KEGG   Candidatus Sodalis pierantonius: SOPEG_3716Help
Entry
SOPEG_3716        CDS       T03006                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
pes  Candidatus Sodalis pierantonius
Pathway
pes00561  Glycerolipid metabolism
pes00640  Propanoate metabolism
pes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pes00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SOPEG_3716 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SOPEG_3716 (gldA)
Enzymes [BR:pes01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SOPEG_3716 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AHF74898
UniProt: W0HRV5
Position
complement(4037303..4038403)
Genome map
AA seq 366 aa AA seqDB search
MRNFIFSSPGKYVQGSGVLDELGHYLSALGSKAFLIADDVVWGITGERVQTTLKKADIAY
NYERFNGEASGNEILRLAGVARDAQTSVVVSLGGGKTLDTAKAVADELKHPVAIVPTVAS
TDAPCSALSVIYSDDGVFDSYRFYNKNPELVLVDTAVCAQAPVRLFTSGIADGLATYVEA
QAVKRTNALSMVGGKPTIAGMAIAAACEETLLTYGYSAYQAVAKRKVTPAVEALVEANTL
LSGLGFENGGLAGAHAIHNGFTAIQGNIHHLTHGEKVAYGTLTHMVLEQRPDDEIARYIR
FYRQIAMPTTLKAIHLENEPYENLVKVGALACSEGDTLRNLNAYRSAEDVAQAIIAVDAF
SRTLAD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagaaactttattttttcgtcaccaggaaaatacgtccagggcagcggcgtcctggat
gaattgggtcattatctgtccgccctgggcagcaaagcctttctcatcgccgacgatgtg
gtatggggtattaccggcgagcgggtgcagaccacgttaaaaaaagccgatattgcttac
aattatgaacgtttcaacggcgaagcatcgggcaacgaaatcctccggctagcgggggtg
gcccgcgatgcgcaaacgtccgtggtggtcagtctcggcggcggtaaaacgctggatacc
gccaaagcggtcgcggatgagttgaaacatccggtggctatcgtgccgacggtcgcctcc
accgacgccccatgtagtgctctgtcggtcatctatagcgacgacggcgttttcgatagc
taccgcttttacaacaaaaacccggaattggtgctggtggacaccgccgtttgcgcccag
gcgccggtgcggctgttcacctcgggcatcgccgacggcctggccacctacgtggaggcc
caggcggtcaaacgcacgaacgccctgtcgatggtcggcggcaaaccgaccatcgccgga
atggcgatagccgcagcctgcgaggagaccttgctcacctatggctatagcgcctatcag
gcggtcgctaagcgcaaagtcacgccggcggtggaggcgttggtggaagccaataccttg
ctttccggcctgggttttgaaaacggcggtctggccggcgcccacgcgatccacaacggt
tttaccgccattcaggggaatattcatcatttgacccacggtgaaaaagtcgcctacggc
acgttgacccatatggtgctggagcagcgcccggatgacgaaattgcccgctacatccgt
ttttaccgccaaattgccatgccgaccacgcttaaggctatccacctggaaaacgagccc
tatgaaaacctggtgaaagtgggcgcgctggcctgcagcgaaggggacaccttgcgtaac
ttgaacgcttatcgcagcgctgaagacgtggcgcaggcgataatcgccgtcgacgcgttc
agccgcacccttgccgattga

DBGET integrated database retrieval system