KEGG   Candidatus Sodalis pierantonius: SOPEG_3433Help
Entry
SOPEG_3433        CDS       T03006                                 

Gene name
recB
Definition
(GenBank) exonuclease V subunit beta
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
pes  Candidatus Sodalis pierantonius
Pathway
pes03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pes00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SOPEG_3433 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pes03400]
    SOPEG_3433 (recB)
Enzymes [BR:pes01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SOPEG_3433 (recB)
DNA repair and recombination proteins [BR:pes03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SOPEG_3433 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 PDDEXK_1 ResIII
Motif
Other DBs
NCBI-ProteinID: AHF74746
UniProt: W0HLG7
Position
complement(3717395..3720949)
Genome map
AA seq 1184 aa AA seqDB search
MMTAESLNPLTLPLQGARLIEASAGTGKTYTLAALYLRLLLGLGGEAAYPRPLSVEEILV
VTFTETVTEELRGRIRDSIHRLRLVCVRGKSEDPLLAALLAQLGCLRLAALHLLAAERQM
DEAAIYTIHGFCQRMLNHNAVESGMLFQQTLLEDESFLRQQVSADFWRRHCYPLPLDVAR
MVQQHWEGPENLLAELLPYLQGEPPVVRDPPDISESILARHGRIIAGIEDLKRQWRAASA
TLRTMLDGHKLDRRVYSSKNLPTWLAKVDRWASEPTVDYQVPDELVRFKSSVLAEKTTAG
EPPRHELFAAVEAFYQHRLSLRELIFVMALAEMRQALEQEKRRRAEMGFDDLLSRLDRAL
AGGGGEALAASVRTRYPVAMIDEFQDTDPQQYRIFRRIYGDQPGCGLLLIGDPKQAIYAF
RGADIFTYMRARSEVDAHYTLDTNWRSAPGMINAVNQLFQSLPSPFIFNDIPFMPVASAA
GNADLRLVVRHQPQPALRVWLQPGAGVGVSEYQQCMARQCAATIRDWLYAAREGEAWLEG
RRGCQPLQASDITVLVRNRNEAALIRDALAALMIPAVYLSNRDSVFETPEARELQWILQA
VLTPEKDTALRCALATGLLGFDAATIDALNNDERRWEQRVEEFADYRQRWQKTGVLPMLR
QMMINHRIAESLLASQGGERRLTDVLHLGELLQEASTQLENEFALVRWLALQVESPNPQA
TNQQLRLESDRHLVQIITVHKSKGLEFPLVFLPFAADFRVQRRPLFHDRQAYGAWLDLSA
AQESLRLAEEERLAEDLRLFYVALTRSIYHCSLGIAPLYRGSRKKTGASDLHLSAPGYLI
QQGQDGDADDLHDRLVALVARADGDIALCEAQAEPAQPLRPAPEPAPAVSARSWPAPPRD
PWRVTSYSGLQRHGSSVVMELQPRLDVDAAGEGGQQERLQLTPHTFPRGASPGTFLHGLF
ETLDFNRSLDPKCLSEQLAQQGIDAVWLPVLTHWMESIIAMPLDGGSLSLAHLAPDSRLA
ELPFYLPIDAVVQARDLDLLCKRYDPLSARCPPLDFPQVKGMLKGFIDLVFRWQGRYYLL
DYKSNWLGEESTAYTLPAMEQAMIAHRYELQYQLYTLALHRFLRHRLVDYDYQRDFGGVY
YLFLRGIDAAQPGNGVFHCRPDMALIDGLDRLFTGEMRPAAQSG
NT seq 3555 nt NT seq  +upstreamnt  +downstreamnt
ctgatgaccgccgagagccttaaccctctcacgttaccgctacagggcgctcgtctcatc
gaagcgtcggcgggaacgggaaaaacctataccctggcagcgctttatctgcggctgctg
cttgggctgggcggcgaggcggcgtacccgcggcccttgagcgtggaagaaatattggtg
gtgacctttaccgagaccgtcaccgaggagctgcgcggccgtatccgcgacagtattcat
cggttgcggctggtctgtgtgcggggtaagagtgaggatccgctgctggcggcgctgctg
gcgcagctcggctgtctgcggctggccgcattgcatttgctggcggcggagcggcagatg
gacgaggcggcaatttataccatccatggcttctgccagcgcatgctgaatcacaatgct
gtcgaatccggcatgttatttcagcaaaccttgctggaggatgaatcgtttttgcgccag
caggtgagcgctgacttctggcgccgccactgctatccgttgccgctggacgttgcgcgc
atggtgcagcagcactgggaggggccggaaaatctgctggcggaactgctgccttatctt
cagggcgagccgccggtggtgcgtgatccgcccgatatcagcgagtctatcttggcgcgt
catgggcgcatcattgccggcattgaagacctcaagcgacaatggcgcgcggcgtcagcg
