GenomeNet

Database: Pfam
Entry: Bap31
LinkDB: Bap31
Original site: Bap31 
#=GF ID   Bap31
#=GF AC   PF05529.12
#=GF DE   Bap31/Bap29 transmembrane region
#=GF AU   Finn RD;0000-0001-8626-2148
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_6449 (release 8.0)
#=GF GA   22.70 22.70;
#=GF TC   22.70 22.70;
#=GF NC   22.60 22.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   11917123
#=GF RT   The procaspase-8 isoform, procaspase-8L, recruited to the BAP31
#=GF RT   complex at the endoplasmic reticulum. 
#=GF RA   Breckenridge DG, Nguyen M, Kuppig S, Reth M, Shore GC; 
#=GF RL   Proc Natl Acad Sci U S A 2002;99:4331-4336.
#=GF DR   INTERPRO; IPR008417;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   Bap31 is a polytopic integral protein of the endoplasmic
#=GF CC   reticulum membrane and a substrate of caspase-8.  Bap31 is
#=GF CC   cleaved within its cytosolic domain, generating pro-apoptotic
#=GF CC   p20 Bap31 [1]. This family also contains the Bap29 protein that
#=GF CC   forms a heterodimer with Bap 31.
#=GF SQ   1426
#=GS A0A1A6A2S2_9TREE/1-138      AC A0A1A6A2S2.1
#=GS G7JEQ0_MEDTR/1-124          AC G7JEQ0.1
#=GS A0A0D3DJQ9_BRAOL/34-159     AC A0A0D3DJQ9.1
#=GS A0A0W7VRW2_9HYPO/1-143      AC A0A0W7VRW2.1
#=GS A0A087U8K9_9ARAC/1-136      AC A0A087U8K9.1
#=GS A1D1T9_NEOFI/1-142          AC A1D1T9.1
#=GS J3JWC1_DENPD/1-136          AC J3JWC1.1
#=GS A0A152A8S8_9MYCE/1-135      AC A0A152A8S8.1
#=GS Q5E9F1_BOVIN/1-136          AC Q5E9F1.1
#=GS D2VYR5_NAEGR/1-130          AC D2VYR5.1
#=GS F8PN20_SERL3/1-139          AC F8PN20.1
#=GS A0A2H3BY65_9AGAR/1-139      AC A0A2H3BY65.1
#=GS D8SCN0_SELML/1-126          AC D8SCN0.1
#=GS A0A066XUZ0_COLSU/1-142      AC A0A066XUZ0.1
#=GS A0A0F8CAR7_LARCR/1-144      AC A0A0F8CAR7.1
#=GS G2Q1T3_MYCTT/1-142          AC G2Q1T3.1
#=GS A0A0B0NMF7_GOSAR/1-126      AC A0A0B0NMF7.1
#=GS A0A183M7A1_9TREM/1-67       AC A0A183M7A1.1
#=GS A0A1E5R258_9ASCO/1-127      AC A0A1E5R258.1
#=GS YET1_YEAST/1-139            AC P35723.2
#=GS K1S3U6_CRAGI/13-148         AC K1S3U6.1
#=GS A0A286U8M5_9HOMO/1-113      AC A0A286U8M5.1
#=GS A0A022Q5Q3_ERYGU/1-126      AC A0A022Q5Q3.1
#=GS I2K2P5_DEKBR/2-82           AC I2K2P5.1
#=GS A0A096MR05_PAPAN/1-136      AC A0A096MR05.1
#=GS A0A1B9ING5_9TREE/1-126      AC A0A1B9ING5.1
#=GS A0A067QHE8_ZOONE/1-136      AC A0A067QHE8.1
#=GS E7QJ52_YEASZ/1-83           AC E7QJ52.1
#=GS A0A0D7BAR8_9AGAR/1-138      AC A0A0D7BAR8.1
#=GS Q8SVM3_ENCCU/1-120          AC Q8SVM3.1
#=GS B8M2V7_TALSN/1-142          AC B8M2V7.1
#=GS A0A0C2WUD2_AMAMU/1-34       AC A0A0C2WUD2.1
#=GS G0W7F3_NAUDC/1-148          AC G0W7F3.1
#=GS A0A1B8D531_9PEZI/1-140      AC A0A1B8D531.1
#=GS A0A1W4WMW9_AGRPL/1-134      AC A0A1W4WMW9.1
#=GS A0A2I3RWQ2_PANTR/1-137      AC A0A2I3RWQ2.1
#=GS A0A1L8GU26_XENLA/2-138      AC A0A1L8GU26.1
#=GS A0A212EZA4_DANPL/1-64       AC A0A212EZA4.1
#=GS A0A0N4XTN1_NIPBR/6-129      AC A0A0N4XTN1.1
#=GS K2RU84_MACPH/1-143          AC K2RU84.1
#=GS A0A0K9PWU7_ZOSMR/1-124      AC A0A0K9PWU7.1
#=GS A0A1U8B5T1_NELNU/1-127      AC A0A1U8B5T1.1
#=GS A0A1S3XHQ0_TOBAC/1-129      AC A0A1S3XHQ0.1
#=GS I1C0I3_RHIO9/1-139          AC I1C0I3.1
#=GS A0A0D9RG29_CHLSB/1-137      AC A0A0D9RG29.1
#=GS A0A1G4KMI5_9SACH/1-141      AC A0A1G4KMI5.1
#=GS A0A0F7VIC8_9EURO/1-142      AC A0A0F7VIC8.1
#=GS A0A093ZKB8_9PEZI/1-140      AC A0A093ZKB8.1
#=GS Q2LZ83_DROPS/1-134          AC Q2LZ83.1
#=GS A0A226MWQ3_CALSU/3-69       AC A0A226MWQ3.1
#=GS G3JJX0_CORMM/1-177          AC G3JJX0.1
#=GS A0A0L8HKE2_OCTBM/1-138      AC A0A0L8HKE2.1
#=GS Q2HDK8_CHAGB/1-142          AC Q2HDK8.1
#=GS A0A2I3LVA0_PAPAN/1-137      AC A0A2I3LVA0.1
#=GS A0A1F8AEL7_9EURO/1-140      AC A0A1F8AEL7.1
#=GS A0A251S7N8_HELAN/1-127      AC A0A251S7N8.1
#=GS A0A1D2VC73_9ASCO/1-148      AC A0A1D2VC73.1
#=GS L8GQY4_ACACA/1-143          AC L8GQY4.1
#=GS M2N463_BAUCO/1-141          AC M2N463.1
#=GS A0A0E0NKM6_ORYRU/1-127      AC A0A0E0NKM6.1
#=GS F7FTW2_MONDO/1-136          AC F7FTW2.1
#=GS B7Z2L0_HUMAN/1-43           AC B7Z2L0.1
#=GS A0A179UZ95_BLAGS/1-144      AC A0A179UZ95.1
#=GS C5DS01_ZYGRC/1-136          AC C5DS01.1
#=GS A0A091SIV7_9AVES/1-98       AC A0A091SIV7.1
#=GS A0A068Y220_ECHMU/1-139      AC A0A068Y220.1
#=GS C5FUT5_ARTOC/1-141          AC C5FUT5.1
#=GS A0A1J7GIM7_LUPAN/1-126      AC A0A1J7GIM7.1
#=GS K4AGL1_SETIT/1-126          AC K4AGL1.1
#=GS A0A091TFD9_PHALP/1-40       AC A0A091TFD9.1
#=GS A0A0C2WSW0_9HOMO/1-100      AC A0A0C2WSW0.1
#=GS G1TPZ4_RABIT/1-137          AC G1TPZ4.1
#=GS W4H719_9STRA/1-132          AC W4H719.1
#=GS I1P403_ORYGL/1-127          AC I1P403.1
#=GS BAP29_HUMAN/1-137           AC Q9UHQ4.2
#=GS A0A0D2CY66_9EURO/1-143      AC A0A0D2CY66.1
#=GS W1NF89_AMBTC/1-126          AC W1NF89.1
#=GS A0A1Y2GNI7_9FUNG/1-135      AC A0A1Y2GNI7.1
#=GS A0A0P7XI47_9TELE/22-157     AC A0A0P7XI47.1
#=GS A0A1S3KSU5_SALSA/1-136      AC A0A1S3KSU5.1
#=GS A0A0G4PET7_PENCA/1-142      AC A0A0G4PET7.1
#=GS A0A0E0CXS3_9ORYZ/1-126      AC A0A0E0CXS3.1
#=GS A0A093XQE1_9PEZI/1-140      AC A0A093XQE1.1
#=GS U4LFH5_PYROM/1-141          AC U4LFH5.1
#=GS W5PB89_SHEEP/21-156         AC W5PB89.1
#=GS A0A177UC51_9BASI/1-138      AC A0A177UC51.1
#=GS A0A0D2UL16_CAPO3/1-137      AC A0A0D2UL16.1
#=GS A0A1L9URI9_9EURO/1-142      AC A0A1L9URI9.1
#=GS C4XW17_CLAL4/1-139          AC C4XW17.1
#=GS E7NGH9_YEASO/1-140          AC E7NGH9.1
#=GS G3WQU3_SARHA/1-135          AC G3WQU3.1
#=GS H2U7F5_TAKRU/1-150          AC H2U7F5.1
#=GS W2TFV7_NECAM/1-138          AC W2TFV7.1
#=GS A0A0F8B7B9_CERFI/1-143      AC A0A0F8B7B9.1
#=GS N4TFS4_FUSC1/1-143          AC N4TFS4.1
#=GS A0A0W4ZGJ1_PNEJ7/59-155     AC A0A0W4ZGJ1.1
#=GS A0A182P8I2_9DIPT/1-135      AC A0A182P8I2.1
#=GS A0A0N4VQP8_ENTVE/3-61       AC A0A0N4VQP8.1
#=GS Q10PB0_ORYSJ/1-126          AC Q10PB0.1
#=GS YET2_YEAST/1-137            AC Q04210.1
#=GS A0A158QJX3_HAEPC/289-426    AC A0A158QJX3.1
#=GS A0A1D5NXR2_CHICK/1-135      AC A0A1D5NXR2.1
#=GS A0A182T4Z9_9DIPT/1-135      AC A0A182T4Z9.1
#=GS A0A1A9VQ95_GLOAU/1-134      AC A0A1A9VQ95.1
#=GS G3N4Y7_GASAC/1-135          AC G3N4Y7.1
#=GS A0A1E4T9C2_9ASCO/327-473    AC A0A1E4T9C2.1
#=GS A0A165Q614_EXIGL/1-139      AC A0A165Q614.1
#=GS A0A0G2I4H2_9PEZI/1-142      AC A0A0G2I4H2.1
#=GS N4V1B3_COLOR/55-163         AC N4V1B3.1
#=GS A0A084VKW3_ANOSI/1-135      AC A0A084VKW3.1
#=GS A0A168KYG5_MUCCL/1-136      AC A0A168KYG5.1
#=GS A0A1G4IM73_9SACH/1-135      AC A0A1G4IM73.1
#=GS I1KJ86_SOYBN/1-126          AC I1KJ86.1
#=GS G0W5V4_NAUDC/1-134          AC G0W5V4.1
#=GS R1DU44_EMIHU/1-119          AC R1DU44.1
#=GS A0A0P9EXZ3_RHOGW/1-135      AC A0A0P9EXZ3.1
#=GS G4VML3_SCHMA/1-137          AC G4VML3.1
#=GS J4GWB6_9APHY/1-139          AC J4GWB6.1
#=GS A0A1B0BRT6_9MUSC/1-134      AC A0A1B0BRT6.1
#=GS G1KQS7_ANOCA/10-147         AC G1KQS7.2
#=GS A0A1W0E2B9_9MICR/1-79       AC A0A1W0E2B9.1
#=GS J9NUF1_CANLF/1-137          AC J9NUF1.1
#=GS A0A166FZ29_9HOMO/1-138      AC A0A166FZ29.1
#=GS A0A2I0MH75_COLLI/1-99       AC A0A2I0MH75.1
#=GS E2LYY4_MONPE/1-108          AC E2LYY4.1
#=GS A0A026W1Q0_OOCBI/1-136      AC A0A026W1Q0.1
#=GS A0A1U8C1H5_MESAU/1-136      AC A0A1U8C1H5.1
#=GS A0A229XP41_9EURO/1-142      AC A0A229XP41.1
#=GS A0A0K9QC27_SPIOL/1-127      AC A0A0K9QC27.1
#=GS A0A0E0FU53_ORYNI/1-127      AC A0A0E0FU53.1
#=GS I3MB38_ICTTR/1-136          AC I3MB38.2
#=GS J9HYA2_AEDAE/1-140          AC J9HYA2.1
#=GS A0A0V0QUW2_PSEPJ/146-281    AC A0A0V0QUW2.1
#=GS A2GB04_TRIVA/1-131          AC A2GB04.1
#=GS A0A0E0BSC5_9ORYZ/1-104      AC A0A0E0BSC5.1
#=GS Q6C4K4_YARLI/1-137          AC Q6C4K4.1
#=GS A0A0F8UF97_9EURO/1-157      AC A0A0F8UF97.1
#=GS E1Z663_CHLVA/1-137          AC E1Z663.1
#=GS A0A0L6UBF0_9BASI/1-146      AC A0A0L6UBF0.1
#=GS A0A0R3WN21_HYDTA/28-81      AC A0A0R3WN21.1
#=GS W1QHX5_OGAPD/1-141          AC W1QHX5.1
#=GS A0A0E0NS85_ORYRU/1-110      AC A0A0E0NS85.1
#=GS A0A1S3D9Q3_DIACI/1-136      AC A0A1S3D9Q3.1
#=GS A0A178AJ93_9PLEO/1-141      AC A0A178AJ93.1
#=GS C4V808_NOSCE/76-118         AC C4V808.1
#=GS A0A117NRG2_9EURO/1-142      AC A0A117NRG2.1
#=GS A0A1S3JN94_LINUN/1-137      AC A0A1S3JN94.1
#=GS A0A1I8CGJ9_9BILA/1-146      AC A0A1I8CGJ9.1
#=GS A0A2H3JLU4_WOLCO/1-139      AC A0A2H3JLU4.1
#=GS A0A151S0D5_CAJCA/1-124      AC A0A151S0D5.1
#=GS A0A180H1F0_PUCT1/1-140      AC A0A180H1F0.1
#=GS C4QZG4_KOMPG/1-141          AC C4QZG4.1
#=GS A0A1X7RDS8_ZYMTR/1-141      AC A0A1X7RDS8.1
#=GS A0A1D2N0I5_ORCCI/1-134      AC A0A1D2N0I5.1
#=GS A0A2K5J3Q5_COLAP/67-202     AC A0A2K5J3Q5.1
#=GS A0A0V0UX63_9BILA/73-191     AC A0A0V0UX63.1
#=GS K1X0K2_MARBU/1-139          AC K1X0K2.1
#=GS A0A250WSW4_9CHLO/1-134      AC A0A250WSW4.1
#=GS A0A0C9LVF2_9FUNG/324-461    AC A0A0C9LVF2.1
#=GS A0A0N5DVF1_TRIMR/1-137      AC A0A0N5DVF1.1
#=GS E1C310_CHICK/1-137          AC E1C310.1
#=GS BAP31_HUMAN/1-136           AC P51572.3
#=GS A0A0D7A259_9AGAR/1-134      AC A0A0D7A259.1
#=GS S8BYT6_DACHA/1-144          AC S8BYT6.1
#=GS B4HVK3_DROSE/1-134          AC B4HVK3.1
#=GS A0A099NVD5_PICKU/1-119      AC A0A099NVD5.1
#=GS A0A2H0ZKT6_CANAR/1-131      AC A0A2H0ZKT6.1
#=GS A0A177AVH4_9METZ/1-139      AC A0A177AVH4.1
#=GS A0A093E9P2_TAUER/1-137      AC A0A093E9P2.1
#=GS A0A0F4GZP8_9PEZI/1-141      AC A0A0F4GZP8.1
#=GS A0A1D6AQ61_WHEAT/1-127      AC A0A1D6AQ61.1
#=GS A9P9M2_POPTR/1-126          AC A9P9M2.1
#=GS K4BJL4_SOLLC/1-126          AC K4BJL4.1
#=GS A0A182YA26_ANOST/1-135      AC A0A182YA26.1
#=GS A0A068RFM2_9FUNG/1-137      AC A0A068RFM2.1
#=GS G2WT66_VERDV/1-141          AC G2WT66.1
#=GS A0A1W4VSC8_DROFC/1-134      AC A0A1W4VSC8.1
#=GS U1HSH2_ENDPU/1-127          AC U1HSH2.1
#=GS G8Y9N0_PICSO/1-139          AC G8Y9N0.1
#=GS A0A0C2XVX9_HEBCY/1-140      AC A0A0C2XVX9.1
#=GS A0A0R3QT98_9BILA/339-475    AC A0A0R3QT98.1
#=GS F2UBF9_SALR5/1-131          AC F2UBF9.1
#=GS F0ZYQ2_DICPU/1-112          AC F0ZYQ2.1
#=GS A0A166C726_9HOMO/1-124      AC A0A166C726.1
#=GS A0A0P1BLA1_9BASI/27-162     AC A0A0P1BLA1.1
#=GS A0A2I4BXV0_9TELE/1-126      AC A0A2I4BXV0.1
#=GS R9AUW8_WALI9/1-138          AC R9AUW8.1
#=GS A0A0R3TNB8_HYMNN/1-139      AC A0A0R3TNB8.1
#=GS A0A164YZD4_9CRUS/1-139      AC A0A164YZD4.1
#=GS A0A158NXT1_ATTCE/1-135      AC A0A158NXT1.1
#=GS B7XJ91_ENTBH/1-75           AC B7XJ91.1
#=GS A0A1I8ACG0_9BILA/1-136      AC A0A1I8ACG0.1
#=GS A0A0G4KMG9_9PEZI/1-141      AC A0A0G4KMG9.1
#=GS A0A1X2IXD4_9FUNG/1-136      AC A0A1X2IXD4.1
#=GS A0A088AVC4_APIME/1-134      AC A0A088AVC4.1
#=GS R1E7E6_BOTPV/1-143          AC R1E7E6.1
#=GS Q2F602_BOMMO/1-134          AC Q2F602.1
#=GS A9P867_POPTR/2-124          AC A9P867.1
#=GS A0A2B7XBW4_9EURO/1-142      AC A0A2B7XBW4.1
#=GS M1WH41_CLAP2/1-141          AC M1WH41.1
#=GS A0A059EKT0_9MICR/67-117     AC A0A059EKT0.1
#=GS A0A1Y2EXL0_9FUNG/1-138      AC A0A1Y2EXL0.1
#=GS A0A0D1Y9L8_9EURO/1-143      AC A0A0D1Y9L8.1
#=GS I3JBN9_ORENI/1-136          AC I3JBN9.1
#=GS A0A1S3ZX92_TOBAC/1-129      AC A0A1S3ZX92.1
#=GS A0A0B7NUJ3_9FUNG/1-145      AC A0A0B7NUJ3.1
#=GS T0KYJ5_9MICR/1-128          AC T0KYJ5.1
#=GS G1RBM4_NOMLE/1-137          AC G1RBM4.2
#=GS B9T5D1_RICCO/1-126          AC B9T5D1.1
#=GS A0A0C3K298_9HOMO/1-137      AC A0A0C3K298.1
#=GS G7YLX1_CLOSI/24-161         AC G7YLX1.1
#=GS B6K3Q3_SCHJY/1-136          AC B6K3Q3.1
#=GS A0A183IH85_9BILA/1-137      AC A0A183IH85.1
#=GS C9IYK6_HUMAN/1-137          AC C9IYK6.1
#=GS A0A1V4JSQ6_PATFA/29-162     AC A0A1V4JSQ6.1
#=GS M0RRW1_MUSAM/1-126          AC M0RRW1.1
#=GS A0A1A9ZRG5_GLOPL/1-135      AC A0A1A9ZRG5.1
#=GS A0A091P0H6_HALAL/1-137      AC A0A091P0H6.1
#=GS A0A1V8UKA6_9PEZI/1-141      AC A0A1V8UKA6.1
#=GS A0A1B7MJ97_9HOMO/1-140      AC A0A1B7MJ97.1
#=GS G3SAF0_GORGO/1-137          AC G3SAF0.2
#=GS B6QAV1_TALMQ/1-142          AC B6QAV1.1
#=GS A0A0E0NS84_ORYRU/1-126      AC A0A0E0NS84.1
#=GS G3P1V0_GASAC/1-136          AC G3P1V0.1
#=GS E9IC03_SOLIN/1-45           AC E9IC03.1
#=GS D8R629_SELML/1-126          AC D8R629.1
#=GS A0A1B9G033_9TREE/1-138      AC A0A1B9G033.1
#=GS A0A2K1XWB7_POPTR/2-124      AC A0A2K1XWB7.1
#=GS I0Z7B1_COCSC/1-137          AC I0Z7B1.1
#=GS A0A132AHA8_SARSC/1-97       AC A0A132AHA8.1
#=GS A0A094CG72_9PEZI/1-140      AC A0A094CG72.1
#=GS A0A1J7IF63_9PEZI/1-141      AC A0A1J7IF63.1
#=GS A0A0L0NB04_9HYPO/87-227     AC A0A0L0NB04.1
#=GS E4V1P1_ARTGP/1-139          AC E4V1P1.1
#=GS A0A158R4A0_9BILA/338-449    AC A0A158R4A0.1
#=GS A0A2H0ZN25_CANAR/1-136      AC A0A2H0ZN25.1
#=GS A0A163AT55_PHYB8/1-136      AC A0A163AT55.1
#=GS A0A1E5WG98_9POAL/1-126      AC A0A1E5WG98.1
#=GS J4TUR7_SACK1/1-122          AC J4TUR7.1
#=GS H0GDS0_SACCK/1-140          AC H0GDS0.1
#=GS I3LRE0_PIG/1-137            AC I3LRE0.2
#=GS A0A2H3CCJ3_ARMGA/1-139      AC A0A2H3CCJ3.1
#=GS V4LCI5_EUTSA/1-126          AC V4LCI5.1
#=GS W5NFQ8_LEPOC/1-136          AC W5NFQ8.1
#=GS A0A1A9ULX3_GLOAU/1-134      AC A0A1A9ULX3.1
#=GS D8SGV1_SELML/1-126          AC D8SGV1.1
#=GS A0A136J1Z3_9PEZI/1-141      AC A0A136J1Z3.1
#=GS H2LWC2_ORYLA/1-136          AC H2LWC2.1
#=GS A0A0D2P0I0_GOSRA/1-126      AC A0A0D2P0I0.1
#=GS A0A1I8QA16_STOCA/1-134      AC A0A1I8QA16.1
#=GS A0A1E3BD90_9EURO/1-142      AC A0A1E3BD90.1
#=GS A0A0W4ZGJ1_PNEJ7/1-63       AC A0A0W4ZGJ1.1
#=GS B6SIK5_MAIZE/1-127          AC B6SIK5.1
#=GS A0A168ACU0_9HYPO/1-141      AC A0A168ACU0.1
#=GS A0A1E3I1Z6_9TREE/1-126      AC A0A1E3I1Z6.1
#=GS B4J2Q6_DROGR/1-134          AC B4J2Q6.1
#=GS A0A1C7MDC5_GRIFR/70-208     AC A0A1C7MDC5.1
#=GS F7CAI0_ORNAN/3-115          AC F7CAI0.2
#=GS A0A0E0BSC4_9ORYZ/1-126      AC A0A0E0BSC4.1
#=GS W9YY71_9EURO/1-128          AC W9YY71.1
#=GS W4H8E4_9STRA/1-133          AC W4H8E4.1
#=GS A0A1G4J8F6_9SACH/1-141      AC A0A1G4J8F6.1
#=GS D7KD12_ARALL/1-126          AC D7KD12.1
#=GS A0A194PQY2_PAPXU/1-134      AC A0A194PQY2.1
#=GS S3CB06_OPHP1/1-141          AC S3CB06.1
#=GS A0A0F4YI76_TALEM/1-143      AC A0A0F4YI76.1
#=GS W2RM19_9EURO/1-143          AC W2RM19.1
#=GS H3ACP1_LATCH/1-137          AC H3ACP1.2
#=GS E4XX96_OIKDI/1-138          AC E4XX96.1
