KEGG   Candidatus Sodalis pierantonius: SOPEG_2117Help
Entry
SOPEG_2117        CDS       T03006                                 

Gene name
argI
Definition
(GenBank) ornithine carbamoyltransferase subunit I
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
pes  Candidatus Sodalis pierantonius
Pathway
pes00220  Arginine biosynthesis
pes01100  Metabolic pathways
pes01110  Biosynthesis of secondary metabolites
pes01130  Biosynthesis of antibiotics
pes01230  Biosynthesis of amino acids
Module
pes_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:pes00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SOPEG_2117 (argI)
Enzymes [BR:pes01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     SOPEG_2117 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AHF74013
UniProt: W0HPI2
Position
complement(2224133..2225149)
Genome map
AA seq 338 aa AA seqDB search
MNQLVQRNLLRLMDFTSAEINQLLMLAADLKRQKRAGGETPRLAGKNIALIFEKDSTRTR
CSFEVAAFDQGARVTYLGPSGSQIGHKESIKDTARVLGRMYDGIQYRGYGQGIVETLARH
AGVPVWNGLTTEFHPTQLLADLMTMQEYLPEKTFNQMSLAYVGDARNNMGNTLLEAAALT
GIDLRLVAPSACWPDQELVTTCRRLAQQNGGDITLTEDIAAGVQTVDFIYTDVWVSMGED
KSIWQERITLLRAYQVNMAMLRQTGNPRVKFLHCLPAFHDDQTTLGRQMAEQYGLAGGME
VTDEVFESAHSVVFDQVENRLHTIKAVMVATLTQPSAG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagttagttcaacgcaatttgctgaggttaatggattttacctctgctgaaatt
aatcagttactgatgctggccgccgacctgaagcgccagaagcgcgccggcggcgagacg
ccgcgcctggccggtaaaaatattgcgctcatcttcgaaaaagattcgacccgtacccgc
tgctctttcgaagttgccgcctttgatcagggtgcccgcgttacctatttggggccgagc
ggtagccagataggccataaagaatccataaaggataccgctcgggtactaggccgtatg
tatgacggaattcaataccgcggctatggccaagggatcgtcgaaacgctggcgcgtcat
gccggcgtgccggtatggaacgggcttacgaccgagttccatcctacccaattgctggct
gacctgatgaccatgcaggaatatttgccggaaaaaacttttaatcaaatgtcactggcc
tatgtcggcgatgcgcgcaataacatgggcaatacgctgctggaagcggcggcgctaacc
ggtatcgatttgcggttggtggcgccgagcgcctgctggccggatcaagagctggtgaca
acctgtcgtcgattggcgcagcaaaacggcggcgatattacccttaccgaagatatcgcc
gccggcgtgcagacggtggactttatctataccgatgtgtgggtatccatgggcgaggac
aaaagcatatggcaggaacgcatcacgcttctgcgcgcctatcaggtcaatatggccatg
ctgcgtcagaccggcaatccacgggtgaagtttttgcactgtctgcccgcgttccatgac
gatcaaaccaccctcggcaggcaaatggcggaacaatacggcttggcgggcggcatggaa
gtgaccgacgaggtatttgagtccgcgcacagcgtggtgttcgatcaggtggaaaaccgc
ctgcataccatcaaagccgtcatggtggcgacgctgacgcagccgtcagccggttaa

DBGET integrated database retrieval system