acgcttaggacgatgctcgacggtcataaactcgaccgtcgggtgtatagcagcaaaaat
ctgccgacctggcttgcgaaagtcgaccgctgggcgagtgagcccaccgtggattatcag
gtgccggatgagctggtgcggtttaaaagctcggtgctggcggaaaaaactaccgccggg
gagccgcctcggcatgaactgtttgccgcggtggaggccttttatcagcataggctctcg
ctgcgcgagctgattttcgtcatggcgctggcggaaatgcgtcaggcgctggagcaggaa
aaaaggcggcgcgcggagatggggttcgacgatttgctgagtcgcctggaccgggcgctg
gccggcggtggcggtgaagccctggccgcgtcggtgcgcacacgctatccggtggcgatg
atcgatgagtttcaggataccgacccgcagcagtaccgtattttccgccgaatttacggc
gatcagcccggctgcggcctgctgttgataggcgacccgaaacaggctatctatgcattt
cgcggcgcggatattttcacctatatgcgcgcccgcagtgaagtggatgctcactatacc
cttgataccaactggcgttccgcgccggggatgatcaatgcggtcaatcaactgttccaa
agcttgccgtcgccgtttattttcaatgatattccctttatgccggtggcgtctgccgcg
ggcaatgccgacctgcggctggtggtgcggcatcagcctcagccggcgctgcgcgtctgg
ctacagccgggcgccggtgtaggcgtaagcgagtaccaacaatgcatggcgcgccagtgt
gccgccaccattcgcgactggctttacgccgcgcgcgaaggcgaagcctggcttgaaggg
cgtcggggctgtcagccgctgcaggcgtcggatattacggtactggtgcgcaaccgcaac
gaggcggcgctgatacgcgacgcgctggcggcgctgatgatcccggcggtgtatctctcc
aaccgggacagcgtcttcgagacgcccgaggcgcgcgaactgcaatggatccttcaggcg
gtgttgacgccggagaaggataccgcgctgcgctgcgcgctggccaccgggctgctgggt
tttgatgccgcgactattgatgcgctgaataacgatgaacgccgctgggagcagcgggtt
gaagagtttgccgactatcgccagcgctggcaaaaaaccggcgtactaccgatgctgcgt
caaatgatgataaaccatcgcatcgcggaaagcctgttggcaagtcaggggggcgaacgc
cggctgaccgacgtactgcatttgggagaactgctacaggaagcctcgacgcaactggag
aacgaatttgcgctggtccgctggctggcgctgcaagtggaatcccctaatccacaggcg
acgaatcagcaattgcggctggaaagcgatcgtcatctggtgcaaatcattacggtgcat
aaatccaaaggtctagagttcccgctggtgttcctgccgttcgcggccgattttcgcgtg
caaaggcggccgctgtttcacgatcgccaggcgtacggagcctggctggatctcagcgcg
gcgcaagagagtttacggctggcggaggaggagcggctggcggaagatttgcgtctgttt
tacgtggcgctaacgcgttctatctaccattgcagtctgggcatcgcgccgttgtatcgc
ggcagccgcaaaaaaaccggcgccagcgatctgcatttgagcgcacccggctacctgatt
cagcaggggcaggatggcgatgcggatgacctgcacgatcggctggtagcgttggtggcg
cgcgccgacggagatattgccctgtgcgaggcgcaggccgagccggcgcaaccgctgaga
cccgcccccgagcccgctcccgcggtaagcgcccgcagctggcccgcgccgccgcgcgat
ccctggcgggtcaccagctattccggtctgcaacggcacggcagctcggtggtgatggag
ttgcaaccgcggttggacgtggatgccgcgggagagggcgggcagcaggaaaggctacag
ttgacgccgcatacctttccgcgcggcgcgtcgccggggacgtttttgcacggtctattt
gaaacgttggatttcaaccggtcgttggacccgaagtgcctgagtgaacagctggcgcag
cagggcatcgacgccgtttggctgccggtgctaacgcactggatggaaagcattatcgcc
atgccgctggatggcgggtcgctttctctcgcgcatctggcgcccgacagccgccttgct
gaattgccgttttatctgcctatcgacgcggtggtgcaggcgcgcgatctggatctgctc
tgcaagcgctacgatccgctttcggcacgctgcccaccgctggattttccgcaggtcaaa
gggatgctgaaagggtttatcgacctggttttccgctggcaaggccgttattacctgctg
gactataaatccaactggctgggagaggagagtaccgcctacaccttgccggcgatggaa
caggcgatgatcgcccatcgttatgagttgcagtaccagctttatacgctggcgctgcat
cgctttttgcgccaccgcctggtggattatgattaccagcgcgatttcggcggggtatat
tatctgtttctgcgcggcatcgacgcagcgcaaccgggaaatggcgtgtttcattgccgg
ccggacatggccttaatcgacggacttgaccgcttattcaccggcgaaatgcggccggcg
gcgcaaagcggctaa

DBGET integrated database retrieval system