#=GS A0A2I4D007_9TELE/1-135      AC A0A2I4D007.1
#=GS A0A058Z9T8_9EUKA/1-139      AC A0A058Z9T8.1
#=GS A0A1Y2FXH4_9ASCO/1-138      AC A0A1Y2FXH4.1
#=GS A0A199UNT0_ANACO/1-126      AC A0A199UNT0.1
#=GS A9PC35_POPTR/1-126          AC A9PC35.1
#=GS A0A1B0G321_GLOMM/201-276    AC A0A1B0G321.1
#=GS G8JRH9_ERECY/1-135          AC G8JRH9.1
#=GS A0A0M9AAW8_9HYME/1-135      AC A0A0M9AAW8.1
#=GS A0A1S3JPA9_LINUN/1-96       AC A0A1S3JPA9.1
#=GS A0A091KIY2_9GRUI/1-136      AC A0A091KIY2.1
#=GS H2UXB8_TAKRU/1-136          AC H2UXB8.1
#=GS A0A0D2VHC8_CAPO3/1-132      AC A0A0D2VHC8.1
#=GS A0A167MQS6_PHYB8/1-141      AC A0A167MQS6.1
#=GS E7KR20_YEASL/1-123          AC E7KR20.1
#=GS A0A024GHM5_9STRA/30-166     AC A0A024GHM5.1
#=GS A0A0D3FG11_9ORYZ/1-126      AC A0A0D3FG11.1
#=GS A0A2I4HLI0_9ROSI/1-126      AC A0A2I4HLI0.1
#=GS K7G571_PELSI/1-136          AC K7G571.1
#=GS A0A2D3UZR1_9PEZI/1-141      AC A0A2D3UZR1.1
#=GS A0A165B578_9APHY/1-138      AC A0A165B578.1
#=GS C7YI95_NECH7/1-127          AC C7YI95.1
#=GS H0YY43_TAEGU/1-134          AC H0YY43.1
#=GS A0A0P7BCS2_9HYPO/1-47       AC A0A0P7BCS2.1
#=GS A0A1S2YL36_CICAR/1-124      AC A0A1S2YL36.1
#=GS A0A0C2H2H2_9BILA/1-59       AC A0A0C2H2H2.1
#=GS A0A182HFS4_ANOAR/1-135      AC A0A182HFS4.1
#=GS A0A080WIT3_TRIRC/1-139      AC A0A080WIT3.1
#=GS E7QH91_YEASZ/1-123          AC E7QH91.1
#=GS A0A177VJ52_9BASI/1-138      AC A0A177VJ52.1
#=GS A0A1I8CDB0_9BILA/653-787    AC A0A1I8CDB0.1
#=GS G8YLY4_PICSO/1-140          AC G8YLY4.1
#=GS S7Z673_PENO1/1-142          AC S7Z673.1
#=GS S0DQ49_GIBF5/1-143          AC S0DQ49.1
#=GS A0A0D9YXX0_9ORYZ/1-127      AC A0A0D9YXX0.1
#=GS A0A2C5YJD4_9HYPO/1-140      AC A0A2C5YJD4.1
#=GS A0A1B8B2L6_FUSPO/1-144      AC A0A1B8B2L6.1
#=GS W4K1X5_9HOMO/1-139          AC W4K1X5.1
#=GS E0VSZ3_PEDHC/1-138          AC E0VSZ3.1
#=GS K4BNU9_SOLLC/1-129          AC K4BNU9.1
#=GS E5SY79_TRISP/58-196         AC E5SY79.1
#=GS Q7SG21_NEUCR/1-142          AC Q7SG21.1
#=GS N1R6W3_FUSC4/1-143          AC N1R6W3.1
#=GS D8QG24_SCHCM/1-141          AC D8QG24.1
#=GS A0A090LLR9_STRRB/1-138      AC A0A090LLR9.1
#=GS A0A0D9R3J7_CHLSB/1-112      AC A0A0D9R3J7.1
#=GS W5P6Z7_SHEEP/1-137          AC W5P6Z7.1
#=GS YET3_YEAST/1-140            AC Q07451.1
#=GS E9GHY5_DAPPU/1-139          AC E9GHY5.1
#=GS A0A182J513_9DIPT/1-135      AC A0A182J513.1
#=GS H0GM04_SACCK/1-83           AC H0GM04.1
#=GS A0A0B2V8Z9_TOXCA/1-137      AC A0A0B2V8Z9.1
#=GS A0A1Y2FIW4_9ASCO/1-112      AC A0A1Y2FIW4.1
#=GS A0A0N4ZN06_PARTI/1-138      AC A0A0N4ZN06.1
#=GS A0A183LF61_9TREM/1-63       AC A0A183LF61.1
#=GS F4S136_MELLP/1-138          AC F4S136.1
#=GS R0MCF0_NOSB1/1-67           AC R0MCF0.1
#=GS D6WDF1_TRICA/1-134          AC D6WDF1.1
#=GS A0A0A2JUD2_PENEN/1-142      AC A0A0A2JUD2.1
#=GS C1H3V0_PARBA/1-142          AC C1H3V0.1
#=GS A0A0H5C2U3_CYBJA/1-117      AC A0A0H5C2U3.1
#=GS A0A024GGJ7_9STRA/30-166     AC A0A024GGJ7.1
#=GS A0A1E4SJT5_9ASCO/1-142      AC A0A1E4SJT5.1
#=GS W1QBU6_OGAPD/1-146          AC W1QBU6.1
#=GS K3YWN4_SETIT/1-127          AC K3YWN4.1
#=GS A0A1B8CKT9_9PEZI/1-141      AC A0A1B8CKT9.1
#=GS A0A0K6G4Y8_9HOMO/1-138      AC A0A0K6G4Y8.1
#=GS E9EBZ2_METAQ/1-141          AC E9EBZ2.1
#=GS A0A078JWE9_BRANA/1-126      AC A0A078JWE9.1
#=GS A0A1J9R254_9PEZI/1-143      AC A0A1J9R254.1
#=GS F9WZ12_ZYMTI/1-141          AC F9WZ12.1
#=GS A0A087VHC9_BALRE/1-134      AC A0A087VHC9.1
#=GS V4LWE8_EUTSA/1-103          AC V4LWE8.1
#=GS A0A120E7B6_9BASI/1-141      AC A0A120E7B6.1
#=GS A0A0J0XTX4_9TREE/1-126      AC A0A0J0XTX4.1
#=GS A0A1A9W7N9_9MUSC/1-134      AC A0A1A9W7N9.1
#=GS H0EVL4_GLAL7/38-113         AC H0EVL4.1
#=GS A0A093F8X8_TYTAL/1-136      AC A0A093F8X8.1
#=GS A0A068XJG8_HYMMI/22-160     AC A0A068XJG8.1
#=GS A0A1E4RZL7_CYBJA/1-128      AC A0A1E4RZL7.1
#=GS Q75DD2_ASHGO/1-135          AC Q75DD2.2
#=GS A0A0F4XD17_HANUV/1-131      AC A0A0F4XD17.1
#=GS S3CDX9_GLAL2/1-140          AC S3CDX9.1
#=GS D4B0C4_ARTBC/123-236        AC D4B0C4.1
#=GS A0A1Y1S623_9MICR/70-118     AC A0A1Y1S623.1
#=GS V9EFF2_PHYPR/1-126          AC V9EFF2.1
#=GS F0UGD3_AJEC8/1-142          AC F0UGD3.1
#=GS A0A0V0QVK4_PSEPJ/4-142      AC A0A0V0QVK4.1
#=GS J3LGU4_ORYBR/137-263        AC J3LGU4.1
#=GS A0A099Z998_TINGU/1-135      AC A0A099Z998.1
#=GS U3IK65_ANAPL/1-137          AC U3IK65.1
#=GS F8WDG1_HUMAN/1-66           AC F8WDG1.1
#=GS Q6FIM4_CANGA/1-136          AC Q6FIM4.1
#=GS H2U7F4_TAKRU/1-128          AC H2U7F4.1
#=GS E7NLF6_YEASO/1-83           AC E7NLF6.1
#=GS B4LGI7_DROVI/1-134          AC B4LGI7.1
#=GS A2X9C1_ORYSI/1-127          AC A2X9C1.1
#=GS A0A151I482_9HYME/1-135      AC A0A151I482.1
#=GS F8WB99_HUMAN/1-137          AC F8WB99.1
#=GS A0A1U7T1U8_TARSY/1-136      AC A0A1U7T1U8.1
#=GS A5DK51_PICGU/1-142          AC A5DK51.2
#=GS A0A1S3JPA4_LINUN/1-137      AC A0A1S3JPA4.1
#=GS Q59UQ1_CANAL/1-132          AC Q59UQ1.1
#=GS A0A0U1M1A4_TALIS/53-195     AC A0A0U1M1A4.1
#=GS A3LSR2_PICST/1-141          AC A3LSR2.2
#=GS A0A0F4ZCB2_9PEZI/1-148      AC A0A0F4ZCB2.1
#=GS H3FU88_PRIPA/1-93           AC H3FU88.1
#=GS M3X8G3_FELCA/1-137          AC M3X8G3.1
#=GS BAP29_MOUSE/1-137           AC Q61334.1
#=GS A0A1X2IRA6_9FUNG/1-144      AC A0A1X2IRA6.1
#=GS Q6P890_XENTR/1-135          AC Q6P890.1
#=GS A0A0V1CPH7_TRIBR/223-341    AC A0A0V1CPH7.1
#=GS V9DZ90_PHYPR/1-135          AC V9DZ90.1
#=GS G8C1A3_TETPH/1-133          AC G8C1A3.1
#=GS A0A0A2L790_PENIT/1-142      AC A0A0A2L790.1
#=GS G3UD72_LOXAF/1-136          AC G3UD72.1
#=GS A0A1U8HUH1_GOSHI/1-126      AC A0A1U8HUH1.1
#=GS A0A067PMF0_9HOMO/1-138      AC A0A067PMF0.1
#=GS A0A1V6TE50_9EURO/1-142      AC A0A1V6TE50.1
#=GS A0A1E5RY24_9ASCO/1-139      AC A0A1E5RY24.1
#=GS A0A163EC60_PHYB8/1-134      AC A0A163EC60.1
#=GS J7S1J6_KAZNA/1-143          AC J7S1J6.1
#=GS A0A1Q8RJ95_9PEZI/1-141      AC A0A1Q8RJ95.1
#=GS A0A1E4RCY5_9ASCO/1-139      AC A0A1E4RCY5.1
#=GS A0A182RLQ5_ANOFN/1-135      AC A0A182RLQ5.1
#=GS A0A0M3K7F9_ANISI/1-132      AC A0A0M3K7F9.1
#=GS A0A099P4N5_PICKU/1-132      AC A0A099P4N5.1
#=GS B0X4Z1_CULQU/1-134          AC B0X4Z1.1
#=GS A0A086T844_ACRC1/1-142      AC A0A086T844.1
#=GS Q22R59_TETTS/4-139          AC Q22R59.1
#=GS H0Y7N8_HUMAN/1-51           AC H0Y7N8.1
#=GS A0A232FFH5_9HYME/1-136      AC A0A232FFH5.1
#=GS A5DBS2_PICGU/1-142          AC A5DBS2.1
#=GS A0A1C7N478_9FUNG/1-136      AC A0A1C7N478.1
#=GS E7KEX4_YEASA/1-126          AC E7KEX4.1
#=GS A0A2G3CXI7_CAPCH/1-126      AC A0A2G3CXI7.1
#=GS A0A2H3EN64_9HELO/1-40       AC A0A2H3EN64.1
#=GS A0A0L0DUF5_THETB/1-131      AC A0A0L0DUF5.1
#=GS A0A1I8M2V4_MUSDO/1-134      AC A0A1I8M2V4.1
#=GS T0Q9N5_9STRA/1-132          AC T0Q9N5.1
#=GS C3YAE4_BRAFL/1-139          AC C3YAE4.1
#=GS A0A1B0ARI9_9MUSC/1-135      AC A0A1B0ARI9.1
#=GS A0A1M2V513_TRAPU/1-130      AC A0A1M2V513.1
#=GS M7YJS9_TRIUA/1-127          AC M7YJS9.1
#=GS A8XI37_CAEBR/1-134          AC A8XI37.1
#=GS A0A0G2H1Z0_9EURO/1-141      AC A0A0G2H1Z0.1
#=GS H2U7F6_TAKRU/1-135          AC H2U7F6.1
#=GS A0A151GC38_9HYPO/1-168      AC A0A151GC38.1
#=GS A0A1F5LPR1_9EURO/1-142      AC A0A1F5LPR1.1
#=GS A0A2K1Y8P9_POPTR/1-130      AC A0A2K1Y8P9.1
#=GS A0A0D3ACR9_BRAOL/1-126      AC A0A0D3ACR9.1
#=GS C5GK62_AJEDR/1-144          AC C5GK62.1
#=GS G1TH64_RABIT/1-138          AC G1TH64.1
#=GS A0A061IZU7_TRYRA/2-134      AC A0A061IZU7.1
#=GS N1PVB2_DOTSN/1-141          AC N1PVB2.1
#=GS A0A024GM54_9STRA/1-126      AC A0A024GM54.1
#=GS A0A1D1UUN3_RAMVA/1-138      AC A0A1D1UUN3.1
#=GS A0A200QL82_9MAGN/1-126      AC A0A200QL82.1
#=GS A0A061FW21_THECC/1-126      AC A0A061FW21.1
#=GS A0A162KDW0_9HYPO/1-143      AC A0A162KDW0.1
#=GS A0A0R3W8C7_TAEAS/7-145      AC A0A0R3W8C7.1
#=GS A0A167ND04_9BASI/1-137      AC A0A167ND04.1
#=GS A0A081CBF7_PSEA2/1-138      AC A0A081CBF7.1
#=GS M1D7G5_SOLTU/1-126          AC M1D7G5.1
#=GS M7PKA1_PNEMU/1-136          AC M7PKA1.1
#=GS T1KL93_TETUR/1-136          AC T1KL93.1
#=GS A0A1Y3ASI4_EURMA/3-55       AC A0A1Y3ASI4.1
#=GS A9UY83_MONBE/1-122          AC A9UY83.1
#=GS I2JVF0_DEKBR/1-154          AC I2JVF0.1
#=GS A0A1E5RXW4_HANUV/1-131      AC A0A1E5RXW4.1
#=GS A0A0E0KB36_ORYPU/1-59       AC A0A0E0KB36.1
#=GS E9EMH1_METRA/1-141          AC E9EMH1.1
#=GS W2PPB3_PHYPN/1-135          AC W2PPB3.1
#=GS G0WAD6_NAUDC/75-216         AC G0WAD6.1
#=GS L0PAQ5_PNEJ8/1-139          AC L0PAQ5.1
#=GS A0A091UXX8_NIPNI/1-107      AC A0A091UXX8.1
#=GS A0A1B0A7G7_GLOPL/1-133      AC A0A1B0A7G7.1
#=GS M3W1G2_FELCA/118-253        AC M3W1G2.2
#=GS A0A0F9WFT3_9MICR/76-118     AC A0A0F9WFT3.1
#=GS A0A0M9WK28_9EURO/1-142      AC A0A0M9WK28.1
#=GS C9JSP1_HUMAN/1-136          AC C9JSP1.1
#=GS A0A0P1ACX2_9STRA/1-135      AC A0A0P1ACX2.1
#=GS A0A182KCE0_9DIPT/1-135      AC A0A182KCE0.1
#=GS A0A1Z5TRZ6_HORWE/1-141      AC A0A1Z5TRZ6.1
#=GS D0NXN6_PHYIT/1-135          AC D0NXN6.1
#=GS A0A2D0T5P8_ICTPU/1-136      AC A0A2D0T5P8.1
#=GS I3JPB8_ORENI/1-136          AC I3JPB8.1
#=GS A0A1E3QZF3_9ASCO/1-140      AC A0A1E3QZF3.1
#=GS G3QS23_GORGO/68-203         AC G3QS23.1
#=GS M5EAS3_MALS4/1-146          AC M5EAS3.1
#=GS W4XKT2_STRPU/86-169         AC W4XKT2.1
#=GS A0A218XE16_PUNGR/1-126      AC A0A218XE16.1
#=GS K1VBV4_TRIAC/128-162        AC K1VBV4.1
#=GS A0A1B7TCN3_9ASCO/1-131      AC A0A1B7TCN3.1
#=GS A7TGE5_VANPO/1-142          AC A7TGE5.1
#=GS A0A1E3PIZ8_9ASCO/1-137      AC A0A1E3PIZ8.1
#=GS A0A238FH43_9BASI/1-130      AC A0A238FH43.1
#=GS A0A1E3PB69_WICAO/1-146      AC A0A1E3PB69.1
#=GS Q757E4_ASHGO/1-134          AC Q757E4.1
#=GS H9JK13_BOMMO/1-134          AC H9JK13.1
#=GS A0A1L9TWW1_9EURO/1-127      AC A0A1L9TWW1.1
#=GS F6W5U4_XENTR/1-135          AC F6W5U4.1
#=GS M3IM88_CANMX/1-132          AC M3IM88.1
#=GS G3W549_SARHA/1-136          AC G3W549.1
#=GS G4ZJV0_PHYSP/71-198         AC G4ZJV0.1
#=GS M2VZ48_GALSU/65-204         AC M2VZ48.1
#=GS V5ELG0_KALBG/1-123          AC V5ELG0.1
#=GS E2LBH9_MONPE/1-141          AC E2LBH9.1
#=GS A0A0A1N867_9FUNG/1-139      AC A0A0A1N867.1
#=GS M4CBV1_BRARP/1-125          AC M4CBV1.1
#=GS A0A087ST33_AUXPR/29-162     AC A0A087ST33.1
#=GS H0UYG0_CAVPO/1-153          AC H0UYG0.1
#=GS A0A1Y1W340_9FUNG/2-135      AC A0A1Y1W340.1
#=GS C5M6A9_CANTT/1-141          AC C5M6A9.1
#=GS A0A1Y1UIE0_9TREE/1-138      AC A0A1Y1UIE0.1
#=GS Q9LSH0_ARATH/1-126          AC Q9LSH0.1
#=GS M3CJM4_SPHMS/1-140          AC M3CJM4.1
#=GS A0A1U7YBW4_NICSY/1-129      AC A0A1U7YBW4.1
#=GS A0A1R3JGQ6_9ROSI/1-126      AC A0A1R3JGQ6.1
#=GS A0A0P7WQ68_9TELE/108-243    AC A0A0P7WQ68.1
#=GS B6QAV2_TALMQ/1-143          AC B6QAV2.1
#=GS F6UGY2_CALJA/1-138          AC F6UGY2.1
#=GS G5C2D0_HETGA/1-58           AC G5C2D0.1
#=GS A0A091RDX4_9GRUI/1-130      AC A0A091RDX4.1
#=GS A0A1G4K451_9SACH/1-135      AC A0A1G4K451.1
#=GS A0A1Y2F031_9FUNG/1-137      AC A0A1Y2F031.1
#=GS A0A1C1WXD5_9PEZI/1-141      AC A0A1C1WXD5.1
#=GS F6RHI2_CALJA/1-139          AC F6RHI2.1
#=GS E7KSI5_YEASL/1-83           AC E7KSI5.1
#=GS A0A0L0SSA8_ALLMA/1-142      AC A0A0L0SSA8.1
#=GS A0A183BL93_GLOPA/1-137      AC A0A183BL93.1
#=GS A0A1V4JZX3_PATFA/1-137      AC A0A1V4JZX3.1
#=GS A0A091HVD3_CALAN/1-85       AC A0A091HVD3.1
#=GS A0A1S3UGQ8_VIGRR/1-126      AC A0A1S3UGQ8.1
#=GS A0A1U7VZM1_NICSY/1-126      AC A0A1U7VZM1.1
#=GS A0A1L9X7Y3_ASPAC/1-141      AC A0A1L9X7Y3.1
#=GS C4M666_ENTHI/2-103          AC C4M666.1
#=GS A0A0D9VRQ8_9ORYZ/1-126      AC A0A0D9VRQ8.1
#=GS S2JM45_MUCC1/1-93           AC S2JM45.1
#=GS R9PB83_PSEHS/1-138          AC R9PB83.1
#=GS H1VQF2_COLHI/1-141          AC H1VQF2.1
#=GS A0A093RUN0_9PASS/1-107      AC A0A093RUN0.1
#=GS F4PAM6_BATDJ/1-135          AC F4PAM6.1
#=GS A0A077ZIX5_TRITR/41-100     AC A0A077ZIX5.1
#=GS A0A151NP58_ALLMI/1-137      AC A0A151NP58.1
#=GS A0A146FB73_9EURO/1-131      AC A0A146FB73.1
#=GS G3AWS5_CANTC/1-137          AC G3AWS5.1
#=GS BAP29_PONAB/1-137           AC Q5R9U7.1
#=GS G1TER3_RABIT/1-136          AC G1TER3.1
#=GS A0A1S7ULV1_ROSNE/1-141      AC A0A1S7ULV1.1
#=GS U5FP85_POPTR/1-127          AC U5FP85.1
#=GS A0A1E4TSG3_PACTA/1-137      AC A0A1E4TSG3.1
#=GS V4LM48_EUTSA/1-124          AC V4LM48.1
#=GS A0A2K5HQB0_COLAP/1-137      AC A0A2K5HQB0.1
#=GS A0A1Q3E766_LENED/458-575    AC A0A1Q3E766.1
#=GS M5G901_DACPD/1-138          AC M5G901.1
#=GS G9P9R2_HYPAI/1-143          AC G9P9R2.1
#=GS A0A074X1U9_AURPU/1-143      AC A0A074X1U9.1
#=GS K0KLP8_WICCF/1-123          AC K0KLP8.1
#=GS A0A0D2F5J7_9EURO/1-143      AC A0A0D2F5J7.1
#=GS A0A0B0P097_GOSAR/1-126      AC A0A0B0P097.1
#=GS A0A179U2F9_AJEDR/1-142      AC A0A179U2F9.1
#=GS I1H7K9_BRADI/1-126          AC I1H7K9.1
#=GS R7S4E7_PUNST/535-672        AC R7S4E7.1
#=GS A0A087SMZ5_AUXPR/1-133      AC A0A087SMZ5.1
#=GS F1S2A8_PIG/1-136            AC F1S2A8.2
#=GS C0NEZ9_AJECG/1-141          AC C0NEZ9.1
#=GS G1WZB4_ARTOA/1-143          AC G1WZB4.1
#=GS A0A0L7LST0_9NEOP/1-134      AC A0A0L7LST0.1
#=GS K7J2I9_NASVI/1-136          AC K7J2I9.1
#=GS Q4WRX3_ASPFU/1-142          AC Q4WRX3.1
#=GS A0A1R0H781_9FUNG/2-68       AC A0A1R0H781.1
#=GS A0A0D2XAF4_FUSO4/1-52       AC A0A0D2XAF4.1
#=GS E7LS60_YEASV/1-140          AC E7LS60.1
#=GS A0A183SFM1_SCHSO/795-926    AC A0A183SFM1.1
#=GS A0A1I8H8A3_9PLAT/1-134      AC A0A1I8H8A3.1
#=GS G3U1I5_LOXAF/1-138          AC G3U1I5.1
#=GS A0A0V1L4M4_9BILA/149-284    AC A0A0V1L4M4.1
#=GS A0A2G5UDU4_9PELO/1-134      AC A0A2G5UDU4.1
#=GS H3GDM5_PHYRM/1-128          AC H3GDM5.1
#=GS A0A1R0GUW4_9FUNG/1-44       AC A0A1R0GUW4.1
#=GS G0V5S8_NAUCC/1-141          AC G0V5S8.1
#=GS B9EQV3_DROME/1-134          AC B9EQV3.1
#=GS W6Y3Y0_COCCA/1-141          AC W6Y3Y0.1
#=GS M4A1Y7_XIPMA/1-136          AC M4A1Y7.1
#=GS E9CY34_COCPS/1-144          AC E9CY34.1
#=GS K4C8W4_SOLLC/1-126          AC K4C8W4.1
#=GS A0A0P7BCS2_9HYPO/36-113     AC A0A0P7BCS2.1
#=GS G8ZQD1_TORDC/1-125          AC G8ZQD1.1
#=GS A0A1I8IET8_9PLAT/1-135      AC A0A1I8IET8.1
#=GS A0A1X2IAR8_9FUNG/1-136      AC A0A1X2IAR8.1
#=GS H2MWD0_ORYLA/1-135          AC H2MWD0.1
#=GS A0A2I2ZPY3_GORGO/1-137      AC A0A2I2ZPY3.1
#=GS A0A0C7N894_9SACH/1-137      AC A0A0C7N894.1
