KEGG   Petrimonas sp. IBARAKI: PEIBARAKI_4175Help
Entry
PEIBARAKI_4175    CDS       T05132                                 

Definition
(GenBank) Hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
pet  Petrimonas sp. IBARAKI
Pathway
pet00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:pet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PEIBARAKI_4175
Enzymes [BR:pet01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     PEIBARAKI_4175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2 GRIM-19
Motif
Other DBs
NCBI-ProteinID: BBD44182
UniProt: A0A3G9E370
Position
complement(223374..224054)
Genome map
AA seq 226 aa AA seqDB search
MKRSEVNQIIEGAKAFLADHRFHLPPWAYWSLSDWKKNKDSVAEVMDNMLGWDITDFGSG
DFYKRGLFLFTLRNGKYNVDKKPYAEKIMIVEENQETPMHFHWAKMEDIINRGGGNLVIE
LYNTTSDDLLDETTPIRLKTDGVERVAEPGGKVILQPGESICLEQGVYHRFYGEPGKGKV
LVGEVSTVNDDTADNRFHETIGRFPQIIEDEEPIHLLVSDYVKFIG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtagcgaagttaatcagattattgaaggagcgaaagcatttttagctgatcat
cggttccacttgcccccctgggcctattggtctctttcagactggaaaaagaacaaggac
tctgtagcagaagttatggacaatatgctggggtgggacataaccgattttggttccggt
gatttttacaagagaggactcttcctgttcacattgcggaatgggaaatataatgtggat
aagaaaccctatgctgagaagataatgattgtggaggaaaatcaggaaacgcctatgcat
ttccactgggcaaaaatggaggatatcatcaatcgtggtggaggcaatctggtaatagaa
ctttacaatacgacatccgatgatttactggatgaaacgacaccgatacggttaaaaacc
gatggagtagagagagttgctgaacccggtgggaaggtgattttacaacccggagaaagt
atttgtctcgagcagggtgtctatcaccgattttatggagagcccggaaaaggaaaagtc
cttgtaggtgaagttagtacagtaaacgatgatactgccgacaatcgtttccacgaaaca
ataggacgattcccgcaaattattgaggacgaagaaccaatccatctgttagtatcagat
tatgtaaagtttatcgggtaa

DBGET integrated database retrieval system