KEGG   Populus euphratica (Euphrates poplar): 105121788
Entry
105121788         CDS       T05872                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
peu  Populus euphratica (Euphrates poplar)
Pathway
peu00100  Steroid biosynthesis
peu01100  Metabolic pathways
peu01110  Biosynthesis of secondary metabolites
Module
peu_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:peu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    105121788
Enzymes [BR:peu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     105121788
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 105121788
NCBI-ProteinID: XP_011018879
Position
Unknown
AA seq 367 aa
MDLDYLLVIPSWKSVGILVTFFTYLAVAGSVLPAKLVPGVTLQDGSRLHYRCNGLFSMLL
LVLLLGVGAKMELLSLTVISERGLELLSATFIFSFLVALALYAAGCKSRNQSSSLKPCVT
GNLIHDWWFGVQLNPSFLGIDLKFFFVRSGMMGWLFINLSVLAKTIQGATLSHSMILYQI
FCLIYILDYFFYEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLGNKVELTTA
AVIANCFVFLIGYLVFRGANKQKHVFKKNPKAFIWGKPPKVVGGKLLASGYWGVARHCNY
LGDLLLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEARCAEKYKEVWVEYRRLVPW
RILPYVY
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggatctggattatcttctcgtaattccctcttggaaatctgttggtatacttgtaaca
ttctttacttacctcgctgttgctggatctgtactccctgccaaactggttcccggcgtc
actttacaagacggctctcgtctccattatcgttgcaatgggctgttctcaatgctgttg
ctggttctgcttcttggtgttggtgctaagatggaacttttatcgcttactgtgatatca
gagagaggactcgagctcctatcggcaacattcattttcagttttcttgtggcattagca
ctctatgctgctggttgcaagtcacgaaatcagagttcttcccttaagccttgtgttaca
ggaaacctaatacatgactggtggtttggagtacagctcaatccttcttttttgggcatt
gacctcaaattcttctttgttagatctggaatgatgggatggttatttatcaatctatca
gttctagcaaaaactattcagggcgccaccttgagccattcgatgatcctctaccaaata
ttctgtctgatatacatcctggactacttcttttatgaggagtacatgacctccacatgg
gacataattgctgagagattgggcttcatgttggtgtttggagacctggtctggattcct
tttactttcagcatccagggttggtggcttttgggtaacaaagtggagttgacaactgct
gctgttatagcaaattgctttgttttcctgattggatatctggtatttagaggagccaac
aagcaaaagcatgtcttcaagaagaatcccaaagcatttatatgggggaagccaccaaag
gttgttggggggaagctgcttgcttctggttattggggggtcgcaaggcattgtaattac
ctgggtgacctattgttggcactatcctttagtctgccttgtggaataagttctccagtc
ccatacttttaccctatatatcttcttatccttctaatatggagagaaaggagagacgag
gctcgatgtgcagagaagtacaaagaagtatgggtggaataccgcagacttgttccatgg
agaatactgccatacgtttactga

DBGET integrated database retrieval system