#=GS A0A0B1PCR1_UNCNE/1-139      AC A0A0B1PCR1.1
#=GS F9FU37_FUSOF/1-143          AC F9FU37.1
#=GS I4YHN3_WALMC/1-138          AC I4YHN3.1
#=GS A0A0D2BK14_9EURO/1-143      AC A0A0D2BK14.1
#=GS A0A0B4H3J8_9HYPO/1-141      AC A0A0B4H3J8.1
#=GS A0A1C7N884_9FUNG/1-135      AC A0A1C7N884.1
#=GS A0A1A9ZF13_GLOPL/2-58       AC A0A1A9ZF13.1
#=GS A0A183PFW1_9TREM/1-82       AC A0A183PFW1.1
#=GS I3JPB7_ORENI/1-136          AC I3JPB7.1
#=GS A0A0C9N7P7_9FUNG/1-150      AC A0A0C9N7P7.1
#=GS G1KI14_ANOCA/1-136          AC G1KI14.2
#=GS A0A2I3LHM7_PAPAN/68-203     AC A0A2I3LHM7.1
#=GS M2SRT2_COCSN/1-141          AC M2SRT2.1
#=GS A0A154PDS8_9HYME/3-138      AC A0A154PDS8.1
#=GS J5K2P8_BEAB2/1-143          AC J5K2P8.1
#=GS A0A183RJF1_9TREM/1-115      AC A0A183RJF1.1
#=GS A0A091F971_CORBR/1-137      AC A0A091F971.1
#=GS A0A015LL83_9GLOM/1-83       AC A0A015LL83.1
#=GS A0A139AM49_GONPR/1-133      AC A0A139AM49.1
#=GS I2G544_USTH4/1-138          AC I2G544.1
#=GS A0A226NVG6_COLVI/1-137      AC A0A226NVG6.1
#=GS A0A2H3HUU1_FUSOX/1-143      AC A0A2H3HUU1.1
#=GS A0A2I4GX48_9ROSI/1-124      AC A0A2I4GX48.1
#=GS A0A1V9XB67_9ACAR/1-140      AC A0A1V9XB67.1
#=GS A0A261APG3_9PELO/1-134      AC A0A261APG3.1
#=GS A0A1G4MD75_LACFM/1-135      AC A0A1G4MD75.1
#=GS A0A0K0JPS3_BRUMA/19-155     AC A0A0K0JPS3.1
#=GS W9WA36_9EURO/1-143          AC W9WA36.1
#=GS H2ZU99_LATCH/1-83           AC H2ZU99.1
#=GS V4A1M2_LOTGI/1-135          AC V4A1M2.1
#=GS H2V2U4_TAKRU/1-136          AC H2V2U4.1
#=GS A0A098VWA4_9MICR/1-162      AC A0A098VWA4.1
#=GS C4WVJ6_ACYPI/1-135          AC C4WVJ6.1
#=GS A0A1E4TUR9_PACTA/1-137      AC A0A1E4TUR9.1
#=GS A0A1V6YR12_PENNA/1-142      AC A0A1V6YR12.1
#=GS Q9W0M4_DROME/1-134          AC Q9W0M4.1
#=GS A0A0C3E008_9HOMO/1-131      AC A0A0C3E008.1
#=GS A0A094AJQ4_9PEZI/3-137      AC A0A094AJQ4.1
#=GS A0A1V6V7M6_9EURO/1-142      AC A0A1V6V7M6.1
#=GS A2QAU7_ASPNC/21-152         AC A2QAU7.1
#=GS A0A1S3JN78_LINUN/1-137      AC A0A1S3JN78.1
#=GS A0A093V8W4_TALMA/1-143      AC A0A093V8W4.1
#=GS A0A1E3I033_9TREE/1-138      AC A0A1E3I033.1
#=GS A0A024U7N4_9STRA/2-128      AC A0A024U7N4.1
#=GS M4E0E6_BRARP/1-126          AC M4E0E6.1
#=GS W9IEN6_FUSOX/1-143          AC W9IEN6.1
#=GS A0A1S3JNW1_LINUN/1-96       AC A0A1S3JNW1.1
#=GS A0A1G4JUG6_9SACH/1-141      AC A0A1G4JUG6.1
#=GS U6NKJ2_HAECO/1-138          AC U6NKJ2.1
#=GS A0A1J4KG37_9EUKA/4-135      AC A0A1J4KG37.1
#=GS A0A093IM91_FULGA/1-137      AC A0A093IM91.1
#=GS S7XH23_SPRLO/65-112         AC S7XH23.1
#=GS A0A0R3UGD3_9CEST/1-139      AC A0A0R3UGD3.1
#=GS A0A066WBQ8_9BASI/1-138      AC A0A066WBQ8.1
#=GS W6MS14_9ASCO/1-137          AC W6MS14.1
#=GS U5HHU3_USTV1/1-138          AC U5HHU3.1
#=GS D7T8H7_VITVI/1-128          AC D7T8H7.1
#=GS A0A085N902_9BILA/140-216    AC A0A085N902.1
#=GS E2BQM5_HARSA/1-136          AC E2BQM5.1
#=GS A0A0N5BA44_STREA/1-138      AC A0A0N5BA44.1
#=GS W5EJK3_WHEAT/84-209         AC W5EJK3.1
#=GS B4QLF9_DROSI/1-134          AC B4QLF9.1
#=GS A0A2A9PIA7_9HYPO/1-142      AC A0A2A9PIA7.1
#=GS G3ASA5_SPAPN/1-141          AC G3ASA5.1
#=GS R0MCF0_NOSB1/64-109         AC R0MCF0.1
#=GS A0A0M3HT46_ASCLU/1-71       AC A0A0M3HT46.1
#=GS E3RG76_PYRTT/1-141          AC E3RG76.1
#=GS A0A091SB79_NESNO/1-99       AC A0A091SB79.1
#=GS W7TBU6_9STRA/49-187         AC W7TBU6.1
#=GS W9XTH3_9EURO/1-128          AC W9XTH3.1
#=GS C5DFF5_LACTC/200-334        AC C5DFF5.1
#=GS A0A168KXF8_ABSGL/1-122      AC A0A168KXF8.1
#=GS E2R4U9_CANLF/22-157         AC E2R4U9.2
#=GS A0A0E0K4Z5_ORYPU/1-127      AC A0A0E0K4Z5.1
#=GS A0A095A6L7_SCHHA/42-145     AC A0A095A6L7.1
#=GS A0A0L8FRT6_OCTBM/1-138      AC A0A0L8FRT6.1
#=GS A0A0B2WTJ8_9HYPO/1-49       AC A0A0B2WTJ8.1
#=GS A0A0B7NDF8_9FUNG/1-135      AC A0A0B7NDF8.1
#=GS G3P6P0_GASAC/1-136          AC G3P6P0.1
#=GS A0A1X7VSC0_AMPQE/1-135      AC A0A1X7VSC0.1
#=GS J3P9B1_GAGT3/1-141          AC J3P9B1.1
#=GS A0A1E1LJQ2_9HELO/110-245    AC A0A1E1LJQ2.1
#=GS A0A0L0SXV2_ALLMA/1-145      AC A0A0L0SXV2.1
#=GS A0A165QX07_9HOMO/1-138      AC A0A165QX07.1
#=GS A0A1S3WHX0_ERIEU/1-137      AC A0A1S3WHX0.1
#=GS M0TV32_MUSAM/1-126          AC M0TV32.1
#=GS W7LMX2_GIBM7/1-143          AC W7LMX2.1
#=GS H2YK38_CIOSA/1-137          AC H2YK38.1
#=GS A0A177WK27_BATDE/1-123      AC A0A177WK27.1
#=GS A0A1D6M104_MAIZE/1-124      AC A0A1D6M104.1
#=GS H6C148_EXODN/1-143          AC H6C148.1
#=GS A0A212EZ42_DANPL/1-134      AC A0A212EZ42.1
#=GS A0A063C4V9_9HYPO/1-142      AC A0A063C4V9.1
#=GS A0A087YI64_POEFO/1-135      AC A0A087YI64.2
#=GS A0A0H2SAK3_9HOMO/1-140      AC A0A0H2SAK3.1
#=GS A0A2B4RUZ3_STYPI/1-138      AC A0A2B4RUZ3.1
#=GS A0A077ZIX5_TRITR/1-49       AC A0A077ZIX5.1
#=GS A0A287UNZ8_HORVV/66-192     AC A0A287UNZ8.1
#=GS F6ZWF1_HORSE/1-137          AC F6ZWF1.1
#=GS A0A150GFZ1_GONPE/3-73       AC A0A150GFZ1.1
#=GS B3RYU9_TRIAD/1-134          AC B3RYU9.1
#=GS A0A2H3I1C4_9EURO/1-143      AC A0A2H3I1C4.1
#=GS T1J0F9_STRMM/99-236         AC T1J0F9.1
#=GS H2LHS9_ORYLA/1-136          AC H2LHS9.1
#=GS A0A094EZB0_9PEZI/1-140      AC A0A094EZB0.1
#=GS G8BIL8_CANPC/1-133          AC G8BIL8.1
#=GS H3E114_PRIPA/1-73           AC H3E114.1
#=GS A0A0V0U550_9BILA/41-147     AC A0A0V0U550.1
#=GS F6RP12_ORNAN/1-136          AC F6RP12.1
#=GS A0A151U293_CAJCA/1-124      AC A0A151U293.1
#=GS F7HKA0_MACMU/1-156          AC F7HKA0.1
#=GS M5BY17_THACB/1-138          AC M5BY17.1
#=GS W9C8N0_9HELO/1-140          AC W9C8N0.1
#=GS A0A1B7NXR8_9EURO/1-127      AC A0A1B7NXR8.1
#=GS F4WLT4_ACREC/1-139          AC F4WLT4.1
#=GS K5URX1_PHACS/1-139          AC K5URX1.1
#=GS A0A226M9U3_COLVI/1-135      AC A0A226M9U3.1
#=GS A0A175W9J1_9PEZI/1-142      AC A0A175W9J1.1
#=GS J7RL11_KAZNA/1-136          AC J7RL11.1
#=GS A0A0A1TF84_9HYPO/1-142      AC A0A0A1TF84.1
#=GS A0A1S3AH48_ERIEU/1-136      AC A0A1S3AH48.1
#=GS A0A1S3SFR6_SALSA/1-136      AC A0A1S3SFR6.1
#=GS A0A0V1MTD6_9BILA/181-301    AC A0A0V1MTD6.1
#=GS A0A075AW24_9FUNG/1-54       AC A0A075AW24.1
#=GS A0A2A4J9Q0_HELVI/1-134      AC A0A2A4J9Q0.1
#=GS C4XZI1_CLAL4/1-140          AC C4XZI1.1
#=GS T0LDA9_COLGC/1-141          AC T0LDA9.1
#=GS A0A1G4MEV1_LACFM/1-142      AC A0A1G4MEV1.1
#=GS R7SWD3_DICSQ/1-123          AC R7SWD3.1
#=GS A0A1Y1V628_9FUNG/1-137      AC A0A1Y1V628.1
#=GS M1CK78_SOLTU/1-126          AC M1CK78.1
#=GS BAP31_MOUSE/1-136           AC Q61335.4
#=GS A0A1L9SEL8_9EURO/1-127      AC A0A1L9SEL8.1
#=GS H2LHS8_ORYLA/1-136          AC H2LHS8.1
#=GS G0SCT2_CHATD/1-142          AC G0SCT2.1
#=GS E6ZV81_SPORE/1-138          AC E6ZV81.1
#=GS A0A179FP83_METCM/1-141      AC A0A179FP83.1
#=GS G7DT92_MIXOS/1-138          AC G7DT92.1
#=GS A0A2C5X3L2_9PEZI/1-143      AC A0A2C5X3L2.1
#=GS I2GWC3_TETBL/1-134          AC I2GWC3.1
#=GS A0A1Y2BSP6_9FUNG/1-145      AC A0A1Y2BSP6.1
#=GS A0A182QA68_9DIPT/1-135      AC A0A182QA68.1
#=GS A0A139HSA4_9PEZI/1-145      AC A0A139HSA4.1
#=GS A0A0C3Q5S7_9HOMO/1-137      AC A0A0C3Q5S7.1
#=GS A0A0J8RBD8_COCIT/1-144      AC A0A0J8RBD8.1
#=GS A0A0M9A8J6_9HYME/1-134      AC A0A0M9A8J6.1
#=GS Q5KI44_CRYNJ/1-138          AC Q5KI44.1
#=GS G7JZ88_MEDTR/1-126          AC G7JZ88.1
#=GS A0A0L0F6G2_9EUKA/1-43       AC A0A0L0F6G2.1
#=GS S2J3D1_MUCC1/1-138          AC S2J3D1.1
#=GS A0A0J8QIC5_COCIT/1-144      AC A0A0J8QIC5.1
#=GS A0A194PWF0_PAPXU/1-133      AC A0A194PWF0.1
#=GS I1C0F3_RHIO9/1-137          AC I1C0F3.1
#=GS A0A1L9RJD2_ASPWE/1-129      AC A0A1L9RJD2.1
#=GS A0A1L0FWV8_9ASCO/1-141      AC A0A1L0FWV8.1
#=GS C6THE6_SOYBN/1-124          AC C6THE6.1
#=GS A0A165GC82_9PEZI/1-128      AC A0A165GC82.1
#=GS A0A0M3HT46_ASCLU/137-252    AC A0A0M3HT46.1
#=GS A0A1A0HFD0_9ASCO/1-138      AC A0A1A0HFD0.1
#=GS A0A0L1IXJ6_ASPNO/46-185     AC A0A0L1IXJ6.1
#=GS A0A0K0E537_STRER/20-157     AC A0A0K0E537.1
#=GS A0A1S8VFS8_9FUNG/30-155     AC A0A1S8VFS8.1
#=GS B2W4A2_PYRTR/1-141          AC B2W4A2.1
#=GS A0A0F0IAS2_ASPPU/1-140      AC A0A0F0IAS2.1
#=GS A0A061B0G1_CYBFA/1-143      AC A0A061B0G1.1
#=GS A0A074Z4B8_9PEZI/1-143      AC A0A074Z4B8.1
#=GS C6HNW2_AJECH/1-142          AC C6HNW2.1
#=GS A0A0W8DXR7_PHYNI/1-126      AC A0A0W8DXR7.1
#=GS A0A177C1V8_9PLEO/1-143      AC A0A177C1V8.1
#=GS D7MS26_ARALL/1-124          AC D7MS26.1
#=GS A0A0E9NDC1_9ASCO/229-369    AC A0A0E9NDC1.1
#=GS A0A094IYB4_9PEZI/1-140      AC A0A094IYB4.1
#=GS A0A0K3CNY5_RHOTO/1-146      AC A0A0K3CNY5.1
#=GS A0A1U7ZL61_NELNU/1-125      AC A0A1U7ZL61.1
#=GS H7C5E2_HUMAN/1-94           AC H7C5E2.1
#=GS A0A162QJG1_MUCCL/1-138      AC A0A162QJG1.1
#=GS G3US92_MELGA/1-137          AC G3US92.1
#=GS W5JI20_ANODA/1-135          AC W5JI20.1
#=GS A0A087HAF4_ARAAL/1-126      AC A0A087HAF4.1
#=GS C9SH53_VERA1/1-141          AC C9SH53.1
#=GS G3RJC3_GORGO/1-137          AC G3RJC3.2
#=GS G4UBJ2_NEUT9/1-142          AC G4UBJ2.1
#=GS H3CEU4_TETNG/1-135          AC H3CEU4.1
#=GS A0A165CKD3_9BASI/1-138      AC A0A165CKD3.1
#=GS F7DHC3_CALJA/1-136          AC F7DHC3.1
#=GS V5F9J6_BYSSN/1-127          AC V5F9J6.1
#=GS B7PYE7_IXOSC/7-146          AC B7PYE7.1
#=GS A3LUK6_PICST/1-142          AC A3LUK6.2
#=GS A0A1B0G321_GLOMM/311-439    AC A0A1B0G321.1
#=GS A0A1W0XA20_HYPDU/73-209     AC A0A1W0XA20.1
#=GS BAP29_BOVIN/1-136           AC Q32KL9.1
#=GS A0A0J6YK19_COCIT/1-144      AC A0A0J6YK19.1
#=GS N4V1B3_COLOR/1-58           AC N4V1B3.1
#=GS T1ELG9_HELRO/1-136          AC T1ELG9.1
#=GS E3Q3H2_COLGM/1-142          AC E3Q3H2.1
#=GS V8NCI7_OPHHA/1-101          AC V8NCI7.1
#=GS Q17GB1_AEDAE/1-134          AC Q17GB1.1
#=GS A0A226DPC6_FOLCA/2-135      AC A0A226DPC6.1
#=GS A5DTS0_LODEL/1-139          AC A5DTS0.1
#=GS A0A0C3KHZ2_9HOMO/1-137      AC A0A0C3KHZ2.1
#=GS A0A0E0GBG6_ORYNI/1-103      AC A0A0E0GBG6.1
#=GS A0A0F2MAR8_SPOSC/1-154      AC A0A0F2MAR8.1
#=GS B7XJ91_ENTBH/66-118         AC B7XJ91.1
#=GS A0A1U7T2V6_TARSY/1-137      AC A0A1U7T2V6.1
#=GS A0A1U7KB62_9APHY/1-133      AC A0A1U7KB62.1
#=GS V7B912_PHAVU/48-173         AC V7B912.1
#=GS A0A024U3K6_9STRA/1-132      AC A0A024U3K6.1
#=GS A0A100I7C7_ASPNG/1-146      AC A0A100I7C7.1
#=GS I1CJ43_RHIO9/1-118          AC I1CJ43.1
#=GS A0A0D1E664_USTMA/1-138      AC A0A0D1E664.1
#=GS A0A1G4B7S2_9PEZI/1-141      AC A0A1G4B7S2.1
#=GS V4KTK3_EUTSA/1-126          AC V4KTK3.1
#=GS A0A1W4W3R5_DROFC/1-134      AC A0A1W4W3R5.1
#=GS F2SX06_TRIRC/1-141          AC F2SX06.2
#=GS A0A166RE78_9PEZI/1-141      AC A0A166RE78.1
#=GS G9MID8_HYPVG/1-143          AC G9MID8.1
#=GS C5KC37_PERM5/7-136          AC C5KC37.1
#=GS C9JMD7_HUMAN/1-136          AC C9JMD7.1
#=GS A0A1B0B5F7_9MUSC/1-133      AC A0A1B0B5F7.1
#=GS A0A182TXA2_9DIPT/1-135      AC A0A182TXA2.1
#=GS A0A1U7LK25_9ASCO/1-136      AC A0A1U7LK25.1
#=GS M7BQF3_CHEMY/134-211        AC M7BQF3.1
#=GS A0A195FXC2_9HYME/1-135      AC A0A195FXC2.1
#=GS A0A067NIR7_PLEOS/1-140      AC A0A067NIR7.1
#=GS T0PVQ5_9STRA/1-128          AC T0PVQ5.1
#=GS G5BQT6_HETGA/1-136          AC G5BQT6.1
#=GS A0A1W4WMV7_AGRPL/1-134      AC A0A1W4WMV7.1
#=GS A0A0V1HWA0_9BILA/217-326    AC A0A0V1HWA0.1
#=GS A0A1S3CSB5_CUCME/1-126      AC A0A1S3CSB5.1
#=GS A0A135UJ70_9PEZI/114-254    AC A0A135UJ70.1
#=GS A0A0N1IGZ2_PAPMA/1-134      AC A0A0N1IGZ2.1
#=GS A0A0L7LTZ8_9NEOP/1-134      AC A0A0L7LTZ8.1
#=GS A0A024GMF0_9STRA/1-128      AC A0A024GMF0.1
#=GS G3WI29_SARHA/1-136          AC G3WI29.1
#=GS A0A1B8F8W7_9PEZI/1-140      AC A0A1B8F8W7.1
#=GS W6ZVM7_COCMI/1-141          AC W6ZVM7.1
#=GS A0A0R3PT54_ANGCS/176-296    AC A0A0R3PT54.1
#=GS A0A139INR0_9PEZI/1-143      AC A0A139INR0.1
#=GS L5JQU6_PTEAL/1-137          AC L5JQU6.1
#=GS A0A0V1A3J8_9BILA/152-287    AC A0A0V1A3J8.1
#=GS A0A0V0UYQ4_9BILA/3-92       AC A0A0V0UYQ4.1
#=GS M4APT3_XIPMA/1-136          AC M4APT3.1
#=GS A0A1S3SFR4_SALSA/1-142      AC A0A1S3SFR4.1
#=GS C4QWM4_KOMPG/1-132          AC C4QWM4.1
#=GS A0A182LQ26_9DIPT/1-135      AC A0A182LQ26.1
#=GS D8LCD9_ECTSI/8-138          AC D8LCD9.1
#=GS G3HSX3_CRIGR/1-136          AC G3HSX3.1
#=GS F6V5V5_HORSE/1-135          AC F6V5V5.1
#=GS A9TBR7_PHYPA/1-126          AC A9TBR7.1
#=GS J8LQI5_SACAR/1-140          AC J8LQI5.1
#=GS A0A1E3NTU2_9ASCO/1-140      AC A0A1E3NTU2.1
#=GS A0A1D5QLW2_MACMU/1-137      AC A0A1D5QLW2.1
#=GS A0A1B7TJN7_9ASCO/1-144      AC A0A1B7TJN7.1
#=GS B5X317_SALSA/1-135          AC B5X317.1
#=GS H2PX57_PONAB/68-203         AC H2PX57.2
#=GS E5A2R6_LEPMJ/1-143          AC E5A2R6.1
#=GS M4AHB3_XIPMA/1-135          AC M4AHB3.1
#=GS A0A0C2D7V5_9BILA/10-75      AC A0A0C2D7V5.1
#=GS A5X380_MESAU/1-136          AC A5X380.1
#=GS G8YPA9_PICSO/1-140          AC G8YPA9.1
#=GS A0A0V0X0M0_9BILA/59-174     AC A0A0V0X0M0.1
#=GS Q6Z756_ORYSJ/1-127          AC Q6Z756.1
#=GS W2KG55_PHYPR/1-135          AC W2KG55.1
#=GS A0A1U8CZL7_MESAU/1-136      AC A0A1U8CZL7.1
#=GS F7VT64_SORMK/1-142          AC F7VT64.1
#=GS C5DGW7_LACTC/1-143          AC C5DGW7.1
#=GS A0A091FWM8_9AVES/1-128      AC A0A091FWM8.1
#=GS A0A1S9DMW5_ASPOZ/1-140      AC A0A1S9DMW5.1
#=GS A0A1D8PGL1_CANAL/1-138      AC A0A1D8PGL1.1
#=GS A0A0L0HNC6_SPIPN/1-145      AC A0A0L0HNC6.1
#=GS A0A0G4EXN9_VITBC/1-138      AC A0A0G4EXN9.1
#=GS A0A1U7RU93_ALLSI/1-136      AC A0A1U7RU93.1
#=GS A0A1I7TQ18_9PELO/4-137      AC A0A1I7TQ18.1
#=GS Q6CWL9_KLULA/66-203         AC Q6CWL9.1
#=GS F4Q7U5_CAVFA/105-232        AC F4Q7U5.1
#=GS I2H6Y5_TETBL/1-137          AC I2H6Y5.1
#=GS A0A1E4SXV3_9ASCO/1-140      AC A0A1E4SXV3.1
#=GS Q5RIX5_DANRE/1-136          AC Q5RIX5.1
#=GS L8GUB8_ACACA/1-127          AC L8GUB8.1
#=GS A0A0C3H6U0_9PEZI/1-140      AC A0A0C3H6U0.1
#=GS A0A1J1J0H0_9DIPT/1-132      AC A0A1J1J0H0.1
#=GS H3DF24_TETNG/1-139          AC H3DF24.1
#=GS A0A0L0C499_LUCCU/1-134      AC A0A0L0C499.1
#=GS Q8LDS7_ARATH/1-126          AC Q8LDS7.1
#=GS A0A0L0HNZ2_SPIPN/1-130      AC A0A0L0HNZ2.1
#=GS A0A1E4S2F3_CYBJA/1-128      AC A0A1E4S2F3.1
#=GS A0A2K5HQA6_COLAP/1-137      AC A0A2K5HQA6.1
#=GS G0V8Q3_NAUCC/1-134          AC G0V8Q3.1
#=GS A0A078HWR7_BRANA/1-126      AC A0A078HWR7.1
#=GS A0A067C1G9_SAPPC/1-128      AC A0A067C1G9.1
#=GS C9JTE9_HUMAN/1-137          AC C9JTE9.1
#=GS A0A0D0CQ96_9AGAR/1-139      AC A0A0D0CQ96.1
