KEGG   Phalaenopsis equestris: 110038897Help
Entry
110038897         CDS       T05601                                 

Definition
(RefSeq) tyrosine decarboxylase 1 isoform X1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
peq  Phalaenopsis equestris
Pathway
peq00350  Tyrosine metabolism
peq00360  Phenylalanine metabolism
peq00380  Tryptophan metabolism
peq00950  Isoquinoline alkaloid biosynthesis
peq00965  Betalain biosynthesis
peq01100  Metabolic pathways
peq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:peq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110038897
   00360 Phenylalanine metabolism
    110038897
   00380 Tryptophan metabolism
    110038897
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    110038897
   00950 Isoquinoline alkaloid biosynthesis
    110038897
   00965 Betalain biosynthesis
    110038897
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:peq04147]
    110038897
Enzymes [BR:peq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     110038897
    4.1.1.105  L-tryptophan decarboxylase
     110038897
Exosome [BR:peq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110038897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase URO-D
Motif
Other DBs
NCBI-GeneID: 110038897
NCBI-ProteinID: XP_020599475
Position
Unknown
AA seq 487 aa AA seqDB search
MESRLKPMDAEQLRENAHMMVDFIADYYKNLESFPVLSQVKPNYLCELLPDSAPQRPESL
QDILKDVHEKIIPGVTHWQSPNYFAYYPCNSSIAGFLGEMLSAGFNIVGFSWIASPAATE
LETIVLDWVAKMLKLPNQFLSSGLGGGVIQGTASEAVLVALLAARDKILRRVGKECLNQL
IVYASDQAHSALQKACQIAGIYPENLRLLKAEPSSSYALASDLLSEAIANDFSSGLIPFF
LCATVGTTSSAAVDPLSDLGKIATARDVWFHVDAAYAGSACICPEYRHCINGVEEADSFG
MNAHKWLLTNFDCSLLWVKDRSALIQSLSTNPEFLKNKASQEKAVTDFKDWQIPLGRRFR
SLKLWMVLRMYGQENLQNYIRNHINLAKQFEQLVQSDSRFEVMAPRTFSLVCFRLIPPSN
HEDNGYKLNYSLMDAINTGGKIFLSHTVLSGKFVLRFAVGAPLTEEKHVREAWKVLQKQA
DALLGDI
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggaaagccgtttgaagcctatggacgcggagcagttgagagagaatgcccatatgatg
gtggatttcattgccgattactacaaaaatctggaaagcttccccgttctgagccaggtt
aagcctaattatctttgcgagcttcttcctgattccgccccacaacggcctgaaagtttg
caggacattcttaaggatgttcatgaaaagatcattcctggtgtcacccactggcagagc
ccaaactattttgcttattatccttgcaatagcagcattgctggatttcttggagaaatg
ctcagtgctggctttaatattgtgggcttcagctggatagcctcccctgctgcaacagag
ttagagactattgtcttggattgggttgctaaaatgttgaagctaccaaatcagttcctt
tcttcagggcttggtggtggagtaattcaaggtacagcaagtgaagcagttcttgttgct
ttgttggctgctcgtgataaaatactgagaagggttggaaaggagtgtctaaatcaactc
attgtttatgcttctgatcaagcccattctgcgttgcagaaggcatgccagattgcagga
atttatccagaaaaccttaggcttttaaaggctgaaccaagttcaagctatgcacttgct
tctgacttactctctgaagcaattgccaacgatttctcatcaggcttgatacccttcttc
ctctgtgctacagttgggacaacatcttctgctgcagttgatcctttatctgatctaggg
aagatagctacggccagagacgtgtggttccatgttgatgctgcatatgctggcagtgct
tgtatttgccctgagtaccgtcactgtattaatggcgtggaagaagctgattcatttgga
atgaatgcacataaatggttgctaacaaattttgattgctccttgctttgggttaaggac
cgaagtgcgctcattcaatccctgtccactaatccagaatttcttaaaaataaggcatct
caggagaaggcagttaccgatttcaaagactggcaaattcctttaggacgtcgtttcaga
tctttaaagctatggatggttttgagaatgtatggccaggaaaatctgcaaaattacatc
cgtaaccacataaaccttgcaaaacagtttgaacaacttgtccagtctgattcaaggttt
gaggttatggcccctcgaacattctctcttgtttgtttccgcctcatcccaccttcaaat
catgaagacaacggctataagctgaactacagcttaatggatgctatcaacacaggcgga
aaaatctttctatctcacacggttctgtcggggaagtttgtgttgcggtttgctgtggga
gctccattgacagaagagaaacatgttagggaagcttggaaggttttacagaagcaggct
gatgctctcttgggtgatatttaa

DBGET integrated database retrieval system