KEGG   Phalaenopsis equestris: 110036259Help
Entry
110036259         CDS       T05601                                 

Definition
(RefSeq) wall-associated receptor kinase 5-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
peq  Phalaenopsis equestris
Brite
KEGG Orthology (KO) [BR:peq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:peq01001]
    110036259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase GUB_WAK_bind EGF_3 EGF_CA hEGF S_locus_glycop PIP49_C ABC1 cEGF WAK IL33
Motif
Other DBs
NCBI-GeneID: 110036259
NCBI-ProteinID: XP_020596322
Position
Unknown
AA seq 644 aa AA seqDB search
MHLHEGTKRTPPMASLPPHSSISLSQPLPETCSSFCGHIKISFPFGLSPNCSLPGFQLSC
KFRQPPLPPLLSLPGTKLRILNIFNGELRIDSSPFIASHCAGDHITLAHLTLPQTGPFTF
SGSSNRFIGIGCDTAAVISDGDGKFTSGCVSLCPSPERIPGATVAGDCSGVGCCEAAVPY
GRRRLSLGASSVFGYVNVSAFDNCSYSFVSENGAYEFKLEDLRDFKSRANVSARLEWAIG
DGAGCSSPHFCGENSYCVSSPRGSGYLCNCLQGFKGNAYLNGSYGCQDVNECMNPNASPC
VPEARCQNLVPGYKCSCPFATTGDGTRNRSGCRKIFPIVEAILGTALVIGAILILGLWIY
FSQKQRSLIKQREQYFRKNGGLLLLRQQLSINEGLADSSRIFSSEELQRATAGYSDTHII
GTSSYGKVYRGILDDGRTVAVKTLRAMERSQIEQFVNEVVILSNINHQNIVRLIGCCLET
KSPMLVYEFAAYGSLYKQLHERDFSHGSRLSWKDRVRIALETAEALAFLNSAASISILHQ
DVKSLNILLDDNFTAKIADFGISSLVLADQTEMPPLGQGSFGYLDPEHFQSSQLTANSDV
YSFGIILVELLTGQKPISISMERPKEDGNLAMYFLSSLKCKELK
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgcacttacatgaaggaacgaaacgaacacctcccatggcttctcttcctcctcattca
tccatcagtctttctcaaccattaccagaaacctgctcctccttctgcggccacataaaa
atttctttccctttcggcctcagccccaactgttccctccctggtttccaactctcctgc
aaattccgccaaccaccacttcctcctctcctttccctccccggcaccaaactccgcatc
cttaacattttcaacggcgaactccgcatcgattcatcccccttcattgcctcccactgc
gccggcgaccacatcaccctcgcccatctcacccttcctcaaaccggcccattcaccttt
tcgggttcctcgaaccgcttcatcggcatcggctgcgacaccgccgccgtcatctctgac
ggcgatggcaagttcacaagcggctgcgtctcactctgtcccagcccagagaggattccg
ggcgccacagtagcaggagactgctctggcgtcggatgctgtgaagctgcagttccttat
ggaaggaggcgtctaagcctcggcgcaagcagtgtttttggctacgttaatgtctcggcg
ttcgacaactgcagttactcctttgtgtcggaaaacggtgcgtacgagtttaagttggag
gatttgagggatttcaagagcagagcgaacgtatctgcgaggctggagtgggcgattggc
gacggcgccgggtgttccagcccgcatttctgcggggaaaacagctactgcgtgtcttcg
ccaagaggtagtgggtatctctgtaattgcttgcaggggttcaaggggaacgcatacttg
aatggctcttatggctgccaagatgttaatgagtgcatgaacccgaacgctagcccatgt
gtccccgaagctcgctgccagaacttggttcctgggtacaaatgttcttgtccttttgct
acaactggggatggaaccaggaatcgatctggttgcagaaagatttttccaattgttgaa
gccattctaggaactgctctcgtgattggagcaattcttatattagggctctggatctac
ttttcacaaaagcagagatcgcttatcaaacaaagggagcaatacttcagaaagaacggc
ggcctccttttgctgagacagcaattatccatcaatgaaggcttggctgacagctctaga
atcttctcctccgaagagctgcagcgagccaccgcaggctacagcgacacccatatcatt
ggcacttctagctacggcaaagtatacaggggcatcctcgatgacgggaggacggttgcc
gtaaaaacgttaagagcaatggagcgctcccagatcgaacagttcgtcaacgaagtcgtc
atcctttcaaatatcaaccatcaaaacatcgtaaggcttatcggctgctgccttgaaact
aaatctccaatgctggtctacgagttcgcagcctatggaagtctgtacaagcaactgcat
gagagagactttagccatggtagccgactgtcatggaaggatagagtgaggattgccctt
gagactgctgaggcgcttgctttcctgaattcggcagcatccatatcaatcttgcaccaa
gatgttaaatcgttgaacattttgttggatgataacttcaccgccaagattgcagatttc
ggtatctcaagtttggttcttgcggaccagaccgaaatgcctcctttagggcaggggagc
tttgggtatttggatcctgagcactttcaatcgagccagttgactgcgaacagcgatgtt
tatagcttcgggatcatattagttgagcttctgacgggtcagaagccgatttcaatttcg
atggagagaccgaaggaagatggcaatctggcaatgtactttctgtcctctcttaagtgc
aaggagttgaagtga

DBGET integrated database retrieval system