#=GS G1Q0C4_MYOLU/1-133          AC G1Q0C4.1
#=GS A0A1S3GRE8_DIPOR/1-136      AC A0A1S3GRE8.1
#=GS A0A044T7H3_ONCVO/383-519    AC A0A044T7H3.1
#=GS A0A0B2QTY3_GLYSO/1-126      AC A0A0B2QTY3.1
#=GS A0A1S8VN41_9FUNG/1-145      AC A0A1S8VN41.1
#=GS A0A163AAC1_DIDRA/1-142      AC A0A163AAC1.1
#=GS D0NSH4_PHYIT/1-126          AC D0NSH4.1
#=GS B8AJZ5_ORYSI/1-126          AC B8AJZ5.1
#=GS K5X172_AGABU/1-139          AC K5X172.1
#=GS A0A1Y1ZBT5_9FUNG/1-134      AC A0A1Y1ZBT5.1
#=GS A0A0D3FA63_9ORYZ/1-127      AC A0A0D3FA63.1
#=GS A0A284RQV1_9AGAR/1-139      AC A0A284RQV1.1
#=GS A0A197JNB3_9FUNG/1-134      AC A0A197JNB3.1
#=GS A0A137NZJ0_CONC2/1-133      AC A0A137NZJ0.1
#=GS A0A059J0R8_9EURO/1-139      AC A0A059J0R8.1
#=GS A0A0D2HBQ7_9EURO/1-143      AC A0A0D2HBQ7.1
#=GS A1CNY2_ASPCL/1-127          AC A1CNY2.1
#=GS A0A2I4BXV6_9TELE/1-135      AC A0A2I4BXV6.1
#=GS A8PVX4_MALGO/1-70           AC A8PVX4.1
#=GS C5DWZ2_ZYGRC/1-140          AC C5DWZ2.1
#=GS A0A139IN82_9PEZI/2-102      AC A0A139IN82.1
#=GS G3TMW4_LOXAF/1-136          AC G3TMW4.1
#=GS G8BPF6_TETPH/1-141          AC G8BPF6.1
#=GS I1RBH5_GIBZE/1-143          AC I1RBH5.1
#=GS A0A1I8Q9X0_STOCA/1-135      AC A0A1I8Q9X0.1
#=GS A0A1Y2GW44_9FUNG/1-137      AC A0A1Y2GW44.1
#=GS A0A2H3EVZ6_9HELO/1-139      AC A0A2H3EVZ6.1
#=GS A0A0V0Y8S9_TRIPS/156-291    AC A0A0V0Y8S9.1
#=GS A0A0B1SH77_OESDE/1-59       AC A0A0B1SH77.1
#=GS A0A0U5GTA2_9EURO/1-142      AC A0A0U5GTA2.1
#=GS A0A1E5S0U0_HANUV/1-142      AC A0A1E5S0U0.1
#=GS A0A0L0S791_ALLMA/1-145      AC A0A0L0S791.1
#=GS A0A0N4UC71_DRAME/313-449    AC A0A0N4UC71.1
#=GS A0A0D2AKG4_9EURO/1-143      AC A0A0D2AKG4.1
#=GS A0A137QUF2_9AGAR/1-130      AC A0A137QUF2.1
#=GS A0A1A9Y7Y1_GLOFF/1-140      AC A0A1A9Y7Y1.1
#=GS A0A182V3X3_ANOME/1-135      AC A0A182V3X3.1
#=GS A0A2G2X856_CAPBA/1-126      AC A0A2G2X856.1
#=GS L8WVF5_THACA/1-34           AC L8WVF5.1
#=GS G7KQC5_MEDTR/1-126          AC G7KQC5.1
#=GS A0A0D3FG12_9ORYZ/1-104      AC A0A0D3FG12.1
#=GS H3CLK1_TETNG/1-136          AC H3CLK1.1
#=GS A0A178ZXD9_9EURO/1-143      AC A0A178ZXD9.1
#=GS A0A1C7NNE1_9FUNG/1-133      AC A0A1C7NNE1.1
#=GS A0A1Q2YBF8_9ASCO/1-140      AC A0A1Q2YBF8.1
#=GS I1IFJ0_BRADI/1-127          AC I1IFJ0.1
#=GS A0A165PBQ3_9APHY/1-139      AC A0A165PBQ3.1
#=GS A0A2I3TRW4_PANTR/1-136      AC A0A2I3TRW4.1
#=GS H2AWQ1_KAZAF/1-133          AC H2AWQ1.1
#=GS A0A096NF84_PAPAN/1-137      AC A0A096NF84.2
#=GS W6U5T3_ECHGR/809-947        AC W6U5T3.1
#=GS Q6FWF0_CANGA/1-146          AC Q6FWF0.1
#=GS M3Z3H0_MUSPF/1-137          AC M3Z3H0.1
#=GS A0A168RPB3_ABSGL/1-121      AC A0A168RPB3.1
#=GS A0A0C3NCX0_PHLGI/1-139      AC A0A0C3NCX0.1
#=GS A0A1Y2I3U0_9FUNG/1-119      AC A0A1Y2I3U0.1
#=GS A0A1I8B998_MELHA/1-104      AC A0A1I8B998.1
#=GS A0A1E4SDZ8_9ASCO/1-127      AC A0A1E4SDZ8.1
#=GS C9JQ75_HUMAN/1-136          AC C9JQ75.1
#=GS A0A162KNH6_CORDF/1-143      AC A0A162KNH6.1
#=GS Q8JFW7_DANRE/1-135          AC Q8JFW7.1
#=GS A0A1V6RN74_9EURO/1-142      AC A0A1V6RN74.1
#=GS A0A091M4Z1_CARIC/1-134      AC A0A091M4Z1.1
#=GS Q6AY58_RAT/1-136            AC Q6AY58.1
#=GS A0A0B2UMG6_9MICR/1-120      AC A0A0B2UMG6.1
#=GS K0KYF7_WICCF/1-146          AC K0KYF7.1
#=GS H2MWD2_ORYLA/1-135          AC H2MWD2.1
#=GS A0A1L0B8U7_9ASCO/1-139      AC A0A1L0B8U7.1
#=GS J9D833_EDHAE/1-121          AC J9D833.1
#=GS A0A067DUF8_CITSI/1-126      AC A0A067DUF8.1
#=GS A0A1V6QUV4_9EURO/1-142      AC A0A1V6QUV4.1
#=GS R0GRR5_9BRAS/40-165         AC R0GRR5.1
#=GS A0A0K9NSA4_ZOSMR/1-126      AC A0A0K9NSA4.1
#=GS A0A0K8LLU8_9EURO/31-171     AC A0A0K8LLU8.1
#=GS A0A0M8MPX8_9BASI/1-138      AC A0A0M8MPX8.1
#=GS A0A2B7ZRD5_9EURO/1-142      AC A0A2B7ZRD5.1
#=GS H0GZ86_SACCK/1-87           AC H0GZ86.1
#=GS A0A0M3KFA7_ANISI/1-150      AC A0A0M3KFA7.1
#=GS R0M088_NOSB1/1-119          AC R0M088.1
#=GS A0A088AVC9_APIME/1-134      AC A0A088AVC9.1
#=GS A0A158QFB3_HYMDI/1-139      AC A0A158QFB3.1
#=GS A0A087XET9_POEFO/1-136      AC A0A087XET9.2
#=GS A0A1U8J8H1_GOSHI/1-126      AC A0A1U8J8H1.1
#=GS C9JM14_HUMAN/1-136          AC C9JM14.1
#=GS G0N6G5_CAEBE/1-134          AC G0N6G5.1
#=GS A0A094E4L4_9PEZI/1-140      AC A0A094E4L4.1
#=GS A0A095C348_CRYGR/30-109     AC A0A095C348.1
#=GS A0A0L0USV7_9BASI/1-140      AC A0A0L0USV7.1
#=GS A0A091U0X5_PHORB/1-137      AC A0A091U0X5.1
#=GS A0A158PQ26_BRUPA/322-458    AC A0A158PQ26.1
#=GS H3FBZ0_PRIPA/256-366        AC H3FBZ0.1
#=GS A0A1Y2D6B2_9PEZI/1-141      AC A0A1Y2D6B2.1
#=GS E7KL18_YEASL/1-140          AC E7KL18.1
#=GS A0A0B2WTJ8_9HYPO/60-175     AC A0A0B2WTJ8.1
#=GS G1RSQ8_NOMLE/1-136          AC G1RSQ8.1
#=GS G0P4L3_CAEBE/1-130          AC G0P4L3.1
#=GS A0A2K5HQC0_COLAP/1-137      AC A0A2K5HQC0.1
#=GS A0A0E0CR48_9ORYZ/1-127      AC A0A0E0CR48.1
#=GS A0A1I7W0X2_LOALO/1-137      AC A0A1I7W0X2.1
#=GS Q7PPR9_ANOGA/1-135          AC Q7PPR9.4
#=GS A0A0A0AXY1_CHAVO/1-137      AC A0A0A0AXY1.1
#=GS A0A0A1P6G2_9FUNG/1-139      AC A0A0A1P6G2.1
#=GS M3B0P5_PSEFD/1-143          AC M3B0P5.1
#=GS A0A0D8XS56_DICVI/1-139      AC A0A0D8XS56.1
#=GS A0A1E3Q5D9_LIPST/1-139      AC A0A1E3Q5D9.1
#=GS M9LU23_PSEA3/1-138          AC M9LU23.1
#=GS A0A1A9Y685_GLOFF/1-134      AC A0A1A9Y685.1
#=GS A0A0D1X545_9EURO/1-143      AC A0A0D1X545.1
#=GS A0A0G0ACM7_TRIHA/1-143      AC A0A0G0ACM7.1
#=GS A0A0C9ZGQ9_9HOMO/1-138      AC A0A0C9ZGQ9.1
#=GS A0A2C5ZZG9_9HYPO/1-142      AC A0A2C5ZZG9.1
#=GS F2PVT5_TRIEC/1-139          AC F2PVT5.1
#=GS A0A194V456_9PEZI/1-142      AC A0A194V456.1
#=GS A0A182M536_9DIPT/1-135      AC A0A182M536.1
#=GS G3B3D9_CANTC/1-136          AC G3B3D9.1
#=GS A0A1Q5U192_9EURO/1-127      AC A0A1Q5U192.1
#=GS Q6BS63_DEBHA/1-142          AC Q6BS63.1
#=GS A0A2G9G7C4_9LAMI/1-126      AC A0A2G9G7C4.1
#=GS V7C6Y1_PHAVU/1-126          AC V7C6Y1.1
#=GS A6QYC7_AJECN/1-144          AC A6QYC7.1
#=GS A0A0L7QNW2_9HYME/1-135      AC A0A0L7QNW2.1
#=GS A0A2K5J3R5_COLAP/1-136      AC A0A2K5J3R5.1
#=GS Q5XIU4_RAT/1-137            AC Q5XIU4.1
#=GS H0WUS4_OTOGA/69-204         AC H0WUS4.1
#=GS E7KGG8_YEASA/1-83           AC E7KGG8.1
#=GS K3WFK4_PYTUL/3-137          AC K3WFK4.1
#=GS A0A1E3PHS3_9ASCO/1-150      AC A0A1E3PHS3.1
#=GS A0A1D2MYG5_ORCCI/1-134      AC A0A1D2MYG5.1
#=GS J9FGI8_WUCBA/1-137          AC J9FGI8.1
#=GS G3XRH4_ASPNA/1-142          AC G3XRH4.1
#=GS A0A0L0HPN2_SPIPN/1-142      AC A0A0L0HPN2.1
#=GS M4BV69_HYAAE/123-249        AC M4BV69.1
#=GS A0A017SQ45_9EURO/1-142      AC A0A017SQ45.1
#=GS A0A084GF94_9PEZI/1-142      AC A0A084GF94.1
#=GS I3KB97_ORENI/1-135          AC I3KB97.1
#=GS A0A2I4DTS6_9ROSI/1-117      AC A0A2I4DTS6.1
#=GS A0A2K5MXG7_CERAT/1-137      AC A0A2K5MXG7.1
#=GS J8PL63_SACAR/1-140          AC J8PL63.1
#=GS A0A1L7WQT2_9HELO/1-139      AC A0A1L7WQT2.1
#=GS A0A1S4B8M0_TOBAC/1-126      AC A0A1S4B8M0.1
#=GS A0A2D0QZX5_ICTPU/1-135      AC A0A2D0QZX5.1
#=GS A0A0D3CJ68_BRAOL/1-126      AC A0A0D3CJ68.1
#=GS A0A178EEK0_9PLEO/1-143      AC A0A178EEK0.1
#=GS H3F0D5_PRIPA/1-108          AC H3F0D5.1
#=GS A0A2A2JHE7_9BILA/1-138      AC A0A2A2JHE7.1
#=GS A0A2I3HR51_NOMLE/1-157      AC A0A2I3HR51.1
#=GS A0A0D2GVM5_9EURO/1-143      AC A0A0D2GVM5.1
#=GS A0BHF9_PARTE/1-144          AC A0BHF9.1
#=GS A0A1V8SAQ6_9PEZI/1-141      AC A0A1V8SAQ6.1
#=GS A0A0V0SEW1_9BILA/156-291    AC A0A0V0SEW1.1
#=GS A0A022QA78_ERYGU/1-126      AC A0A022QA78.1
#=GS E3K438_PUCGT/1-140          AC E3K438.1
#=GS A0A1S3JN86_LINUN/1-96       AC A0A1S3JN86.1
#=GS A0A067TEL6_GALM3/1-139      AC A0A067TEL6.1
#=GS A0A1Z5SSE3_HORWE/1-141      AC A0A1Z5SSE3.1
#=GS A0A1A9Y5I2_GLOFF/1-134      AC A0A1A9Y5I2.1
#=GS A0A0W8CAH8_PHYNI/1-115      AC A0A0W8CAH8.1
#=GS A0A162Q5C5_9PEZI/1-141      AC A0A162Q5C5.1
#=GS A0A0G4EWW9_VITBC/1-135      AC A0A0G4EWW9.1
#=GS G0RMS0_HYPJQ/1-143          AC G0RMS0.1
#=GS E7KAH8_YEASA/1-123          AC E7KAH8.1
#=GS A0A1V8UTJ0_9PEZI/1-126      AC A0A1V8UTJ0.1
#=GS A0A0C2X9C0_AMAMU/1-98       AC A0A0C2X9C0.1
#=GS A0A0H1BHX6_9EURO/1-129      AC A0A0H1BHX6.1
#=GS A0A066VVX3_9HOMO/1-138      AC A0A066VVX3.1
#=GS A0A1A0HEH5_9ASCO/1-140      AC A0A1A0HEH5.1
#=GS A0A2K5HQ89_COLAP/1-137      AC A0A2K5HQ89.1
#=GS A0A1A9ZF11_GLOPL/1-134      AC A0A1A9ZF11.1
#=GS A0A1V6TB40_9EURO/1-142      AC A0A1V6TB40.1
#=GS A0A2H3SVM7_FUSOX/1-143      AC A0A2H3SVM7.1
#=GS A0A1J8QDI0_9HOMO/1-140      AC A0A1J8QDI0.1
#=GS A0A060S347_PYCCI/1-71       AC A0A060S347.1
#=GS K1VBV4_TRIAC/1-64           AC K1VBV4.1
#=GS L7N3N7_XENTR/1-107          AC L7N3N7.1
#=GS U3K6M1_FICAL/1-137          AC U3K6M1.1
#=GS A0A0V1CQR4_TRIBR/3-92       AC A0A0V1CQR4.1
#=GS S8DRL3_9LAMI/1-126          AC S8DRL3.1
#=GS A0A072PLD9_9EURO/1-128      AC A0A072PLD9.1
#=GS BAP31_PONAB/1-136           AC Q5R8H3.3
#=GS H2YK40_CIOSA/1-137          AC H2YK40.1
#=GS W5NBE2_LEPOC/1-135          AC W5NBE2.1
#=GS S7NTH9_MYOBR/1-136          AC S7NTH9.1
#=GS K9GAP2_PEND2/1-142          AC K9GAP2.1
#=GS A0A087U9N2_9ARAC/1-131      AC A0A087U9N2.1
#=GS Q6BPT4_DEBHA/1-140          AC Q6BPT4.2
#=GS C4V808_NOSCE/1-74           AC C4V808.1
#=GS C9J0M4_HUMAN/1-136          AC C9J0M4.1
#=GS A0A182FUJ5_ANOAL/1-135      AC A0A182FUJ5.1
#=GS A0A094GYI6_9PEZI/1-140      AC A0A094GYI6.1
#=GS L5KG07_PTEAL/1-136          AC L5KG07.1
#=GS G7Q1Z6_MACFA/68-203         AC G7Q1Z6.1
#=GS G1NBM5_MELGA/1-137          AC G1NBM5.2
#=GS A0A1A9X3F8_9MUSC/1-135      AC A0A1A9X3F8.1
#=GS V2XW09_MONRO/1-141          AC V2XW09.1
#=GS A0A0B2SF52_GLYSO/1-126      AC A0A0B2SF52.1
#=GS A0A151NJP8_ALLMI/1-114      AC A0A151NJP8.1
#=GS C9JGJ9_HUMAN/1-133          AC C9JGJ9.1
#=GS M2QX16_CERS8/1-139          AC M2QX16.1
#=GS A5E3X4_LODEL/1-138          AC A5E3X4.1
#=GS A0A0E0CXS2_9ORYZ/1-126      AC A0A0E0CXS2.1
#=GS A0A1X7QZ42_9SACH/1-133      AC A0A1X7QZ42.1
#=GS G3SMP8_LOXAF/1-137          AC G3SMP8.1
#=GS A0A2K5NV01_CERAT/1-136      AC A0A2K5NV01.1
#=GS Q17GB2_AEDAE/1-134          AC Q17GB2.1
#=GS M7U6U3_BOTF1/1-140          AC M7U6U3.1
#=GS S7MGB5_MYOBR/1-137          AC S7MGB5.1
#=GS R0MCE4_NOSB1/1-68           AC R0MCE4.1
#=GS YF14_SCHPO/1-137            AC O14290.1
#=GS A8NIF1_COPC7/1-138          AC A8NIF1.1
#=GS A0A1Y2ATT7_9TREE/1-138      AC A0A1Y2ATT7.1
#=GS A0A1Y1ZVF2_9PLEO/5-146      AC A0A1Y1ZVF2.1
#=GS S9WJ21_CAMFR/1-131          AC S9WJ21.1
#=GS B0D7E8_LACBS/1-140          AC B0D7E8.1
#=GS D5GJC7_TUBMM/1-139          AC D5GJC7.1
#=GS G3GTA2_CRIGR/1-136          AC G3GTA2.1
#=GS A0A067MMJ2_9HOMO/1-138      AC A0A067MMJ2.1
#=GS A0A091DFP2_FUKDA/1-136      AC A0A091DFP2.1
#=GS A0A091HU67_BUCRH/1-128      AC A0A091HU67.1
#=GS I1P9B9_ORYGL/1-126          AC I1P9B9.1
#=GS A0A0L6WJ53_9AGAR/1-140      AC A0A0L6WJ53.1
#=GS A0A1E4RTC0_9ASCO/1-145      AC A0A1E4RTC0.1
#=GS A0A0C3NYJ6_PISTI/1-138      AC A0A0C3NYJ6.1
#=GS G1LQ55_AILME/17-153         AC G1LQ55.1
#=GS H0GSE0_SACCK/3-56           AC H0GSE0.1
#=GS E1ZVU8_CAMFO/1-135          AC E1ZVU8.1
#=GS A0A0C9Y6H5_9AGAR/1-140      AC A0A0C9Y6H5.1
#=GS F7A5H3_MONDO/1-140          AC F7A5H3.2
#=GS A0A0K0FUT3_9BILA/1-138      AC A0A0K0FUT3.1
#=GS B4L0C7_DROMO/1-134          AC B4L0C7.1
#=GS A0A0C2TEV5_AMAMU/9-70       AC A0A0C2TEV5.1
#=GS R1CWY0_EMIHU/1-137          AC R1CWY0.1
#=GS H3FU89_PRIPA/1-43           AC H3FU89.1
#=GS A0A1V8SCF3_9PEZI/1-141      AC A0A1V8SCF3.1
#=GS A0A0C7NDX6_9SACH/1-141      AC A0A0C7NDX6.1
#=GS A0A231MPH2_9EURO/1-143      AC A0A231MPH2.1
#=GS A0A0D9VKP8_9ORYZ/1-127      AC A0A0D9VKP8.1
#=GS A0A0A1T2K8_9HYPO/1-50       AC A0A0A1T2K8.1
#=GS Q0CZL4_ASPTN/1-141          AC Q0CZL4.1
#=GS A0A084RA55_STACH/1-143      AC A0A084RA55.1
#=GS K1Q5J2_CRAGI/1-136          AC K1Q5J2.1
#=GS A0A2C5ZL38_9HYPO/1-141      AC A0A2C5ZL38.1
#=GS B4FAP8_MAIZE/1-126          AC B4FAP8.1
#=GS A0A0N5CV64_THECL/304-440    AC A0A0N5CV64.1
#=GS A0A1I8M2V6_MUSDO/1-134      AC A0A1I8M2V6.1
#=GS A0A135LNR1_PENPA/1-142      AC A0A135LNR1.1
#=GS F7ESN9_MACMU/67-202         AC F7ESN9.2
#=GS A0A1R3RLS7_ASPC5/1-142      AC A0A1R3RLS7.1
#=GS A0A0B2UST1_TOXCA/1-136      AC A0A0B2UST1.1
#=GS C4M417_ENTHI/2-133          AC C4M417.1
#=GS M4DXM7_BRARP/1-126          AC M4DXM7.1
#=GS A0A0A1T2K8_9HYPO/48-158     AC A0A0A1T2K8.1
#=GS E7NK01_YEASO/1-126          AC E7NK01.1
#=GS A0A0D9VRQ9_9ORYZ/1-126      AC A0A0D9VRQ9.1
#=GS J6EDB6_SACK1/1-138          AC J6EDB6.1
#=GS I3LW63_ICTTR/1-137          AC I3LW63.2
#=GS A0A1V6TBU6_9EURO/8-74       AC A0A1V6TBU6.1
#=GS G3ALC9_SPAPN/1-142          AC G3ALC9.1
#=GS B9I4T6_POPTR/61-186         AC B9I4T6.1
#=GS A0A179GZ64_9HYPO/1-141      AC A0A179GZ64.1
#=GS B4HAG5_DROPE/1-134          AC B4HAG5.1
#=GS W2G3J5_PHYPR/1-126          AC W2G3J5.1
#=GS A0A2G8KAX6_STIJA/1-135      AC A0A2G8KAX6.1
#=GS A0A2C9JUQ8_BIOGL/1-139      AC A0A2C9JUQ8.1
#=GS G2REV9_THITE/1-127          AC G2REV9.1
#=GS A0A0B2UMF6_TOXCA/1-136      AC A0A0B2UMF6.1
#=GS A0A0D1Z6S1_9PEZI/1-140      AC A0A0D1Z6S1.1
#=GS A0A1Y3N9I5_PIRSE/1-137      AC A0A1Y3N9I5.1
#=GS R4FPZ2_RHOPR/1-134          AC R4FPZ2.1
#=GS A0A161HKY6_9ASCO/1-126      AC A0A161HKY6.1
#=GS S6EW33_ZYGB2/1-136          AC S6EW33.1
#=GS B9N383_POPTR/1-126          AC B9N383.1
#=GS G8ZUQ6_TORDC/1-141          AC G8ZUQ6.1
#=GS A0A168NC43_MUCCL/1-143      AC A0A168NC43.1
#=GS A0A182X1W0_ANOQN/1-135      AC A0A182X1W0.1
#=GS S9W1N2_SCHCR/1-137          AC S9W1N2.1
#=GS A0A094BE68_9PEZI/1-140      AC A0A094BE68.1
#=GS F6RHD6_CALJA/1-137          AC F6RHD6.1
#=GS C9JP06_HUMAN/1-64           AC C9JP06.1
#=GS A0A150V4F6_9PEZI/1-140      AC A0A150V4F6.1
#=GS J3KAY9_COCIM/1-144          AC J3KAY9.2
#=GS L5LN01_MYODS/1-136          AC L5LN01.1
#=GS A0A067JAC6_JATCU/1-112      AC A0A067JAC6.1
#=GS A0A1X7QWJ4_9SACH/1-147      AC A0A1X7QWJ4.1
#=GS A0A2G8JX38_STIJA/1-135      AC A0A2G8JX38.1
#=GS A0A1V1SZV0_9FUNG/1-141      AC A0A1V1SZV0.1
#=GS E6R4K1_CRYGW/1-138          AC E6R4K1.1
#=GS A0A1Y1XVZ9_9FUNG/1-134      AC A0A1Y1XVZ9.1
#=GS A0A1V2L7I1_CYBFA/1-122      AC A0A1V2L7I1.1
#=GS A0A1Y2F1T9_9FUNG/9-141      AC A0A1Y2F1T9.1
#=GS U7PVN2_SPOS1/1-141          AC U7PVN2.1
#=GS M4DCC5_BRARP/1-104          AC M4DCC5.1
