GenomeNet

Database: Pfam
Entry: Adeno_E3_CR2
LinkDB: Adeno_E3_CR2
Original site: Adeno_E3_CR2 
#=GF ID   Adeno_E3_CR2
#=GF AC   PF02439.18
#=GF DE   Adenovirus E3 region protein CR2
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_1854 (release 5.4)
#=GF GA   36.00 36.00;
#=GF TC   36.10 58.40;
#=GF NC   35.30 29.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   8627757
#=GF RT   Early region 3 of adenovirus type 19 (subgroup D) encodes an
#=GF RT   HLA-binding protein distinct from that of subgroups B and C. 
#=GF RA   Deryckere F, Burgert HG; 
#=GF RL   J Virol 1996;70:2832-2841.
#=GF DR   INTERPRO; IPR003470;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   Early region 3 (E3) of human adenoviruses (Ads) codes for
#=GF CC   proteins that appear to control viral interactions with the host
#=GF CC   [1]. This region called CR2 (conserved region 1) [1] is found in
#=GF CC   Adenovirus type 19 (a subgroup D virus) 49 Kd protein in the E3
#=GF CC   region. CR2 is also found in the 20.1 Kd protein of subgroup B
#=GF CC   adenoviruses. The function of this 50 amino acid region is
#=GF CC   unknown.
#=GF SQ   12
#=GS Q2Y0G3_ADE03/145-181      AC Q2Y0G3.1
#=GS Q6QP94_9ADEN/159-196      AC Q6QP94.1
#=GS Q9PX39_ADE07/145-181      AC Q9PX39.1
#=GS Q2Y0G4_ADE03/135-171      AC Q2Y0G4.1
#=GS A0A1W2KEW8_ADE04/164-202  AC A0A1W2KEW8.1
#=GS B9A6D9_9ADEN/381-419      AC B9A6D9.1
#=GS A0A1W6HVJ9_9ADEN/28-65    AC A0A1W6HVJ9.1
#=GS Q9PX68_ADE07/135-171      AC Q9PX68.1
#=GS A0A3G9JU39_ADE04/170-208  AC A0A3G9JU39.1
#=GS E1AI32_9ADEN/362-400      AC E1AI32.1
#=GS K7ZQ33_ADE08/357-395      AC K7ZQ33.1
#=GS Q6QP95_9ADEN/160-198      AC Q6QP95.1
Q2Y0G3_ADE03/145-181                 IPKSTIGIITAVVVGLMIIFLCIMYYACCYRKHE-Q.K-g
Q6QP94_9ADEN/159-196                 CPGLLVSGIVGVLSGLAVIIICMFIFACCYRRLYRQ.KS.
Q9PX39_ADE07/145-181                 IPKSTIGIITAVVVGLIIIFLCIMYYACCYRKHE-Q.K-g
Q2Y0G4_ADE03/135-171                 IPNSMIAIIAAVALGMALIIICMLLYACYYKKFQ-H.KQ.
A0A1W2KEW8_ADE04/164-202             IPRSMIGIIAAVVVCMVIIILCMMYYACYYRKHRLNnK-l
B9A6D9_9ADEN/381-419                 IPSTTVAIVVGVIAGFITLIIVFICYICCRKRPRAYnHM.
A0A1W6HVJ9_9ADEN/28-65               IPDSMIAIIAAVAVVMALPVICMLLYACRYKKFHPK.KQ.
Q9PX68_ADE07/135-171                 IPNSMIAIIAAVALGMALIIICMFLYACCYKKFQ-H.KQ.
A0A3G9JU39_ADE04/170-208             IPRSMIGIIAAVVVCMVIIILCMMYYACYYRKHRLNnK-l
E1AI32_9ADEN/362-400                 IPSATVAIVVGVIAGFVTLIIVFICYICCRKRPRSYnHM.
K7ZQ33_ADE08/357-395                 IPSATVAIVAGVIAGFVTLIIVFLCYICCRKRSRAYnHM.
Q6QP95_9ADEN/160-198                 IPRSMIGIIVAVVVCMLIIALCMVYYAFCYRKHRLNdK-l
#=GC seq_cons                        IPpShIuIIsAVllGhslIIlChhhYACCY+Kac.p.K..
//
DBGET integrated database retrieval system