GenomeNet

Database: Pfam
Entry: Adeno_knob
LinkDB: Adeno_knob
Original site: Adeno_knob 
#=GF ID   Adeno_knob
#=GF AC   PF00541.16
#=GF DE   Adenoviral fibre protein (knob domain)
#=GF PI   adeno_fiber; 
#=GF AU   Bateman A
#=GF SE   SCOP
#=GF GA   25.00 25.00;
#=GF TC   417.40 417.40;
#=GF NC   24.30 19.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   7704534
#=GF RT   Crystal structure of the receptor-binding domain of adenovirus
#=GF RT   type 5 fiber protein at 1.7 A resolution. 
#=GF RA   Xia D, Henry LJ, Gerard RD, Deisenhofer J; 
#=GF RL   Structure 1994;2:1259-1270.
#=GF DR   INTERPRO; IPR000978;
#=GF DR   SCOP; 1knb; fa;
#=GF DR   HOMSTRAD; adeno_fiber;
#=GF CC   Specific  attachment of adenovirus is achieved through
#=GF CC   interactions  between host-cell receptors and the adenovirus
#=GF CC   fibre protein and is  mediated by the globular carboxy-terminal
#=GF CC   domain of the adenovirus fibre protein, termed the
#=GF CC   carboxy-terminal knob domain.
#=GF SQ   1
#=GS SPIKE_ADE02/401-578  AC P03275.1
#=GS SPIKE_ADE02/401-578  DR PDB; 1QIU F; 401-578;
#=GS SPIKE_ADE02/401-578  DR PDB; 1QIU D; 401-578;
#=GS SPIKE_ADE02/401-578  DR PDB; 1QIU A; 401-578;
#=GS SPIKE_ADE02/401-578  DR PDB; 1QHV A; 401-578;
#=GS SPIKE_ADE02/401-578  DR PDB; 1QIU B; 401-578;
#=GS SPIKE_ADE02/401-578  DR PDB; 1QIU E; 401-578;
#=GS SPIKE_ADE02/401-578  DR PDB; 1QIU C; 401-578;
SPIKE_ADE02/401-578             LWTTPDPSPNCRIHSDNDCKFTLVLTKCGSQVLATVAALAVSGDLSSMTGTVASVSIFLRFDQNGVLMENSSLKKHYWNFRNGNSTNANPYTNAVGFMPNLLAYPKTQSQTAKNNIVSQVYLHGDKTKPMILTITLNGTSESTETSEVSTYSMSFTWSWESGKYTTETFATNSYTFSY
#=GR SPIKE_ADE02/401-578  SS    EES-SS--S-B-SSSTT-EEEEEEEEEETTEEEEEEEEEESSS-GGGGHSSSSEEEEEEEE-TTS-B-SSSSB-STT-EEEETTEE-SS--S--GGGSB-TTTS-B-SS--GGGEEEEEEEGGG-TTSEEEEEEEESGGGS--STT---SEEEEEEEE-STTTSTTS--BB--EEEEE
#=GC SS_cons                    EES-SS--S-B-SSSTT-EEEEEEEEEETTEEEEEEEEEESSS-GGGGHSSSSEEEEEEEE-TTS-B-SSSSB-STT-EEEETTEE-SS--S--GGGSB-TTTS-B-SS--GGGEEEEEEEGGG-TTSEEEEEEEESGGGS--STT---SEEEEEEEE-STTTSTTS--BB--EEEEE
#=GC seq_cons                   LWTTPDPSPNCRIHSDNDCKFTLVLTKCGSQVLATVAALAVSGDLSSMTGTVASVSIFLRFDQNGVLMENSSLKKHYWNFRNGNSTNANPYTNAVGFMPNLLAYPKTQSQTAKNNIVSQVYLHGDKTKPMILTITLNGTSESTETSEVSTYSMSFTWSWESGKYTTETFATNSYTFSY
//
DBGET integrated database retrieval system