KEGG   Phalaenopsis equestris: 110036369Help
Entry
110036369         CDS       T05601                                 

Definition
(RefSeq) alpha-humulene synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
peq  Phalaenopsis equestris
Pathway
peq00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    110036369
Enzymes [BR:peq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     110036369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth DNA_pol3_delta2
Motif
Other DBs
NCBI-GeneID: 110036369
NCBI-ProteinID: XP_020596455
Position
Unknown
AA seq 529 aa AA seqDB search
MDTARQSAHFHQSVWGDYFINYSPLQSRTSLAHQKQKNEKLRVEIRKILLDTIDPLQSLE
LIDSMERFGVAYHFEKEISDILCRVHKTNIGDDDDDLYAVALHFRLLRQHKYQITSDVFI
KFLDDKGEFKSPLCNDVRALLSLYEATYLGFPDEEILDKAKNFSRVHLKSSIYNTEPSLA
LMVSSALELPLVRRTNRLKARSYLEIYENYNLCNKKLIDFSKLDFNLLQAIHKEEVQVIS
VWWKQLCLSKYLPFARDRLVESYFWMLAAYSEPSYSHARVINAKIMPLIVATDDIYDIYG
TPEELELFTDIIECWDLERVTMLPEYMQRCFLALYNTLKETEDELAPQHNSFRVCYLKDE
FKNMTRAYLQEAKWASEGHVPTLEEHLRVTLVTSGYLLITYVVYLGMEEVISKDTYEWVS
SFPQIIKSLCIVGRLMNDIGSYQNEQKRNHVASSIQCYAKENGCSELEACKKLREMVEEN
WKIINREFASSNIPLSLIRPTMNLTYFAYFVYKNKTDIYTNSSKFMKKS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggatactgctcgccaatctgcacatttccaccaatctgtttggggagattatttcatc
aactattcacctctacaatcgagaactagtctggcacatcaaaagcaaaagaatgaaaag
cttcgggttgagataaggaagattctcctagataccattgatccattacaatcacttgaa
ctaattgactcaatggaacgttttggagtggcctatcattttgaaaaagaaatcagtgac
atattatgtagagttcataagacgaacattggtgatgatgatgatgatctgtacgcagtt
gcacttcattttcgattattaagacaacacaaatatcaaatcacttctgatgtatttatt
aagtttttggatgataaaggagagttcaaatcacctttatgtaatgatgtgagggctttg
ttaagcttatatgaagcaacttatctgggatttcctgatgaagaaatattagataaagct
aaaaacttttcaagggttcacttgaagtcatccatatacaacacagagccctctttagcc
ctgatggtgtcaagtgctttggaattgccattggttagaagaacaaatcggctcaaggct
agaagctacttggaaatatatgagaattataacttgtgcaataaaaagctaatagatttt
tctaaattagatttcaatctattgcaagctattcataaagaagaagttcaagtaatatca
gtttggtggaaacagttatgcttgtccaaatacctaccatttgcgcgtgatcgattagtg
gaatcatacttttggatgcttgcagcttactctgaaccatcctattcacatgccagagtg
attaatgcgaagattatgccccttattgtggcaactgatgatatctatgacatttacgga
acaccagaagaacttgagttattcaccgacataatagaatgctgggaccttgaaagagtt
actatgttgccagaatatatgcaacgatgcttccttgcactttataatactttgaaggaa
accgaggatgagctagcacctcaacacaattcttttcgcgtttgttatcttaaagacgag
tttaaaaatatgactagagcataccttcaagaagccaaatgggctagcgagggccacgtt
cctacgcttgaggaacatttgagagtaacactagttacttctgggtacttgttaatcact
tacgttgtctatcttggaatggaggaagtgatctcaaaggatacctatgaatgggtttct
agctttcctcaaatcatcaaatcattgtgtatagttgggaggcttatgaatgacattggt
tcttatcaaaatgaacaaaaaaggaatcatgttgcttcatctattcaatgttatgccaag
gaaaatggttgctctgagttggaggcatgcaagaagcttagggaaatggtggaagaaaat
tggaagattattaatagagaatttgcatcaagcaacattccactatcattaattaggcca
accatgaacttgacatactttgcttattttgtttataaaaacaagactgatatttacact
aactcgtcaaagttcatgaagaaatcatga

DBGET integrated database retrieval system