KEGG   Phalaenopsis equestris: 110037276Help
Entry
110037276         CDS       T05601                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL23
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
peq  Phalaenopsis equestris
Brite
KEGG Orthology (KO) [BR:peq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:peq01001]
    110037276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr zf-CCHC PIP49_C
Motif
Other DBs
NCBI-GeneID: 110037276
NCBI-ProteinID: XP_020597538
Position
Unknown
AA seq 497 aa AA seqDB search
MLYGRVQTITLEEVRSLIRAKELQRKHDRDKEVSGDSLIVRGRSDKKDSRNGRYRSGSSK
DGGNQSSRGSFKCYHCHKDGHFKRNCPDRKNKYQEEPEESGEASVVSDDYDSAEALVITE
SKSKKRSDNVKILLLVFITIVIFSENLTFIYIFTESKKHRAVAEEILKMGNGNPTTRVFS
FAELCSATQNFKSDCLLGEGGFGRVYKGHLKDTNQDIAVKQLDRNGLQGNREFLVEVLML
SLLHHPNLVNLLGYCADGDQRILVYEYMPMGSLEDHLLELPPNKKPLDWKTRIKIAQGAA
KGLEYLHEIANPPVIYRDFKASNILLDENYEPKLSDFGLAKVGPIGDKSHVSTRVMGTYG
YCAPEYAMTGQLTTMSDVYSFGVVFLEIITGRRVIDTSRPSGEQNLVQWAEPLFKDKKKF
VEMADPLLEEKYPIKGLYQALAVAAMCLQEEACTRPLITDVVTALEYLALPKLDLDKSKE
RGKEEDINKEKEEDSVQ
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgctctatggaagggtgcaaacaattactctggaggaggttcgatctctgattagagcc
aaagaacttcagaggaagcatgatagggacaaggaagtcagcggagacagtcttattgtc
agaggaagatcggacaagaaagattcaagaaatggtcggtacagatcagggtcaagcaag
gatggcgggaatcagtcatcaaggggatcttttaagtgctatcattgtcacaaagacggt
catttcaagaggaactgccccgacaggaagaataagtatcaagaagagccagaagaatca
ggagaagcaagcgtagtctctgatgactacgattctgctgaggccctggtgatcacagaa
tctaaatccaaaaaaagatctgacaatgttaaaatactcctcctagtttttatcaccata
gtaattttctctgaaaatttaacatttatatatatttttacagaaagtaagaagcataga
gcagtagctgaagagattttaaagatgggcaatggaaatccgactactagagtcttctcc
tttgcagaattatgctctgcaacccaaaactttaaatcagattgtttgcttggtgaaggt
ggatttggaagagtgtacaaaggccatcttaaagacacaaatcaggatattgcagtcaaa
cagcttgacagaaatggacttcaaggaaatagagagttccttgttgaagtattaatgttg
agccttcttcaccacccaaaccttgtcaacctacttggatattgtgctgatggagatcaa
agaattttggtttatgaatatatgccaatgggttctttagaggatcatctcctggaattg
ccaccaaacaagaagccattagattggaaaacaaggataaagatagcccaaggtgcagca
aagggcctggaatacttacatgaaatagcaaatccaccggtgatatatcgagatttcaaa
gcatcaaatattcttctcgatgagaactacgaaccaaagttatctgattttggcttggct
aaggttggtcccattggggacaaaagtcatgtgtccactagagtgatgggtacttatggc
tattgtgcaccggagtatgccatgactggccaactaacaacaatgtcagacgtgtatagc
tttggtgttgtgttcttggaaataataacgggaaggagagtaatcgatacctccaggcct
tcaggagagcaaaatctagtgcaatgggcagaaccacttttcaaagacaaaaagaaattt
gtggagatggcagatcctttgcttgaggaaaagtatcccataaaagggctataccaagct
cttgcagttgcagcaatgtgccttcaagaagaagcatgcactcgtcccctcataaccgat
gtcgtgaccgctctcgaatatcttgctctccctaagctcgacctagataaatcgaaggaa
agggggaaagaagaggatattaacaaggagaaagaagaggactctgtgcagtga

DBGET integrated database retrieval system