#=GS C5M1R3_CANTT/1-131          AC C5M1R3.1
#=GS B6HAR5_PENRW/1-142          AC B6HAR5.1
#=GS A0A182E9G2_ONCOC/1-137      AC A0A182E9G2.1
#=GS A0A093FXM3_DRYPU/1-136      AC A0A093FXM3.1
#=GS G4ZD24_PHYSP/1-136          AC G4ZD24.1
#=GS W5LDN2_ASTMX/1-139          AC W5LDN2.1
#=GS E7Q1W1_YEASB/1-140          AC E7Q1W1.1
#=GS L8G5T8_PSED2/1-140          AC L8G5T8.1
#=GS A0A0W0FCT3_9AGAR/1-141      AC A0A0W0FCT3.1
#=GS G0VJE2_NAUCC/1-139          AC G0VJE2.1
#=GS A0A1E3QKM8_9ASCO/1-136      AC A0A1E3QKM8.1
#=GS W0TBT5_KLUMD/31-168         AC W0TBT5.1
#=GS E7QCJ5_YEASZ/1-140          AC E7QCJ5.1
#=GS H2AYB1_KAZAF/1-133          AC H2AYB1.1
#=GS A0A0C9LPD7_9FUNG/1-136      AC A0A0C9LPD7.1
#=GS Q6DKC8_XENLA/1-135          AC Q6DKC8.1
#=GS A0A1V6NDB5_9EURO/1-142      AC A0A1V6NDB5.1
#=GS A7TT08_VANPO/1-141          AC A7TT08.1
#=GS R0KR50_SETT2/1-141          AC R0KR50.1
#=GS C5XZA1_SORBI/1-127          AC C5XZA1.1
#=GS A0A074W6R5_9PEZI/1-143      AC A0A074W6R5.1
#=GS A0A0B7NT63_9FUNG/1-141      AC A0A0B7NT63.1
#=GS A0A0B4IGP9_9HYPO/1-141      AC A0A0B4IGP9.1
#=GS A0A091R5C2_MERNU/1-128      AC A0A091R5C2.1
#=GS H2R510_PANTR/1-137          AC H2R510.2
#=GS A0A183SFM2_SCHSO/15-100     AC A0A183SFM2.1
#=GS A0A1C1CMV4_9EURO/1-95       AC A0A1C1CMV4.1
#=GS A0A1A6HJK8_NEOLE/9-135      AC A0A1A6HJK8.1
#=GS A0A1B0FH63_GLOMM/1-134      AC A0A1B0FH63.1
#=GS A0A094EHM6_9PEZI/1-140      AC A0A094EHM6.1
#=GS A0A166W0X1_9HOMO/1-130      AC A0A166W0X1.1
#=GS A7EKL9_SCLS1/1-140          AC A7EKL9.1
#=GS D3B6G0_POLPP/1-135          AC D3B6G0.1
#=GS A0A091J1F6_EGRGA/1-137      AC A0A091J1F6.1
#=GS A0A078I9Q8_BRANA/1-126      AC A0A078I9Q8.1
#=GS A0A1V6PSB7_9EURO/1-142      AC A0A1V6PSB7.1
#=GS A0A1B0GK83_LUTLO/1-134      AC A0A1B0GK83.1
#=GS A0A0G2J611_9EURO/1-129      AC A0A0G2J611.1
#=GS W9X7E2_9EURO/1-143          AC W9X7E2.1
#=GS A0A0P7UF87_9TELE/1-135      AC A0A0P7UF87.1
#=GS W6MSB2_9ASCO/1-131          AC W6MSB2.1
#=GS H2MWD1_ORYLA/1-135          AC H2MWD1.1
#=GS C8VQF6_EMENI/1-143          AC C8VQF6.1
#=GS A0A194W175_9PEZI/411-551    AC A0A194W175.1
#=GS A0A182VTA9_9DIPT/1-135      AC A0A182VTA9.1
#=GS A0A1E7FYE0_9STRA/3-144      AC A0A1E7FYE0.1
#=GS A0A024GI39_9STRA/24-160     AC A0A024GI39.1
#=GS A0A059EXP2_9MICR/66-117     AC A0A059EXP2.1
#=GS F6RP01_ORNAN/1-136          AC F6RP01.1
#=GS A0A1I8M2V5_MUSDO/1-134      AC A0A1I8M2V5.1
#=GS A0A251RVQ5_HELAN/1-129      AC A0A251RVQ5.1
#=GS H0GXH6_SACCK/1-126          AC H0GXH6.1
#=GS A0A0M3QW51_DROBS/1-134      AC A0A0M3QW51.1
#=GS A0A0D2RKY0_GOSRA/1-126      AC A0A0D2RKY0.1
#=GS A0A0M8MSF7_9HYPO/967-1109   AC A0A0M8MSF7.1
#=GS I1KQ72_SOYBN/1-126          AC I1KQ72.1
#=GS G2Y238_BOTF4/1-140          AC G2Y238.1
#=GS A0A2K5NUQ1_CERAT/68-203     AC A0A2K5NUQ1.1
#=GS A0A1E4T9N5_9ASCO/1-132      AC A0A1E4T9N5.1
#=GS E2R5S2_CANLF/1-136          AC E2R5S2.1
#=GS A9PCI7_POPTR/1-126          AC A9PCI7.1
#=GS A0A1I7XJM2_HETBA/22-141     AC A0A1I7XJM2.1
#=GS B6T975_MAIZE/1-127          AC B6T975.1
#=GS A0A0C9LZ76_9FUNG/1-142      AC A0A0C9LZ76.1
#=GS A0A0D2B0J2_9EURO/1-143      AC A0A0D2B0J2.1
#=GS M7XJU9_RHOT1/1-142          AC M7XJU9.1
#=GS H0GJ68_SACCK/1-126          AC H0GJ68.1
#=GS H3G6Y1_PHYRM/1-107          AC H3G6Y1.1
#=GS A0A0D2GZ53_9EURO/1-143      AC A0A0D2GZ53.1
#=GS A0A1B9I837_9TREE/1-117      AC A0A1B9I837.1
#=GS A0A179V3H6_BLAGS/1-142      AC A0A179V3H6.1
#=GS A0A0D0E308_9HOMO/1-139      AC A0A0D0E308.1
#=GS M2UGK2_COCH5/1-141          AC M2UGK2.1
#=GS A0A177D7D0_ALTAL/1-142      AC A0A177D7D0.1
#=GS H0X8E2_OTOGA/1-154          AC H0X8E2.1
#=GS A0A0T6BFG7_9SCAR/1-47       AC A0A0T6BFG7.1
#=GS W5KA27_ASTMX/1-136          AC W5KA27.1
#=GS B8N3Y9_ASPFN/1-140          AC B8N3Y9.1
#=GS W2PNZ9_PHYPN/1-113          AC W2PNZ9.1
#=GS A0A226PB28_COLVI/1-92       AC A0A226PB28.1
#=GS A0A059DDW6_EUCGR/1-124      AC A0A059DDW6.1
#=GS I1LRP3_SOYBN/1-124          AC I1LRP3.1
#=GS A0A074X1L3_9PEZI/1-143      AC A0A074X1L3.1
#=GS A0A1B8E718_9PEZI/1-140      AC A0A1B8E718.1
#=GS A0A023EKI9_AEDAL/1-134      AC A0A023EKI9.1
#=GS C4JY58_UNCRE/1-142          AC C4JY58.1
#=GS Q6DFC1_XENLA/1-137          AC Q6DFC1.1
#=GS E7LYC0_YEASV/1-83           AC E7LYC0.1
#=GS Q0U9D7_PHANO/40-178         AC Q0U9D7.2
#=GS A0A1Y1IM41_KLENI/4-130      AC A0A1Y1IM41.1
#=GS G1P2D2_MYOLU/30-165         AC G1P2D2.1
#=GS T5A6X6_OPHSC/1-142          AC T5A6X6.1
#=GS S7Q8M6_GLOTA/1-138          AC S7Q8M6.1
#=GS H3E114_PRIPA/64-118         AC H3E114.1
#=GS H2YK39_CIOSA/1-137          AC H2YK39.1
#=GS M5WB52_PRUPE/1-126          AC M5WB52.1
#=GS A0A1I8HFA2_9PLAT/1-134      AC A0A1I8HFA2.1
#=GS G4T5B1_SERID/1-139          AC G4T5B1.1
#=GS B2AA16_PODAN/1-145          AC B2AA16.1
#=GS F7FI52_CALJA/65-177         AC F7FI52.1
#=GS A0A0R3S0G0_9BILA/357-493    AC A0A0R3S0G0.1
#=GS A0A0D0A182_9HOMO/1-139      AC A0A0D0A182.1
#=GS A0A0D9N5P7_ASPFA/1-140      AC A0A0D9N5P7.1
#=GS A0A182MYC8_9DIPT/1-135      AC A0A182MYC8.1
#=GS M4BK73_HYAAE/1-133          AC M4BK73.1
#=GS A0A0A2WFT9_BEABA/1-154      AC A0A0A2WFT9.1
#=GS A0A093Y564_9PEZI/1-140      AC A0A093Y564.1
#=GS S8E699_FOMPI/1-139          AC S8E699.1
#=GS A0A225UT38_9STRA/1-119      AC A0A225UT38.1
#=GS A0A194XVM0_9HELO/1-139      AC A0A194XVM0.1
#=GS A0A183DQX1_9BILA/8-144      AC A0A183DQX1.1
#=GS G1M4K4_AILME/1-139          AC G1M4K4.1
#=GS A0A010QT85_9PEZI/68-208     AC A0A010QT85.1
#=GS A0A0C9WEV8_9HOMO/1-138      AC A0A0C9WEV8.1
#=GS G3I7S8_CRIGR/1-157          AC G3I7S8.1
#=GS A0A0A1U4H6_ENTIV/2-125      AC A0A0A1U4H6.1
#=GS A0A164Q5N4_9HOMO/1-124      AC A0A164Q5N4.1
#=GS A0A197JWH8_9FUNG/1-135      AC A0A197JWH8.1
#=GS A0A0E0GBG7_ORYNI/1-126      AC A0A0E0GBG7.1
#=GS A0A024U3L0_9STRA/1-133      AC A0A024U3L0.1
#=GS A0A0Q3T2C8_AMAAE/1-137      AC A0A0Q3T2C8.1
#=GS A0A1J9P598_9EURO/1-142      AC A0A1J9P598.1
#=GS G8BDU9_CANPC/1-139          AC G8BDU9.1
#=GS G8JQ35_ERECY/1-135          AC G8JQ35.1
#=GS A0A226MZA7_CALSU/8-98       AC A0A226MZA7.1
#=GS A0A2A2JH74_9BILA/12-149     AC A0A2A2JH74.1
#=GS H2UXB9_TAKRU/1-136          AC H2UXB9.1
#=GS E7Q650_YEASB/1-126          AC E7Q650.1
#=GS Q2UL88_ASPOR/1-140          AC Q2UL88.1
#=GS I1CBN1_RHIO9/23-116         AC I1CBN1.1
#=GS M3YAP8_MUSPF/1-136          AC M3YAP8.1
#=GS W3X555_PESFW/6-144          AC W3X555.1
#=GS A0A091HVD3_CALAN/81-119     AC A0A091HVD3.1
#=GS R0M124_NOSB1/1-119          AC R0M124.1
#=GS F7HK98_MACMU/1-110          AC F7HK98.2
#=GS S2J4N8_MUCC1/1-143          AC S2J4N8.1
#=GS Q6CIG6_KLULA/1-136          AC Q6CIG6.1
#=GS A0A094AAR1_9PEZI/1-140      AC A0A094AAR1.1
#=GS A0A0V0UXM9_9BILA/209-327    AC A0A0V0UXM9.1
#=GS A0A2G9HW43_9LAMI/1-128      AC A0A2G9HW43.1
#=GS J3LLU6_ORYBR/1-126          AC J3LLU6.1
#=GS W2PRW0_PHYPN/1-126          AC W2PRW0.1
#=GS A0A0K0DKX3_ANGCA/165-285    AC A0A0K0DKX3.1
#=GS A0A151W2Z6_HYPMA/1-139      AC A0A151W2Z6.1
#=GS A0A226MXC1_CALSU/1-69       AC A0A226MXC1.1
#=GS A0A0P1ACX9_9STRA/1052-1163  AC A0A0P1ACX9.1
#=GS A9S3H1_PHYPA/1-126          AC A9S3H1.1
#=GS A0A0D3BBW1_BRAOL/1-126      AC A0A0D3BBW1.1
#=GS B3M8E5_DROAN/1-134          AC B3M8E5.1
#=GS A0A1B8FHH7_9PEZI/1-140      AC A0A1B8FHH7.1
#=GS A0A0D2PC52_9AGAR/1-140      AC A0A0D2PC52.1
#=GS K3WFP5_PYTUL/1-128          AC K3WFP5.1
#=GS H2XTD6_CIOIN/1-137          AC H2XTD6.1
#=GS K7G584_PELSI/1-136          AC K7G584.1
#=GS H0EVL4_GLAL7/1-50           AC H0EVL4.1
#=GS A0A139AL23_GONPR/2-131      AC A0A139AL23.1
#=GS C1GHQ7_PARBD/1-127          AC C1GHQ7.2
#=GS A0A0L0HNI7_SPIPN/7-73       AC A0A0L0HNI7.1
#=GS A0A0R3WN21_HYDTA/1-34       AC A0A0R3WN21.1
#=GS A0A1Y1Y7V1_9FUNG/1-134      AC A0A1Y1Y7V1.1
#=GS H2V2U3_TAKRU/1-136          AC H2V2U3.1
#=GS A0A075A7C2_9TREM/67-204     AC A0A075A7C2.1
#=GS C6T197_SOYBN/1-126          AC C6T197.1
#=GS A0A091DMG0_FUKDA/1-136      AC A0A091DMG0.1
#=GS A0A167N0B4_9PEZI/1-141      AC A0A167N0B4.1
#=GS V9DZ47_PHYPR/1-113          AC V9DZ47.1
#=GS A0A080WNZ6_TRIRC/1-124      AC A0A080WNZ6.1
#=GS A0A1U7S6M1_ALLSI/1-101      AC A0A1U7S6M1.1
#=GS L1J661_GUITH/1-128          AC L1J661.1
#=GS A0A0N0DHQ3_FUSLA/1-144      AC A0A0N0DHQ3.1
#=GS A0A1U8L1P0_GOSHI/1-126      AC A0A1U8L1P0.1
#=GS A0A1W0E2B9_9MICR/69-117     AC A0A1W0E2B9.1
#=GS A0A0S7E0Z9_9EURO/1-143      AC A0A0S7E0Z9.1
#=GS A0A2K5MXD9_CERAT/1-137      AC A0A2K5MXD9.1
#=GS A0A0M9FRG1_9TRYP/3-130      AC A0A0M9FRG1.1
#=GS W7X7M6_TETTS/1-138          AC W7X7M6.1
#=GS A0A1E3IA53_9TREE/1-113      AC A0A1E3IA53.1
#=GS A0A0D9P079_METAN/1-141      AC A0A0D9P079.1
#=GS M3ZBY1_NOMLE/1-137          AC M3ZBY1.2
#=GS A0A2I4AZ84_9TELE/1-136      AC A0A2I4AZ84.1
#=GS H0VCJ0_CAVPO/1-136          AC H0VCJ0.1
#=GS A0A2H2ZSW8_9HYPO/1-143      AC A0A2H2ZSW8.1
#=GS A0A2B7WYQ6_9EURO/1-142      AC A0A2B7WYQ6.1
#=GS A0A2I3MV91_PAPAN/1-137      AC A0A2I3MV91.1
#=GS G5EBI0_CAEEL/1-134          AC G5EBI0.1
#=GS A0A1L9N6Q8_ASPTU/1-146      AC A0A1L9N6Q8.1
#=GS E2RRL9_CANLF/1-139          AC E2RRL9.2
#=GS A0A087RKP7_APTFO/1-78       AC A0A087RKP7.1
#=GS F7FAT9_MONDO/1-135          AC F7FAT9.1
#=GS A0A1L9VUP1_ASPGL/1-142      AC A0A1L9VUP1.1
#=GS A0A2A4JIK1_HELVI/1-134      AC A0A2A4JIK1.1
#=GS A0A1E5R9D0_9ASCO/1-131      AC A0A1E5R9D0.1
#=GS A0A093P162_PYGAD/1-138      AC A0A093P162.1
#=GS A0A0L7R1B6_9HYME/1-135      AC A0A0L7R1B6.1
#=GS A0A151IT42_9HYME/1-136      AC A0A151IT42.1
#=GS S7XH23_SPRLO/1-72           AC S7XH23.1
#=GS A0A1D6JVL3_MAIZE/1-142      AC A0A1D6JVL3.1
#=GS A0A225UGY0_9STRA/1-128      AC A0A225UGY0.1
#=GS R8BGV1_TOGMI/1-142          AC R8BGV1.1
#=GS A0A183BL87_GLOPA/1-100      AC A0A183BL87.1
#=GS W0TBF3_KLUMD/1-151          AC W0TBF3.1
#=GS G7XIC9_ASPKW/1-146          AC G7XIC9.1
#=GS A0A1D2VQH6_9ASCO/1-135      AC A0A1D2VQH6.1
#=GS A0A0F9WFT3_9MICR/1-74       AC A0A0F9WFT3.1
#=GS A0A0L9VIJ3_PHAAN/1-126      AC A0A0L9VIJ3.1
#=GS W5DX55_WHEAT/1-126          AC W5DX55.1
#=GS A0A1E3NED0_9ASCO/1-131      AC A0A1E3NED0.1
#=GS A0A084QGE0_STAC4/1-143      AC A0A084QGE0.1
#=GS A0A2K3E5Z9_CHLRE/1-136      AC A0A2K3E5Z9.1
#=GS A0A1B0A7H3_GLOPL/1-46       AC A0A1B0A7H3.1
#=GS A0A2I4EW72_9ROSI/1-126      AC A0A2I4EW72.1
#=GS A0A0C3BTV4_9HOMO/1-139      AC A0A0C3BTV4.1
#=GS A0A0E0GBG5_ORYNI/1-126      AC A0A0E0GBG5.1
#=GS R7Z691_CONA1/1-144          AC R7Z691.1
#=GS A0A1L8F1N4_XENLA/1-135      AC A0A1L8F1N4.1
#=GS A0A2B7Z488_9EURO/1-140      AC A0A2B7Z488.1
#=GS A0A251RQZ4_HELAN/1-126      AC A0A251RQZ4.1
#=GS A2DY63_TRIVA/1-133          AC A2DY63.1
#=GS A0A1L1RWD3_CHICK/1-74       AC A0A1L1RWD3.1
#=GS A0A2I2U2L4_FELCA/1-136      AC A0A2I2U2L4.1
#=GS A0A194RAD5_PAPMA/1-134      AC A0A194RAD5.1
#=GS A0A1E5RHE2_9ASCO/1-171      AC A0A1E5RHE2.1
#=GS S6EDL2_ZYGB2/1-140          AC S6EDL2.1
#=GS YETL_DICDI/1-135            AC Q54K74.2
#=GS A0A225A6E6_9EURO/1-147      AC A0A225A6E6.1
#=GS D7L7W4_ARALL/1-126          AC D7L7W4.1
#=GS A0A0G2GRH8_9PEZI/1-143      AC A0A0G2GRH8.1
#=GS A0A139A7I0_GONPR/1-129      AC A0A139A7I0.1
#=GS A0A183CFX0_GLOPA/29-93      AC A0A183CFX0.1
#=GS A0A087H1U1_ARAAL/1-126      AC A0A087H1U1.1
#=GS A0A1I7RHS9_BURXY/1-136      AC A0A1I7RHS9.1
#=GS A0A0A1PB07_9FUNG/1-133      AC A0A0A1PB07.1
#=GS E3N5U9_CAERE/65-198         AC E3N5U9.1
#=GS A0A1G4KJK0_9SACH/1-136      AC A0A1G4KJK0.1
#=GS A0A1W5DA80_9LECA/293-435    AC A0A1W5DA80.1
#=GS A0A218UGH4_9PASE/1-137      AC A0A218UGH4.1
#=GS A0A0N0NN16_9EURO/1-143      AC A0A0N0NN16.1
#=GS A0A087XDW4_POEFO/1-136      AC A0A087XDW4.2
#=GS A0A177WT29_BATDE/1-102      AC A0A177WT29.1
#=GS A0A1U7S150_ALLSI/1-136      AC A0A1U7S150.1
#=GS G4MX02_MAGO7/1-141          AC G4MX02.1
#=GS A0A183VRI8_TRIRE/1-88       AC A0A183VRI8.1
#=GS A0A1Y1V539_9FUNG/9-141      AC A0A1Y1V539.1
#=GS A0A1J6JCB5_NICAT/1-126      AC A0A1J6JCB5.1
#=GS A0A1B0D9D3_PHLPP/1-134      AC A0A1B0D9D3.1
#=GS A0A0V1P5H2_9BILA/149-284    AC A0A0V1P5H2.1
#=GS A0A094DGU3_9PEZI/1-140      AC A0A094DGU3.1
#=GS N1JDR0_BLUG1/1-139          AC N1JDR0.1
#=GS A0A1S3MZ22_SALSA/20-141     AC A0A1S3MZ22.1
#=GS A0A1S3GMX9_DIPOR/2-110      AC A0A1S3GMX9.1
#=GS X0LTU1_FUSOX/1-143          AC X0LTU1.1
#=GS L2FSK3_COLGN/1-141          AC L2FSK3.1
#=GS W4FKA2_9STRA/2-128          AC W4FKA2.1
#=GS A0A2I2U7Z5_FELCA/118-253    AC A0A2I2U7Z5.1
#=GS I3KB96_ORENI/1-135          AC I3KB96.1
#=GS A0A1L9P6E6_ASPVE/1-143      AC A0A1L9P6E6.1
#=GS W6QDV2_PENRF/1-142          AC W6QDV2.1
#=GS A0A0A1PEZ4_9FUNG/1-133      AC A0A0A1PEZ4.1
#=GS A0A1A6GXQ4_NEOLE/1-95       AC A0A1A6GXQ4.1
#=GS A0A1D5QRG9_MACMU/1-111      AC A0A1D5QRG9.1
#=GS A0A183I357_9BILA/384-520    AC A0A183I357.1
#=GS X0CXD0_FUSOX/1-143          AC X0CXD0.1
#=GS F0XAI8_GROCL/1-140          AC F0XAI8.1
#=GS A0A1S3ZUE0_TOBAC/1-126      AC A0A1S3ZUE0.1
#=GS A0A135TWS7_9PEZI/99-239     AC A0A135TWS7.1
#=GS J9VSY5_CRYNH/1-138          AC J9VSY5.2
#=GS A0A0C4DT17_MAGP6/1-141      AC A0A0C4DT17.1
#=GS Q4D7Z9_TRYCC/2-134          AC Q4D7Z9.1
#=GS B4N4B2_DROWI/1-133          AC B4N4B2.1
#=GS A0A0L0SV53_ALLMA/1-142      AC A0A0L0SV53.1
#=GS W4XKT2_STRPU/1-75           AC W4XKT2.1
#=GS A0A1S3JN79_LINUN/1-96       AC A0A1S3JN79.1
#=GS A0A1B9GVQ5_9TREE/1-70       AC A0A1B9GVQ5.1
#=GS A0A1S3MZH5_SALSA/1-136      AC A0A1S3MZH5.1
#=GS A0A0A1NYX6_9FUNG/1-93       AC A0A0A1NYX6.1
#=GS A0A183CFX0_GLOPA/1-39       AC A0A183CFX0.1
#=GS C5WRK5_SORBI/1-126          AC C5WRK5.1
#=GS A0A183JX73_9TREM/1-137      AC A0A183JX73.1
#=GS M7TFF0_EUTLA/3-143          AC M7TFF0.1
#=GS A0A0L1HZY0_9PLEO/1-141      AC A0A0L1HZY0.1
#=GS E0CVQ1_VITVI/1-124          AC E0CVQ1.1
A0A1A6A2S2_9TREE/1-138                 ..................................................MTLYY.TLCFG.LLM.AELAL.FATM.V........C.P.M...PF.AL........R....KKLF.H.............F..L..S.....EN..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......V..AV.......LF..V................DAVQ.R......MV.RIAQEGAAAk..............................akPDMV.D.ARTETNYAAR.RF.Y.A...QRN.L..YLT..GATLF.L.SL........LLARVF.YIVLDFIHVQESYT--tl....................................................................
G7JEQ0_MEDTR/1-124                     ................................................ml-----.----Q.LLY.TAIFG.EMLL.I........L.T.L...VF.KT........P...lRKLV.I.............V..S..L.....DR..V......K..R....G..R.GP..I..V........V..............T..T.VGAT......L..IV.......VL..S................SSLY.S......MA.KIQQRTVEA.................................G---.V.LNPTDQVLMS.KH.M.L...E--.A..SLM..GFVLF.L.SL........MIDRLH.HYIRELRLLRKTMEA-v.....................................................................
A0A0D3DJQ9_BRAOL/34-159                ..................................................MALQW.LILSY.VVA.AEVVI.AVVL.T........L.P.Y...PM.VV........K....KRVV.S.............L..V..S.....LI..L......Q..P....A..A.--..-..-........-..............-..S.IVAF......A..AF.......QL..C................DIYW.K......--.-NEHRLSCS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AAGIF.L.YW........CIYRIC.KYNKDLELLE------eaekrh................................................................
A0A0W7VRW2_9HYPO/1-143                 ..................................................MTLYY.SLVFA.LLM.AEMGL.FMLL.L........V.P.L...PF.KI........K....RKIF.T.............F..I..S.....ES..P......L..V....A..K.MQ..Y..W........M..............K..I.TFVF......I..LI.......LF..V................DSVN.R......VY.KVQVELMAAheqt.........................akgnAAVI.M.GSERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVK--my....................................................................
A0A087U8K9_9ARAC/1-136                 ..................................................MSLQW.TLVAG.FLY.AEMVV.VILL.M........L.P.F...IS.AT........M...wQKLF.K.............S..R..F.....LK..S......L..G....A..Y.SN..F..Y........F..............S..A.FFVI......L..LL.......LF..L................DSLR.Q......MH.KYSIARDQE.................................QDHG.H.LDAELQQSMK.MF.R.A...QRN.C..YIA..GFALF.L.AP........VIRRIA.SLLSRQAELIASAEA-s.....................................................................
A1D1T9_NEOFI/1-142                     ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........I.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFtke..........................gnsmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDRVKH-l.....................................................................
J3JWC1_DENPD/1-136                     ..................................................MSIQW.TLIAG.FLY.AEIAV.VLLL.V........L.P.V...AS.PR........R...wNAIF.K.............S..R..F.....LQ..A......L..Q....R..Q.AG..V..Y........F..............V..I.LFGI......L..VL.......FL..L................DAIR.E......MR.KYSNLETEE.................................HGHA.H.LDREMQGSMR.LF.R.A...QRN.F..YIS..GFALF.L.AL........VIRRLV.ILISSQAALLAQSAA-s.....................................................................
A0A152A8S8_9MYCE/1-135                 ............................................meaili-----.-VAFF.LLV.VEIFI.CTLA.V........F.P.F...LS.MD........T...rKKLF.S.............Q..I..H.....KV..M......G..G....H..T.TK..V..V........V..............Y..V.MASL......M..LF.......IF..L................QSNY.D......SY.KTDKKLHQG.................................G-GV.L.VTDKPGEYSK.LF.R.H...QRN.I..YLS..GFVLF.L.YF........LISRAQ.SIIKELGAVEVKSN--av....................................................................
Q5E9F1_BOVIN/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAVEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
D2VYR5_NAEGR/1-130                     ................................................ms---SW.YLVFL.ALA.LLTTLnLVLL.F........V.P.L...PS.FL........R....TKLV.R.............-..-..-.....--..K......L..D....S..G.KA..I..F........L..............G..L.LVVF......L..VL.......AF..F................-CYS.D......MN.KYHLEKATA.................................---K.T.FELEAQRQMK.EF.R.A...QRN.F..YMS..MIGAV.L.SL........ITL---.----------------gvnmkekkiidledkvqlkqres...............................................
F8PN20_SERL3/1-139                     ..................................................MTIYY.SLTFM.LLA.AEMVT.FCLL.V........S.P.I...PY.TI........R....RKLF.R.............F..L..S.....ES..P......T..V....A..K.VA..Y..A........L..............K..I.SFIF......V..GI.......LF..V................DAVQ.R......MF.RVTAESEMVks.............................ggQGMQ.D.VRTETNFAAR.KF.Y.A...QRN.T..YLT..GFCLF.L.SL........VLTRTF.YILLDLIHTQEQYAK-l.....................................................................
A0A2H3BY65_9AGAR/1-139                 ..................................................MTIYY.SLTFL.LLA.AEMGT.FCLI.V........L.P.L...PH.TV........K....KRVF.S.............F..L..S.....TS..P......F..V....A..K.IA..Y..V........L..............K..I.SFIF......V..GI.......LF..F................DALQ.R......MF.RVTAEAELAks.............................gqQGVS.D.VRTETNLAAR.KF.Y.S...QRN.V..YLT..GFTLF.L.SL........VLTRTF.SIILDLIQVEEEV---lky...................................................................
D8SCN0_SELML/1-126                     ..................................................MALEW.AGLMI.VVA.AESLL.LLFL.T........F.P.W...PA.KF........R....SSII.G.............V..S..-.....--..-......-..-....S..S.IL..R..P........L..............L..A.VLPF......A..GF.......LL..L................DVY-.-......-M.KYENRIQCQ.................................AGSC.T.AMDREHYAKS.VM.K.S...QRN.G..ILG..VFAIL.L.YW........FSYRVT.HILVDLEKTNKQI---svk...................................................................
A0A066XUZ0_COLSU/1-142                 ..................................................MTLYY.TLVFV.LLM.VEMGL.FMLL.I........V.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......V..V....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELALAtek..........................qnsgGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRS-y.....................................................................
A0A0F8CAR7_LARCR/1-144                 ..................................................MTLQW.TAVAF.FLY.AEIAV.NLIL.C........I.P.F...IS.AKsvllkqlcR...wRSVF.N.............L..S..I.....WN..W......L..S....P..Y.WN..K..C........F..............F..T.MIMV......L..IV.......LF..C................DAVR.E......VN.KYSGPESMQ.................................DAKV.N.PNVYDHVHMK.LF.R.A...QRN.L..YIS..GFSIF.L.WL........IMRRVV.TLLNQVAVTLENS---agl...................................................................
G2Q1T3_MYCTT/1-142                     ..................................................MTLYY.TLVFL.LLV.AEMAL.FMLL.I........L.P.L...PF.PM........R....RKVF.T.............F..I..S.....EN..P......I..V....A..K.VQ..Y..W........L..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELASAten..........................tgtsAPTI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEEKLKQ-y.....................................................................
A0A0B0NMF7_GOSAR/1-126                 ..................................................MALQW.MILTY.VVA.AEAAL.ALLL.T........L.P.S...PK.LL........K....NRLV.S.............L..I..S.....VI..-......-..-....-..-.LQ..P..A........L..............-..F.IVPF......A..GF.......QL..L................DIYW.K......NE.HRLMCTSE-.................................--IC.T.AAERDRYEKS.FY.K.S...QRN.V..ILC..VTACL.L.YW........CIQRIC.KYNKEIQSLEE-----iekry.................................................................
A0A183M7A1_9TREM/1-67                  ..........................................lrqaynsi-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.-----K-DH.................................PHEM.R.PETESLYLMR.MF.R.A...QRN.F..YIT..GFSLF.V.WF........VLHRLV.SLLSEHAKMAASEEA-s.....................................................................
A0A1E5R258_9ASCO/1-127                 ..................................................MSLYL.TLLFL.LLV.TEMAI.LFVL.L........M.P.L...PH.MV........R....KRIG.Y.............M..Y..N.....NL..K......A..S....S..Q.MK..T..V........L..............V..V.FSIL......V..SS.......LF..A................DSMK.R......GA.RPLPLDRNL.................................----.-.--VTPDMLAT.KA.Y.H...QRN.I..YIS..GFILY.F.GL........CIPIVM.GVIAKLVKYEDTL---ki....................................................................
YET1_YEAST/1-139                       ..................................................MSLYF.TTLFL.LLT.VEMVM.LFIF.V........L.P.L...PF.RI........R....RGIF.S.............T..Y..N.....QL..T......A..K....Q..Q.IK..T..I........I..............F..I.TGCL......V..GL.......LF..I................DSWK.R......SQiRVSLYHNDNs...............................gSIGS.S.AVTPIQALAS.RA.Y.N...QRN.M..YIS..GFILY.F.SI........CIPTVM.SIVKRLVKYQ------glineqe...............................................................
K1S3U6_CRAGI/13-148                    ..................................................MALQW.TFVAS.FMY.IEIAV.VIIL.L........L.P.F...VS.PG........R...wQKIF.R.............S..R..L.....VS..G......V..S....A..Y.SN..I..Y........F..............N..V.FIAI......L..LI.......LF..V................DSIR.E......VH.KYTAPTEEV.................................DLKH.N.PDAANLAMMK.LF.R.A...QRN.F..YIS..GFALF.L.WF........IIRRLL.TLINEEAKLAAQCQA-y.....................................................................
A0A286U8M5_9HOMO/1-113                 ..................................................MTIYY.SLTFL.LLA.SEMIT.FCAI.V........A.P.L...PY.AV........R....KRVF.T.............F..L..S.....ES..P......I..V....G..K.IA..Y..G........L..............K..I.AFIF......V..AV.......LF..A................DALQ.R......MF.RITAEAEAAka............................sglGAAH.D.IRAETNFAAR.KF.Y.A...QRN.T..YLT..-----.-.--........------.----------------eya...................................................................
A0A022Q5Q3_ERYGU/1-126                 ..................................................MGLQW.MILTY.VVA.AEAAV.AVVL.T........L.P.S...PK.AV........K....SRIV.S.............L..V..S.....LI..L......Q..P....S..-.--..-..-........-..............L..F.IIPF......S..AF.......QL..L................DIYW.K......N-.--EHRLMCT.................................GDVC.T.ASERDRYEKS.IY.K.S...QRN.S..ILC..TVACL.L.YW........FIYRVC.KYCKDIQSMEEV----ekry..................................................................
I2K2P5_DEKBR/2-82                      .......................ffdaxktsfphkdssfaafsaqsypvt-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................--KT.I.GQSIWDVRSK.KF.Y.A...HRN.M..YIT..GAVLY.L.MV........AIYFND.LLLSSIVRNKEKL---ika...................................................................
A0A096MR05_PAPAN/1-136                 ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A1B9ING5_9TREE/1-126                 .................................................m-----.-----.---.SELAL.FATM.V........C.P.M...PF.TL........R....KRMF.H.............F..L..S.....EN..P......V..V....A..K.VQ..Y..G........L..............K..I.TFIF......V..AV.......LF..V................DAVQ.R......MV.RIAQEGAAAk..............................akPDMV.D.ARTETNYAAR.RF.Y.A...QRN.L..YLT..GATLF.L.SL........LLARVF.YIVLDFIHVQENYT--tl....................................................................
A0A067QHE8_ZOONE/1-136                 ..................................................MSLQW.TIIAT.FLY.VEIVV.VLLL.V........L.P.V...AS.PQ........R...wNKLF.K.............S..R..F.....LH..A......L..N....N..Q.AF..I..Y........F..............L..V.LLAI......L..VL.......FF..L................DAIR.E......MR.KYSSAETTE.................................ATHA.H.LDAEMQVNMR.LF.R.A...QRN.F..YIA..GFALF.L.SL........VIRRLV.TLISQQASLVAQSEA-f.....................................................................
E7QJ52_YEASZ/1-83                      ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.-MIF......V..GL.......LF..I................DSWK.R......SQiRVSTYRNQK................................nPYII.N.SVTPVDALAS.RA.Y.N...QRN.V..YIS..GFIIY.F.YI........CILTVM.SILRRIVEWNDKMKA-g.....................................................................
A0A0D7BAR8_9AGAR/1-138                 ..................................................MTIYY.SLTFM.LLA.AEMAT.FCVL.V........T.P.L...PH.NV........K....KKLF.S.............F..L..S.....TS..P......I..I....A..K.VA..Y..A........L..............K..I.SFIF......V..AI.......LF..F................DALQ.R......MW.RVAAESEQAk..............................sgTATH.D.VRTETNFAAR.KF.Y.S...QRN.V..YLT..GFTLF.L.SL........VLTRTF.SIIIDLIHAEEELR--tv....................................................................
Q8SVM3_ENCCU/1-120                     ..................................................MGITT.QLVQS.ILL.GEMCV.FTFM.L........L.P.I...SK.GL........K....KSMM.K.............L..F..Q.....TS..K......V..Y....R..G.FL..H..I........L..............Y..V.LFAM......I..LV.......MF..V................DSAY.K......IY.TGEDQANP-.................................----.-.--------FV.LY.Q.A...ERN.M..YLT..GFTLF.L.AV........IFRMFI.RMMCMLFREEE-----sall..................................................................
B8M2V7_TALSN/1-142                     ..................................................MTLYY.TLVFM.LLV.FEMLV.FLAL.I........V.P.L...PY.SV........K....RKLF.A.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........L..............R..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEMSAFskd..........................ttgvGAAA.L.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMIVEVLRLEDRVK--ll....................................................................
A0A0C2WUD2_AMAMU/1-34                  ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.M..YLT..GFCLF.L.SL........VLTRTF.HLLLDLIHTKEGYY--kl....................................................................
G0W7F3_NAUDC/1-148                     ..................................................MSLYF.MALFG.LLI.LEMSV.LFIS.V........L.P.L...PN.KI........R....KGIY.K.............A..Y..F.....KT..T......S..S....Q..E.SK..T..I........I..............I..I.LSVL......V..SL.......LF..I................DSWK.R......SQfRVTTYQSKQyqnvrr.....................ggsgneGIDD.A.PVTPLQALAS.RA.Y.N...QRN.V..YIS..GFILY.F.LV........GIPTVM.SIVRRLVKYDDLI---keq...................................................................
A0A1B8D531_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMGL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAse............................qsqTGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
A0A1W4WMW9_AGRPL/1-134                 ..................................................MSLQW.TLIAG.FLY.LEIVI.VLLL.V........L.P.I...AS.PR........R...wNTFF.K.............S..R..F.....LQ..G......I..Q....Q..Q.AG..I..Y........F..............V..V.LLAV......L..VL.......FL..L................DAIR.E......MR.KYSSPEVTD.................................--HQ.H.LDAEMQGNMR.LF.R.A...QRN.F..YIS..GFALF.L.CL........VIRRLV.TLISQQASLLAQSEA-a.....................................................................
A0A2I3RWQ2_PANTR/1-137                 ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A1L8GU26_XENLA/2-138                 ..................................................MTFQW.TAVAS.FLY.GEVAV.LLIL.C........I.P.F...IS.PL........R...wRKIF.R.............F..Q..L.....WS..K......V..S....P..Y.WN..K..A........F..............L..S.IIVV......L..IV.......LF..L................DAAR.E......VR.KYSASNLTD................................kNAKL.Y.PSSYDLIHMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRVV.SLIMELASE-------iegngam...............................................................
A0A212EZA4_DANPL/1-64                  ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......MR.KYSHSSEGP.................................---T.H.LANEMKGSVK.LF.R.A...QRN.F..YIT..SFAIF.L.AY........VIRRII.TMILIQHELQVKAD--qi....................................................................
A0A0N4XTN1_NIPBR/6-129                 ..................................................MTLQW.SIIAA.VLY.VEIAV.TFIL.L........L.P.W...IR.PS........L...wSKLF.K.............S..R..L.....VA..S......L..S....A..H.AQ..I..Y........S..............Y..A.GAFV......L..FI.......LF..A................DAVR.E......VN.KYSHIEVGMe...............................sSVRH.A.ADADAVIHMR.LF.R.A...Q--.-..---..-----.-.--........------.----------------likrimgllsrsaqleaaseaa................................................
K2RU84_MACPH/1-143                     ..................................................MTLYY.SLVFM.LLV.AEMVI.FMSL.I........I.P.L...PF.TW........R....RRLF.T.............F..I..S.....EN..P......L..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAsgae.........................kqgrAAVI.G.GPERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEEVKS-l.....................................................................
A0A0K9PWU7_ZOSMR/1-124                 ................................................mi-----.QLLFS.VLT.VEASV.VVLL.L........V.K.T...P-.--........I....RKLV.T.............L..G..L.....DR..L......K..R....G..R.GP..V..M........V..............K..T.LAGA......L..FV.......MF..G................SSLY.S......MQ.KIGTRSDDI.................................G---.S.LSATDQVLWS.RH.L.L...--E.A..SLM..GYSLF.L.SL........IIDRLH.HYIKELRSMKKSKEA-l.....................................................................
A0A1U8B5T1_NELNU/1-127                 ..................................................MALQW.IILSY.VVA.VEAAI.ALLL.T........L.P.A...PK.LL........-....----.K.............S..R..V.....VS..L......I..S....I..L.LQ..P..A........M..............G..I.V-PF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEVC.T.AAERDRYEKS.IY.K.A...QRN.V..VLC..AAACL.L.YW........FVFRLC.KYYKEIQKLEEAEK--klk...................................................................
A0A1S3XHQ0_TOBAC/1-129                 ..................................................MALEW.VVLGY.AAA.AEVVM.VILL.T........L.P.G...TY.PL........R....KGLI.S.............V..T..-.....--..-......-..-....R..N.LL..K..P........F..............L..S.VVPF......C..VF.......LL..L................DIYW.K......YE.TRPRCKSA-.................................-ESC.T.PTELMRHQKS.VV.K.S...QRN.A..LLI..AAALM.F.YW........LLYSVT.RLVTRVEMLNQRVEK-lqn...................................................................
I1C0I3_RHIO9/1-139                     ..................................................MALYY.GIVFG.ILT.IEIVL.FFLL.M........L.P.I...ST.RW........K....KPVF.R.............W..L..A.....TS..P......T..I....A..Q.AT..Y..I........L..............K..I.VFGF......I..FV.......LF..V................DAVN.T......LR.AFYEVVHDDdn.............................vtPGTS.D.FRAQVNQAAK.KF.Y.A...QRN.L..YLT..GFTML.L.LL........ILNTIK.DMNLEYIRLEDET---lel...................................................................
A0A0D9RG29_CHLSB/1-137                 ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................rSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A1G4KMI5_9SACH/1-141                 ..................................................MSVYL.SVLFA.MLT.TEMAC.LFLL.V........L.P.L...HY.KI........R....KAMA.S.............T..Y..F.....RL..M......S..Y....T..Q.VK..T..V........I..............A..I.VGGL......V..GL.......LF..V................DSWK.R......SQ.ITVSLHHHQvsa...........................gadPNGS.G.SVTSVQALAS.RA.Y.N...QRN.I..YIS..GFILY.F.AF........CIPTVI.SVVRRLVKYETL----irek..................................................................
A0A0F7VIC8_9EURO/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMAV.FLAL.I........V.P.L...PF.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELASFskd..........................gtsiGAAH.L.GVDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEDRVK--ll....................................................................
A0A093ZKB8_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMGL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAte............................qsqSGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
Q2LZ83_DROPS/1-134                     ..................................................MSLVW.TLIAG.FLY.AEIAL.VLLL.V........L.P.V...AS.PY........R...wNRFF.K.............S..K..F.....LA..L......L..A....Q..Q.AH..I..Y........F..............F..L.IMGV......L..VL.......FL..L................EAIR.E......MR.KYSNHEQSG.................................E--V.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRRLV.TLVSAQANLLAQSEA-s.....................................................................
A0A226MWQ3_CALSU/3-69                  ..................................................MSLQW.TVVAT.FLY.AEVFL.VLLL.C........V.P.F...VS.PT........R...wQKIF.K.............S..R..L.....VG..L......A..V....A..Y.GN..T..A........F..............V..V.LIVI......L..VL.......LL..L................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------gea...................................................................
G3JJX0_CORMM/1-177                     ..................................................MTLYY.TIVFA.LLM.FEMAL.FLFF.I........I.P.L...PH.NP........R....RVIF.Tnahaqa.ltkgcsF..I..S.....EN..K......V..V....A..Q.IQ..Y..W........L..............K..I.TFIF......I..IV.......LF..V................DSVN.R......VY.RVQVELHDTmeraaksggtyvasf...pqrnlgcqkltlalpSSVV.L.GHERTEVQAR.KF.Y.A...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIKDIIRLEERIRA-y.....................................................................
A0A0L8HKE2_OCTBM/1-138                 ..................................................MGLQW.TIIAS.FLY.FEIGM.VFLF.L........L.P.F...IS.PL........T...wRKLF.K.............S..R..L.....LS..L......I..S....T..Y.SY..L..Y........I..............R..L.LMLA......L..AV.......AF..V................DSIW.H......LR.KYNNAIDKLd...............................tMTGV.M.PGVGQNQHLN.LF.R.A...QRN.F..YIS..GFSLF.L.WM........VLNRLV.KLITAQAQLQTDLEA-t.....................................................................
Q2HDK8_CHAGB/1-142                     ..................................................MTLYY.TLVFL.LLV.GEMGL.FMLL.I........M.P.L...PF.AM........R....RKVF.T.............F..I..S.....EN..P......I..V....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELAAAten..........................tgasAPAI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEEKLKQ-y.....................................................................
A0A2I3LVA0_PAPAN/1-137                 ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................rSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A1F8AEL7_9EURO/1-140                 ..................................................MTLYY.SLVFC.LLV.FEMVI.FIGL.I........V.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEVTNFsk............................enmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVKT-l.....................................................................
A0A251S7N8_HELAN/1-127                 ..................................................MALQW.AVLGY.TAA.AEAAM.VLLL.T........L.P.G...LG.PL........R....KGLV.S.............V..I..L.....N-..I......L..K....P..L.--..-..-........-..............-..-.-LSI......V..PF.......CL..F................LSLD.I......YW.KYENRPTCK................................sADSC.T.PTEYLRHQKS.IM.K.S...QRN.M..LLI..VMALV.F.YC........LLCLVT.HLVVKMEQLNSRVEK-l.....................................................................
A0A1D2VC73_9ASCO/1-148                 ..................................................MSLYM.TFIFL.SLI.IEMSI.ITIL.V........I.P.F...PI.II........R....KQFI.T.............V..A..D.....YV..S......S..S....L..E.FR..V..S........I..............K..C.FGGL......I..LL.......LF..L................DALN.R......SS.SINLHPESTglgnsg....................ngdgsqdNVGT.N.VLITPELIAT.KF.Y.N...QRN.F..YLS..GAILF.L.LL........AIPTVL.NILKKIVKYET-----ivqte.................................................................
L8GQY4_ACACA/1-143                     ..................................................MGLGW.QALGV.FLG.AEALG.CVVL.I........L.P.L...PL.DT........K....RSLL.Q.............F..L..S.....SN..P......H..V....A..K.AQ..S..Y........L..............W..V.IFFL......L..LA.......LF..A................DSLR.E......AH.LAGGRLEVHns.............................hsHEHG.G.HDDMHALEAH.LY.A.S...QRN.A..LLT..GVSLF.L.LV........FVNVVT.ALFKL-----------eqnaeilskqaknqe.......................................................
M2N463_BAUCO/1-141                     ..................................................MTLYY.SLVFA.LLV.FEMAV.FMSL.I........I.P.L...PF.SW........K....RKLF.T.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........L..............R..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQVELSMAkqq...........................sgaAAAV.A.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEEVKR-l.....................................................................
A0A0E0NKM6_ORYRU/1-127                 ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.GL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........-..............M..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCDD--.................................EHHC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.SLVVRLDQLQQRVDK-l.....................................................................
F7FTW2_MONDO/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VQ..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LL..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..HIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
B7Z2L0_HUMAN/1-43                      ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.--------MK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A179UZ95_BLAGS/1-144                 ..................................................MTLYY.SLVFL.LLV.VEMVI.FVGL.I........I.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQTELSTHskem........................ggagrRTAA.L.GAERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVKQ-l.....................................................................
C5DS01_ZYGRC/1-136                     ..................................................MSIYY.KMVFG.ILV.AEVSF.FSVL.A........L.P.L...PS.KI........R....KPLV.S.............V..L..V.....RP..F......L..N....D..I.IQ..V..A........I..............K..C.MLGF......V..LL.......LF..V................DSIN.R......VY.SVEQELDAI................................nPAGG.Y.SSSRMEVLSR.KF.F.A...QRN.M..YLT..GITLF.L.TF........VVVRTF.NLVRELLELKDHYH--la....................................................................
A0A091SIV7_9AVES/1-98                  ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSAVHVNE................................kAANV.N.TNAFDHIQMK.LF.R.-...---.-..---..-FSLF.L.WL........VLRRTI.TLLTQLAKGMASHAA-l.....................................................................
A0A068Y220_ECHMU/1-139                 ..................................................MSILW.TITAA.CLY.TEAAV.ITLL.L........M.P.F...IS.SR........I...wNAVF.K.............S..R..I.....VG..R......L..S....S..Y.AS..F..Y........F..............N..G.CLLI......L..GL.......MV..F................EAVR.Q......VR.YQNHVYQELk..............................sdPSIF.K.PETESVYLMK.LF.R.A...QRN.L..YIS..GFCLF.L.WF........VFKRLV.TLIADHARVTAAGE--as....................................................................
C5FUT5_ARTOC/1-141                     ..................................................MTLYF.TLVFV.LLV.TEMAI.FVGL.I........V.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELTGFdsa...........................nagHRHA.I.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEILRLEDKVK--my....................................................................
A0A1J7GIM7_LUPAN/1-126                 ..................................................MALQW.LIISY.VVA.IEAAI.VVLI.T........L.P.S...PK.LL........R....NRIV.S.............L..V..S.....LI..L......Q..P....A..-.--..-..-........-..............L..F.VIPF......A..GF.......QL..L................DLYW.K......NE.HRLICT---.................................SEVC.T.ATERDRYEKA.IY.K.A...QRN.V..ILC..VATIL.I.YW........CISRIC.KYQKDVQSLEE-----vekry.................................................................
K4AGL1_SETIT/1-126                     ..................................................MALQW.MILAC.VVA.VEAAV.AALV.T........L.P.A...PR.AV........R....GQIV.A.............L..T..S.....LL..L......-..-....Q..P.M-..-..-........-..............A..S.VIPF......A..AF.......QL..L................DIYW.K......KE.HRLMCT---.................................SEIC.T.AEERIRFEKS.MF.K.A...QRN.V..ILC..VSACL.L.YW........CIYRVV.KYNKDIKALEETE---krl...................................................................
A0A091TFD9_PHALP/1-40                  ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.-F.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTV.TLLTQLAKGMASHAA-l.....................................................................
A0A0C2WSW0_9HOMO/1-100                 ..................................................MAIYY.SLTFF.LLA.AEMVS.FVLL.L........M.P.M...PL.AA........R....KRFF.R.............F..L..T.....ES..Y......I..V....G..K.IA..Y..A........L..............K..I.SFIF......I..AI.......LF..V................DAVQ.R......ML.RVTAEAEAAkn.............................anSGVN.H.VSTEVNIAAR.KF.-.-...---.-..---..-----.-.--........------.----------------......................................................................
G1TPZ4_RABIT/1-137                     ..................................................MTIQW.VAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..S..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSAHAVE................................kGSTV.K.PGGFEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
W4H719_9STRA/1-132                     ..................................................MTIWA.AWAYV.LLP.PAVIL.LVLL.T........I.P.F...PK.AI........A....KGVV.R.............M..NdfF.....LN..F......E..V....A..G.VP..V..V........S..............L..V.TFFA......F..VA.......LA..G................QSYD.L......QK.RYNYQISGM.................................--EK.H.YEADLQHKAT.RW.R.S...ERN.W..WIS..ALTFT.I.YW........MLL---.----------------afqsmkkqllaasrrv......................................................
I1P403_ORYGL/1-127                     ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.GL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........-..............M..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCDD--.................................EHHC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.SLVVRLDQLQQRVDK-l.....................................................................
BAP29_HUMAN/1-137                      ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A0D2CY66_9EURO/1-143                 ..................................................MTLYY.SLVFV.LLV.LEMVL.FVAL.I........I.P.M...PF.TA........K....RKLF.N.............F..I..S.....ES..P......I..V....A..K.IQ..Y..A........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMSALtkdn.........................sgagRAAA.L.GSDRMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVK--my....................................................................
W1NF89_AMBTC/1-126                     ..................................................MGLQW.VILSY.VVA.AEAAV.ALFL.T........L.P.S...PS.II........K....SRIV.S.............L..V..S.....L-..-......-..-....-..I.LQ..P..A........L..............G..I.-VPF......A..GF.......QL..M................DIYW.K......Q-.--EHRLMCT.................................SETC.T.AAERDRYEKS.IY.K.A...QRN.A..ILC..LAACL.L.YW........FVHRIC.NYYKELQRLEEV----ekrr..................................................................
A0A1Y2GNI7_9FUNG/1-135                 ..................................................MSLPY.TMVFT.LLM.TEMVV.FIFL.I........L.P.L...PF.KW........R....RGLL.K.............F..L..A.....ES..P......F..M....G..S.VQ..Y..V........M..............K..I.VFIF......V..FI.......LF..I................DSLN.R......VI.KVEEIKENT.................................YPHH.G.HGAETNVAAR.RF.Y.A...QRN.M..YLT..GFTLF.L.SL........ILNRTF.FLILDLLKSEEKME--vi....................................................................
A0A0P7XI47_9TELE/22-157                ..................................................MTLQW.TAVAS.FLY.AEIVV.LLIL.C........L.P.F...IS.PH........R...wRKIF.N.............F..N..I.....WN..R......I..A....P..Y.WN..K..G........F..............L..T.MIII......L..IV.......LF..L................DAVR.E......VR.KYSGKESGT.................................GEKL.N.PNAFDHLHMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........IVRRVV.TLINQLAVA-------lgtgaal...............................................................
A0A1S3KSU5_SALSA/1-136                 ..................................................MTLQW.TVVAI.FLY.VEIAV.ILIL.C........L.P.F...IS.AK........R...wRSLF.N.............L..S..I.....WN..W......F..A....P..Y.WN..K..G........F..............F..T.MILI......L..II.......LF..C................DALR.E......VR.KYSNAEPMG.................................EAKL.N.PNLFDHLHMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VMRRVV.TLINQVAIA-------tvtgtsl...............................................................
A0A0G4PET7_PENCA/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMGV.FLAL.V........I.P.L...PH.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELSAFtkd..........................gpgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRV---rlf...................................................................
A0A0E0CXS3_9ORYZ/1-126                 ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.SV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..VSACL.L.YW........CIFRIC.KYNKDIKALEET----ekrl..................................................................
A0A093XQE1_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMAL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAte............................qsqTGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
U4LFH5_PYROM/1-141                     ..................................................MTLYY.SLVFA.ILM.LEMSI.FLLL.V........F.P.L...PF.TW........R....KKTF.E.............F..I..S.....HN..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVKRELAEAats...........................gpyAQPV.M.GGDRTEIQAR.KF.Y.S...ERN.L..YLC..GFTLF.L.SL........ILNRTH.SFILDILRLEQTVKE-l.....................................................................
W5PB89_SHEEP/21-156                    ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAVEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A177UC51_9BASI/1-138                 ..................................................MTLYY.SIVFM.LLV.LEMAM.FLVL.I........L.P.L...PF.TA........R....RKLF.H.............F..L..A.....TN..S......F..I....G..Q.IQ..Y..G........I..............K..I.TFIF......V..AV.......LF..V................DAVQ.R......MI.KVMNEAQLAk..............................qnKGAS.D.VRTETNMAAK.RF.Y.T...QRN.M..YLT..GFTLF.L.SL........ILSRTH.SLVVDLIKTQEEN---vsl...................................................................
A0A0D2UL16_CAPO3/1-137                 ..................................................MALEW.TFVYY.LLI.TEVVI.FALL.C........I.P.L...PI.RW........R....QAIL.S.............R..I..A.....NS..K......T..L....L..K.LW..P..L........A..............L..V.VVAI......L..SF.......LF..F................AALT.E......AR.ATHREHEEHk...............................rHNGY.H.HSGDMQTEIR.MF.R.A...QRN.M..YIT..GFALF.L.LV........VLNRFY.SLITELVRAD------vlasqa................................................................
A0A1L9URI9_9EURO/1-142                 ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........I.P.L...PF.TV........K....RKLF.A.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFgke..........................ggtmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEDRVR--ll....................................................................
C4XW17_CLAL4/1-139                     ..................................................MALYY.NLVFG.LLV.IEMTF.FGVL.S........L.P.F...PR.NI........R....RKVL.L.............T..A..S.....AP..F......R..S....E..Q.VQ..I..A........I..............R..C.IFGF......V..LV.......LF..I................DSVN.R......VY.SVSAELHASap.............................qnAVGA.V.VNDRSEIQSR.RF.Y.A...QRN.M..YLC..GFTLF.L.TL........ILTRTY.SLVTELVDTKDKLD--dy....................................................................
E7NGH9_YEASO/1-140                     ..................................................MSLYY.TLVFA.ILV.VEIFM.FSIL.A........L.P.I...PS.RY........R....RPLT.L.............L..L..L.....KP..F......K..S....S..T.VQ..V..A........I..............K..C.ILGF......I..LL.......LF..I................DCIN.R......VY.SIDKELQLSsa............................sqnNGAI.I.AQDRIEVLSR.KF.F.A...QRN.M..YLT..GITLF.L.TF........VVVRTF.GLVIELLTMKDIYR--as....................................................................
G3WQU3_SARHA/1-135                     ..................................................MTLQW.MAVAS.FFY.AEIMA.VLLL.C........S.P.F...IS.PQ........K...wEKIF.S.............S..R..L.....VH..W......L..V....T..Y.GQ..P..F........F..............G..I.LLLI......L..AL.......LF..L................EALW.E......IR.KFESMEKES.................................-LLK.C.PAVMEHHQMK.LF.R.A...QRN.L..HIT..GFALL.L.SL........LLPRLT.ALQKQQASLQDENER-l.....................................................................
H2U7F5_TAKRU/1-150                     ..................................................MSLQW.MAVAT.FLY.VEVFF.VLLL.C........I.P.F...IS.PK........R...wNKIF.K.............S..R..I.....IQ..T......V..A....L..Y.GN..T..S........F..............M..V.VIAI......L..IF.......LL..I................DAFR.E......VR.KYSVTEKVD.................................-LTN.N.PTAIEHIHMK.LF.R.A...QRN.Q..YIA..GFALL.L.CL........S-----.----------------ssssssssssrsssssssssssssssssssssrtfy..................................
W2TFV7_NECAM/1-138                     ..................................................MTLQW.SIIAF.VLY.VEIAV.TFIL.L........L.P.W...IR.PS........L...wSKLF.K.............S..R..L.....IT..S......L..S....A..H.AQ..I..Y........S..............Y..A.GAFV......L..FI.......LF..A................DAVR.E......VN.KYSHVEVALe...............................sSVRH.A.ADADAVIHMR.LF.R.A...QRN.F..YIS..GFALL.L.FL........VIKRIM.GLISRGAQLEAASEA-a.....................................................................
A0A0F8B7B9_CERFI/1-143                 ..................................................MTLYY.SLVFF.LLM.FEVGV.FFLL.I........V.P.M...PY.KM........K....KKLF.T.............F..I..S.....ES..P......L..I....S..K.IQ..Y..W........L..............K..I.TFVF......V..LI.......LF..A................DSVM.R......VY.RVQIELHAAtesa.........................tknmGAGI.M.GHERTEVQAR.KF.Y.A...QRN.M..YLC..GFTLL.L.SL........ILNRTY.SMILELIRMEEKVR--tf....................................................................
N4TFS4_FUSC1/1-143                     ..................................................MTLYY.TLVFM.LLV.FEMAL.FMLL.I........V.P.M...PF.NV........K....RKIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAseqs.........................kqggGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRA-y.....................................................................
A0A0W4ZGJ1_PNEJ7/59-155                ...........................................nirnlrl-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.AD..V..L........I..............K..I.TFIF......I..LV.......LF..F................DSVN.R......VF.RAADDAKPG................................aGGAL.R.DVYRSDIQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........IIDRVY.GLTLQVFKYEDMVNA-m.....................................................................
A0A182P8I2_9DIPT/1-135                 ..................................................MTLVW.SIIAS.FLY.VEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..I..Y........F..............Y..L.LLTV......L..VV.......FL..L................EAIR.E......MR.KYSSNDHTH.................................-TDT.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
A0A0N4VQP8_ENTVE/3-61                  .............................................ldsti-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................--RH.T.ADTETAIHMR.LF.R.A...QRN.L..YIS..GFALL.L.FL........VIKRLS.ALLMRVSQLQAAAAA-a.....................................................................
Q10PB0_ORYSJ/1-126                     ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..VSACL.L.YW........CIFRIC.KYNKDIKALEET----ekrl..................................................................
YET2_YEAST/1-137                       ..................................................MGVYL.AVLFS.LLV.IEMAI.LFIL.V........L.P.L...PQ.RM........R....RWLY.I.............R..Y..S.....II..S......T..N....K..K.FR..T..Y........M..............V..G.IMIF......V..GL.......LF..I................DSWK.R......SQiRVSTYRNQK................................nPYII.N.SVTPVDALAS.RA.Y.N...QRN.V..YIS..GFIIY.F.YI........CILTVM.SILRRIVEWNDKMKA-g.....................................................................
A0A158QJX3_HAEPC/289-426               ..................................................MTLQW.TIIAA.VLY.IEIAV.TFIL.L........L.P.W...IR.PS........I...wSKLF.K.............S..R..I.....LT..S......L..S....A..H.AQ..I..Y........S..............Y..A.GAFV......L..FI.......LF..A................DAVR.E......VN.KYSHVEIAMd...............................nSPRH.A.ADADAIVHMR.LF.R.A...QRN.F..YIS..GFALL.L.FL........VIKRIM.GLLSRSAQLEAASEA-a.....................................................................
A0A1D5NXR2_CHICK/1-135                 ..................................................MSLQW.TVVAT.FLY.AEVFL.VLLL.C........V.P.F...VS.PT........R...wQKIF.K.............S..R..L.....VG..L......A..V....A..Y.GN..T..A........F..............V..V.LIVI......L..VL.......LL..L................DAYR.E......TR.KYNASERAA.................................-LPT.T.PGALEHFHMR.LF.R.A...QRN.L..YLA..GFALL.L.SF........LLRRLV.TLISQQALLGASSQA-f.....................................................................
A0A182T4Z9_9DIPT/1-135                 ..................................................MTLVW.GIIAS.FLY.VEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHSH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
A0A1A9VQ95_GLOAU/1-134                 ..................................................MDLVL.TLIAG.FSY.AEIFV.VLLL.V........L.P.V...AS.PH........Q...wNRFF.K.............S..N..F.....LA..T......V..A....R..R.TY..L..C........F..............F..F.VMVA......L..VG.......FL..L................KAIR.E......MH.KYSNQEHST.................................D--V.R.LNTEMQRRAH.LF.K.A...QRN.F..GIS..GFPIF.L.AL........VIRRLV.TLISVQANLLAQSEA-t.....................................................................
G3N4Y7_GASAC/1-135                     ..................................................MSLQW.TAVAT.FLY.GEVFF.VLLL.C........I.P.F...IS.PK........R...wSKIF.K.............S..R..L.....IQ..T......I..A....I..Y.GN..T..S........F..............M..V.AIAI......L..VF.......LL..I................DAVR.E......VR.KYSVTEKVD.................................-LTN.N.PTAIEHIHMK.LF.R.A...QRN.E..YIA..GFALL.L.CL........LLRRIA.TLLSQQATLMASNEA-f.....................................................................
A0A1E4T9C2_9ASCO/327-473               ..................................................MSLQM.NLIFG.ALI.FEMAL.MSIL.V........M.P.L...PH.KL........Q....EMYV.N.............L..V..Y.....KL..Y......Q..N....Q..N.IR..I..G........L..............G..F.SGCI......I..FM.......MF..I................DAFK.A.....aVP.RIPKEFLQGngngn......................gpmgglQPPP.Q.FGSVWEMRVK.KF.Y.A...QRN.M..YIT..GAVMF.L.AI........AILFNI.KLLTSMVKNKKKL---iel...................................................................
A0A165Q614_EXIGL/1-139                 ..................................................MTIYY.TLTFF.LLA.AEMGT.FCII.L........A.P.L...PF.MM........R....KRML.T.............F..L..S.....TN..F......V..V....A..K.IA..Y..G........L..............K..I.SFIF......I..AI.......LF..I................DAIQ.R......MW.RIVAEGEASkk.............................dgSPVH.D.VRTETNLAAR.KF.Y.A...QRN.T..YLT..GFCLF.L.SL........LLTRTF.YILLDHLHTQEEYAK-l.....................................................................
A0A0G2I4H2_9PEZI/1-142                 ..................................................MTLYY.TLVFM.LLM.AEMAL.FMFL.I........I.P.M...PF.SL........K....RRVF.T.............F..I..S.....EN..P......I..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELSSVteg..........................gnnaRQAI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEEKLKQ-y.....................................................................
N4V1B3_COLOR/55-163                    ..............................................aars-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............F..I..S.....ES..P......I..V....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELALAtek...........................qnsGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVR--gy....................................................................
A0A084VKW3_ANOSI/1-135                 ..................................................MTLVW.GIIAS.FLY.VEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHTH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAMLLAQAEA-s.....................................................................
A0A168KYG5_MUCCL/1-136                 ..................................................MAIYY.ALTFG.ILV.TEMII.FGLL.V........L.P.L...PS.RW........R....HAML.K.............F..A..S.....TS..P......M..M....A..K.AM..Y..A........L..............K..I.VFGF......I..FV.......LF..I................DTIS.R......LN.RIESEVEGE................................kSHHH.D.YGYETSIKAK.RF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.ALVLELLQREEELKK-a.....................................................................
A0A1G4IM73_9SACH/1-135                 ..................................................MTLYY.TLIFG.VLV.AEMTM.FILL.M........L.P.V...PS.KY........R....RPVT.L.............A..L..V.....KP..F......E..Q....P..Q.IQ..V..A........V..............K..C.VLVF......I..LL.......LF..V................DTIN.R......VY.KIESELNVN.................................PVAA.S.GSDRAEVLSR.KF.Y.A...QRN.M..YLT..GITLF.L.TF........TVFRTF.HLVSELLTSKEVYR--ad....................................................................
I1KJ86_SOYBN/1-126                     ..................................................MALQW.LILTY.VVA.AEAAV.AILL.T........L.P.T...PK.LL........R....DRFA.S.............L..V..S.....L-..-......-..-....-..I.LQ..P..A........L..............-..F.IVPF......A..GF.......QL..L................DIYW.K......NE.HRLMCTS--.................................-EVC.T.AAERDRYEKS.IY.K.A...QRN.V..ILC..VTACL.L.YW........SISRIC.KYQKEIQSLEE-----gekri.................................................................
G0W5V4_NAUDC/1-134                     ..................................................MSIYL.LIIFF.SLI.MEMTI.LFIL.V........L.P.L...PF.SI........R....RLFF.S.............L..F..E.....RA..T......K..S....M..Q.VR..T..I........S..............S..I.FGLL......V..SF.......LF..Y................DSRK.R......SM.VHVLTYQDD.................................-VSG.Q.NVTPIHALAS.RA.Y.H...QRN.M..YLS..GFILY.F.GV........CIATVM.TILGKLVKVHDDM---hmr...................................................................
R1DU44_EMIHU/1-119                     ..............................................mdpg----W.FVLCL.ALL.LECAL.VGLL.I........L.P.I...RG.LL........N....EWVV.S.............L..L..S.....N-..Q......G..V....K..Y.AG..F..A........I..............L..L.LDAY......Y..FA.......GT..M................DALS.N.....pLV.HVGIVASPI.................................---D.D.VILSCEVGLE.KF.R.N...ERN.A..YIT..GFSLF.M.FL........VLRRLT.----------------ssr...................................................................
A0A0P9EXZ3_RHOGW/1-135                 ..............................................ynli-----.--SFA.ILT.LELMT.FLVV.I........F.P.L...PF.AW........R....RAMF.K.............A..I..A.....ES..H......I..I....A..R.LQ..Y..G........L..............K..I.TFIF......I..AI.......LF..A................DAVN.Q......ML.KIHREREAPa..............................gvAATP.D.MRAQADYRSR.KF.L.S...ERN.F..YLH..GSCLV.L.SL........ILSRTY.SLVLDLIRAQEELA--vl....................................................................
G4VML3_SCHMA/1-137                     .................................................m---LW.HIVVA.FLY.SEMFV.VLLM.I........L.P.F...FS.SQ........T...wSKFF.K.............F..S..I.....IQ..K......I..S....E..K.SS..F..Y........F..............R..L.FLVM......L..VC.......VL..A................EALR.N......VW.VLRQAYNSIk..............................dhPHEM.R.PETESLYLMR.MF.R.A...QRN.F..YIT..GFSLF.V.WF........VLHRLV.SLLSEHAKMSASEEA-s.....................................................................
J4GWB6_9APHY/1-139                     ..................................................MTIYY.SLTFM.LLI.SEMVT.FCVI.V........A.P.L...PH.AV........R....KRFF.R.............F..L..S.....ES..P......L..V....A..K.LA..Y..G........V..............K..I.AFIF......V..AI.......LF..V................DAFQ.R......ML.RVTAEADVAkg.............................ggAGMQ.D.VRTETNFASR.KF.Y.S...QRN.T..YLT..GFCLF.L.SL........VLTRTF.YILLDLVHTQEEYAK-l.....................................................................
A0A1B0BRT6_9MUSC/1-134                 ..................................................MDLVW.TLLTG.FLY.AEICV.VLLL.V........L.P.V...AS.PH........K...wNRFF.K.............S..T..F.....LA..I......I..T....R..R.FY..L..Y........F..............F..L.IMGV......L..VL.......FL..F................EAIR.E......MR.IYSNWEHWS.................................D--A.L.LSTKMQHSMR.FF.R.A...QRN.I..YIS..GFLIL.L.VL........VIRRLV.TLISVQAQSEASLKQ-a.....................................................................
G1KQS7_ANOCA/10-147                    ..................................................MTFQW.TAVAA.FLY.AEIAI.LLIL.C........L.P.I...IS.PV........R...wQKVF.T.............I..R..I.....WS..K......L..A....N..Y.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSSLQSSDk...............................tTHTS.S.PNAFDHIQMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........VLRRTV.SLITMLAKEMK-----vqmnl.................................................................
A0A1W0E2B9_9MICR/1-79                  ..................................................MEVQT.TVIHV.VLG.INLLM.NVIL.L........F.P.W...FD.NV........K....RWFI.Q.............F..Y..A.....YN..M......V..F....K..T.IR..H..I........F..............N..I.FYVM......I..GV.......LL..V................DSAY.K......MN.ITE------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------sklley................................................................
J9NUF1_CANLF/1-137                     ..................................................MTLQW.VAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSIPAIE................................kGLTT.R.PGAYEHAQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A166FZ29_9HOMO/1-138                 ..................................................MTIYY.TLTFM.LLA.SEMAT.FVVF.I........A.P.L...PF.AV........R....KRFF.N.............F..L..A.....TS..P......I..V....A..K.LA..Y..G........L..............K..I.SFIF......I..AI.......LF..V................DALQ.R......MF.RVATEVEAAk..............................vgSGMQ.D.VRTETNIAAR.KF.Y.A...QRN.V..YLT..GFCLF.L.SV........VLTRTF.YIIQDLIHTQDEYAK-l.....................................................................
A0A2I0MH75_COLLI/1-99                  ..................................................MTFQW.TAAAT.FLY.GEIGV.LLVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..I................DAVR.E......VK.KYSAIHVME................................kAVNV.N.ANAFDHIQMN.--.-.-...---.-..---..-----.-.--........------.----------------vlr...................................................................
E2LYY4_MONPE/1-108                     ..................................................-----.-----.---.--MTT.FCVL.V........A.P.L...PY.KV........R....RSLF.R.............F..L..S.....ES..E......L..V....G..K.VA..Y..A........L..............K..T.SFII......-..--.......--..-................---S.E......MA.RSGAGGAGV.................................---G.D.VRTETNLAAR.KF.Y.A...QRN.T..YLT..GFTLF.L.SL........VLTRTF.YITLDLIHVQEEYAK-i.....................................................................
A0A026W1Q0_OOCBI/1-136                 ..................................................MSLQW.TLIAS.FLY.VEVAL.VLLL.V........L.P.V...AS.PT........R...wQKLF.R.............S..R..F.....LQ..S......I..S....N..Q.AS..I..Y........F..............V..V.LLGV......L..VL.......FL..L................DAIR.E......MR.KYSGPADHS.................................EHHH.Q.LNLELQENMR.LF.R.A...QRN.F..YIS..GFALF.L.SL........VIRRLV.LLISTQATLLAQNEA-a.....................................................................
A0A1U8C1H5_MESAU/1-136                 ..................................................MTIQW.VAVAS.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..S..I.....WA..K......I..A....S..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSCTQVTE................................kSSAD.R.PSAYEHMQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKE-------isnkgv................................................................
A0A229XP41_9EURO/1-142                 ..................................................MTLYY.SLVFC.LLI.FEMAV.FMGL.I........I.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFtve..........................gnamGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDRVKH-l.....................................................................
A0A0K9QC27_SPIOL/1-127                 ..................................................MGLQW.MILTY.AVA.AEAAI.FLLI.S........L.P.S...PK.V-........-....---L.K.............T..R..L.....VS..L......I..S....L..I.LQ..P..L........-..............M..F.IVPF......A..AF.......QL..L................DIY-.-......-W.KYEHRLTCT.................................SEIC.T.ATERDRYEKS.IY.K.S...QRN.V..LLC..SAACL.L.YW........CIYRVC.KYNKDIENLEE-----vekryk................................................................
A0A0E0FU53_ORYNI/1-127                 ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.GL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........-..............M..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCDD--.................................EHHC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.SLVVRLDQLQQRVDK-l.....................................................................
I3MB38_ICTTR/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
J9HYA2_AEDAE/1-140                     ..................................................MSLVW.SLIAS.FLY.VEIFI.VLML.V........L.P.V...AS.PQ........R...wQRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLFV......L..VL.......FL..L................EAIR.E......MR.KYSHVGELPta.............................dpAAEQ.H.LNVGMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLI.SLITSQAQLLAQSEA-s.....................................................................
A0A0V0QUW2_PSEPJ/146-281               .............................................yilqq-----.--ILT.FIF.AEALL.FLLM.T........L.P.F...LD.KL........S....HKCV.K.............F..F..I.....KA..R......S..L....E..V.LR..I..A........Y..............R..L.IAFS......I..LI.......AF..F................YSIY.A......GL.TYKEQTKTIk..............................qrDFGA.N.TTDNDANAIK.MF.R.A...QRD.I..YIY..GIFVF.L.YY........ANLSMT.KLIIKVQDIQTKIS--ka....................................................................
A2GB04_TRIVA/1-131                     ...................mnifwvlslflstvggvlmllyalplknswi-----.-----.---.-----.----.-........-.-.-...--.--........-....TK--.-.............-..-..-.....LS..K......L..L....Y..R.FR..A..F........L..............F..C.SAGI......Y..VF.......LI..I................QEFS.S......MK.HESMHKKDM.................................--EG.N.GAEFSRRSAN.LF.R.N...QRN.L..YIVliGLSIQ.L.GL........L-----.----------------ifiwqshsmakryknlvrqires...............................................
A0A0E0BSC5_9ORYZ/1-104                 ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..V----.-.--........------.----------------sacllyw...............................................................
Q6C4K4_YARLI/1-137                     ..................................................MTLYY.TLVFA.ILV.TEMAT.FLLL.V........A.P.L...PE.KI........R....RQFF.L.............S..L..A.....KL..E......V..L....D..K.LR..L..G........L..............K..F.TFVF......I..LI.......LF..I................DSVN.R......VY.RVSVDRSTGe...............................yKGNL.V.ATERSELQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.SLVIELINARDLI---nel...................................................................
A0A0F8UF97_9EURO/1-157                 ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........V.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........L..............R..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEVAALskdgalgyvlc...........sharytlivssRAAA.L.GADRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEDRVK--ll....................................................................
E1Z663_CHLVA/1-137                     ..................................................MATIW.SIIAFwILP.IPLVL.FTLL.T........L.P.L...PR.NM........Rr..gLLIF.T.............Q..R..V.....FD..V......P..V....V..G.AF..K..L........L..............H..V.MLWL......T..AV.......AF..L................GSAR.Q......AH.MIKTAGQEA.................................-VWT.T.PNMEISHLSK.RW.R.S...ERN.L..WMT..AFAFC.A.WV........FLAALY.REASRRLDLEARLS--em....................................................................
A0A0L6UBF0_9BASI/1-146                 ..................................................-----.-MVFS.LLI.IEIVT.FVIL.VgslsiflqM.P.L...PF.TW........R....RVLF.R.............F..L..A.....TS..P......L..V....A..K.LQ..Y..A........L..............S..F.FFFF......F..FF.......LD..V................MMIG.S......MK.TYSYRFSGPgeaa........................reqgaGVGR.D.LRSETDWRSR.KF.L.S...ERD.M..YMR..GFTLF.L.SL........ILSRTF.ALILDLIKAQEDLA--tl....................................................................
A0A0R3WN21_HYDTA/28-81                 ...............................................ssk-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................-MQV.R.EQNRSVYLMK.LF.R.A...QRN.L..YIS..GFCLF.L.WF........GSDLLL.V---------------fhkhlinflmd...........................................................
W1QHX5_OGAPD/1-141                     ..................................................MPLHY.NLVFA.LLI.FEVAL.FALI.S........L.P.L...PS.KF........R....KPLL.K.............T..L..S.....GP..F......H..S....Q..H.FQ..I..T........T..............K..C.VLGF......V..LV.......LF..L................DALN.R......MK.TVTNELQSQqds...........................piaGAVG.I.HESRSEIQAK.RF.Y.A...QRN.V..YLC..GFTLF.Q.TL........IVNRTF.SLVFELLAVKEKLAE-s.....................................................................
A0A0E0NS85_ORYRU/1-110                 ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..VSACL.L.--........------.----------------ywwilcys..............................................................
A0A1S3D9Q3_DIACI/1-136                 ..................................................MSLQW.TLIAT.VLY.FEMAF.MLLL.I........L.P.I...LS.TQ........R...lHKIL.K.............S..K..F.....VQ..G......V..K....T..Q.AG..W..Y........F..............G..C.ILVI......L..SL.......FF..L................DAIR.E......MR.KYASPEVKE.................................EAHG.H.LDAEMQNNMK.LF.R.A...QRN.F..YIS..GFSLF.L.WL........VIRQII.QLIAQQANLLAQNEA-s.....................................................................
A0A178AJ93_9PLEO/1-141                 ..................................................MTLYY.SLVFA.LLV.TEMLI.FLAL.I........V.P.L...PF.TW........R....RGLF.K.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELSGMgnq...........................qggGAAL.G.GIERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEEVK--im....................................................................
C4V808_NOSCE/76-118                    ..............................................dvvy-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.H.T...ERN.V..YLT..GFTLY.L.SL........ILKIFV.NMLNTLYKEEEAVN--vl....................................................................
A0A117NRG2_9EURO/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMCV.FLAL.V........I.P.L...PH.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELSSFtkd..........................gpgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRV---rlf...................................................................
A0A1S3JN94_LINUN/1-137                 ..................................................MGMIW.TFVAT.GLY.CEILV.AIIL.M........L.P.W...IP.CE........R...wQKLF.K.............S..R..F.....LM..I......I..T....S..Y.AN..Y..Y........F..............T..V.FIVI......L..MV.......VF..G................DAIR.E......VY.KYSGEEKML................................dPKTT.H.HDTLEHIQLR.LF.R.S...QRN.L..YIA..GFALF.L.WL........VLKRLV.VLISAAATLTAQR---dva...................................................................
A0A1I8CGJ9_9BILA/1-146                 ..................................................MSFQW.IIIAA.VLY.IEIGV.GILL.V........L.P.W...IK.PA........F...wRTVF.N.............T..R..I.....IR..D......V..L....K..H.GR..T..I........F..............Y..S.TFVV......L..VL.......LF..A................DAAR.E......CI.KYSNLDEGLlaaqa.......................mpevnTLKA.N.IDMDSVVHMR.LF.R.A...QRN.F..YVS..GFALV.M.FI........LNRRIL.TLILNAQLDQ------neqtat................................................................
A0A2H3JLU4_WOLCO/1-139                 ..................................................MTIYY.TLTFM.LLV.AEMAT.FCVI.V........A.P.L...PH.AA........R....KRLL.R.............F..L..S.....ES..P......I..V....A..K.VA..Y..G........I..............K..I.AFIF......V..GI.......LF..L................DAFQ.R......ML.RVTAEADLAkn.............................sgSGMQ.D.VRSETNFAAR.KF.Y.S...QRN.T..YLT..GFCLF.L.SL........VLTRTF.YILLDLIHTQEEYAK-l.....................................................................
A0A151S0D5_CAJCA/1-124                 ................................................ml-----.----Q.LLY.TAIFA.EMLL.I........L.T.L...VF.KT........P...lRKLV.I.............V..S..L.....DR..V......K..R....G..R.GP..V..V........V..............S..T.VGAT......L..VV.......VL..A................SSLY.S......MA.KIQQRTLEA.................................G---.I.VNPTDQVLMS.KH.M.L...E--.A..SLM..GFVLF.L.SL........MIDRLH.HYIRELRLLRKTMEA-i.....................................................................
A0A180H1F0_PUCT1/1-140                 ..................................................MALYN.WMVFS.LLI.VEIVT.FIIL.V........M.P.L...PF.TW........R....RVLF.R.............F..L..A.....TS..P......L..V....A..K.LQ..Y..A........L..............K..I.LFIF......V..TV.......LF..V................DSVQ.R......MM.KIHHEGEAAke............................qgaGVGR.D.LRSETDWRSR.KF.L.S...ERD.M..YMR..GFTLF.L.SL........ILSRTF.ALILDLIKAQEDLA--tl....................................................................
C4QZG4_KOMPG/1-141                     ..................................................MSLFL.NLVCG.LMF.FEMGL.FSAM.T........I.P.F...PP.KI........R....KPIL.N.............I..V..S.....LP..F......K..S....I..H.FQ..V..A........Y..............K..C.ILGF......I..LI.......LF..I................DSVN.K......VI.KVSSDLTSFdsa...........................assALGN.N.SVDRTDILLR.RF.Y.A...QRN.M..YIC..GFTLF.L.TL........ILSRTY.ALVDEVMVLKEQR---ysk...................................................................
A0A1X7RDS8_ZYMTR/1-141                 ..................................................MTLYY.SLVFG.LLV.FEMVV.FVSL.I........V.P.M...PF.AV........K....RKLF.T.............F..I..S.....EN..P......L..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAQAkhq...........................ggaAGGV.A.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDTLRLEAEVKK-l.....................................................................
A0A1D2N0I5_ORCCI/1-134                 ..............................................mgyw----W.YGTSW.FVH.FQVIV.VLLI.L........S.P.F...AR.PK........F...wANIL.G.............C..R..I.....IG..F......I..N....D..K.LW..N..I........Y..............L..M.IGTP......S..LL.......VF..L................DSIR.E......LH.KHSTIDYDL.................................--YG.D.PITRKDARIA.ML.Q.A...QRN.Y..YIS..GAAVI.L.CM........IVPRLL.SILRENGD--------lsirsdat..............................................................
A0A2K5J3Q5_COLAP/67-202                ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A0V0UX63_9BILA/73-191                ..............................laasvsksfftfysdvfivi-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..H.....LL..F......C..V....N..V.AS..T..V........F..............G..L.LFTR......LneMM.......IL..L................DALR.E......VR.KYSDADLVK.................................QSVG.N.VQGEFNTHMR.LF.R.A...QRN.L..YIS..GAALF.L.WF........AIQRVA.SMISREAMLIASAEA-a.....................................................................
K1X0K2_MARBU/1-139                     ..................................................MTLYY.SLVFL.LLV.AEMVL.FVLL.I........V.P.L...PF.TI........R....RKMF.T.............F..I..S.....ES..P......V..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.KVQMELTEAnk.............................taGQTV.M.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEEKIKK-y.....................................................................
A0A250WSW4_9CHLO/1-134                 ...............................................msa----W.KLVVH.FMLpPPLIL.TILL.V........I.P.V...PR.LI........N....KALL.Q.............F..A..K.....KI..L......F..C....N..V.LN..G..Ik......lV..............H..L.MLLI......T..GM.......LL..I................GSGV.H......TH.QLRIRMDP-.................................--DV.S.GHKRTEALAR.IW.R.E...ERN.F..WIS..VLTFL.L.WG........LLYRFY.NLMMEHLSLKDKIAA-l.....................................................................
A0A0C9LVF2_9FUNG/324-461               ..................................................MTIYY.TTVFF.ILV.LEMLS.FGIL.V........F.P.F...PS.RW........R....RAML.K.............F..V..S.....GS..P......T..V....A..K.AV..R..I........L..............K..I.VFGF......I..FV.......LF..I................DAVN.R......LQ.RIDQDEQPEd..............................asRPYH.D.YNYEASQKAR.KF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.TLVIAMLKHEEELEH-a.....................................................................
A0A0N5DVF1_TRIMR/1-137                 ..................................................MTLQW.TVVAV.FLY.IEAFL.LAFL.L........L.P.W...IR.PP........M...wQKIF.R.............S..R..I.....MR..S......L..Q....S..Y.SY..I..G........S..............Y..T.YGGV......L..VL.......LF..L................DGVR.E......VR.KYSEADKSM................................dNHFH.T.AQADAIIHMR.LF.R.A...QRN.L..YIS..GFALF.L.WF........VIRRVI.DLIGREAMLMASAEA-a.....................................................................
E1C310_CHICK/1-137                     ..................................................MTVQW.TAVAA.FLY.GEVGV.LLVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..II.......LF..L................DAVR.E......VK.KYSAIQLNE................................kVANV.N.ANAIDHIQMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRTV.TLLTQLAKGMASHA--al....................................................................
BAP31_HUMAN/1-136                      ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......L..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A0D7A259_9AGAR/1-134                 ..................................................----Y.SLTFL.LLA.SEMVT.FCVL.V........A.P.L...PH.TL........R....KKML.H.............F..L..S.....ES..K......Y..V....A..K.IA..Y..A........L..............K..I.SFIF......V..AI.......LF..V................DALQ.R......MF.RVQAEFDLAk..............................asGTAG.E.PRTESSLAAR.RF.Y.A...QRN.T..YLT..GFCLF.L.SL........VLTRTF.YMMSELIHVQDEYAK-l.....................................................................
S8BYT6_DACHA/1-144                     ..................................................MTLYY.SLVFA.LLM.FEMGI.FLVL.I........L.P.L...PL.TW........R....RQMF.T.............F..I..S.....TN..P......L..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQRELSDAaqaat.......................gnrggAAAI.L.GHERTEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VLILDILRLEEEVK--l.....................................................................
B4HVK3_DROSE/1-134                     ..................................................MSLVW.TLIAG.FLY.AEIAL.VLLL.V........L.P.V...LT.PY........R...wNRFF.K.............S..K..F.....LS..M......L..G....Q..Q.AH..I..Y........F..............L..L.IMGI......L..VI.......FL..L................EAIR.E......MR.KYSGLQQSN.................................--EV.H.LNVEMQHSMK.LF.R.A...QRN.F..YIS..GFAIF.L.AL........VIRRLV.NLICTQANLLAQSEA-s.....................................................................
A0A099NVD5_PICKU/1-119                 ..................................................-----.-----.---.--MAL.FALI.S........F.P.L...PS.KF........R....RPLL.Q.............T..L..S.....TP..F......N..S....P..Q.VQ..M..V........L..............R..C.VFVF......I..GI.......MF..A................DSVN.R......TM.KVGNELAGD.................................-LVT.G.GVTRAEIQSR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.KMVFALLAMKEKESK-l.....................................................................
A0A2H0ZKT6_CANAR/1-131                 ..................................................----M.SIVFG.ILV.FEMSY.LLLL.M........V.P.L...PF.AI........R....QKLV.N.............G..S..V.....KL..N......Q..S....R..N.FK..S..A........W..............A..F.TTFV......L..GL.......QF..V................DCLQ.K......LQ.KYSNSESFA.................................SASQ.F.GGARYDQLAS.KF.Y.S...QRN.L..YIT..GAVLY.L.EV........SIVTVV.TILKKLVLKEESYRA-a.....................................................................
A0A177AVH4_9METZ/1-139                 ..................................................MALQW.TLVLY.FLY.LEVAI.TLIL.L........L.P.I...ST.GK........T....RRIM.R.............L..F..A.....PF..K......S..F....Y..V.FR..L..A........L..............T..V.IMAI......M..IV.......LL..Y................DAYR.G......IT.KYSLMISIEnpm...........................sniHANL.N.AAAANNIYIQ.LF.R.A...QRN.M..YLS..FISIL.L.AL........IIWRLT.ALIETHASLV------tdhl..................................................................
A0A093E9P2_TAUER/1-137                 ..................................................MTFQW.TAVAA.FLY.GEIGV.ILVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..II.......LF..L................DAVR.E......VR.KYSAVHVNE................................kAVNI.N.TNAFDHIQMK.LF.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTV.TLLTQLAKGMASHA--al....................................................................
A0A0F4GZP8_9PEZI/1-141                 ..................................................MTLYY.SLVFG.LLV.FEMVV.FVSL.I........V.P.M...PF.AV........K....RKLF.T.............F..I..S.....EN..P......L..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAQAkhq...........................ggaAGSV.A.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDTLRLEAEVKK-l.....................................................................
A0A1D6AQ61_WHEAT/1-127                 ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.AL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........M..............S..-.VVPF......C..LF.......LL..M................DIYW.K......YE.MRPTSXD--.................................EHAC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.SLVVKLDHLQQRVDK-l.....................................................................
A9P9M2_POPTR/1-126                     ..................................................MALQW.MILTY.LVA.AEAVI.AVLL.T........L.P.S...P-.--........-....-KLL.K.............Y..R..L.....VS..L......I..S....L..V.LQ..P..A........L..............F..-.VVPF......A..GF.......QL..L................DIYW.K......ME.HRLMCTGET.................................---C.T.AAERDRYEKS.IY.K.A...QRN.V..ILC..ISACL.L.YW........CVYRVC.KFYKEIQSLEEV----ekry..................................................................
K4BJL4_SOLLC/1-126                     ..................................................MALQW.MILTY.VVA.AEAAI.AILL.T........L.P.S...PK.AI........K....SRFV.S.............L..I..S.....LT..L......Q..P....S..-.--..-..-........-..............L..F.IIPF......A..GF.......QL..L................DIYW.K......NE.HRL---MCT.................................GEIC.T.AAERDRYEKS.IY.K.A...QRN.A..ILC..VAACL.L.YW........CIYRVC.KYYKEIQSVEE-----vekrl.................................................................
A0A182YA26_ANOST/1-135                 ..................................................MTLVW.GIIAS.FLY.VEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHSH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
A0A068RFM2_9FUNG/1-137                 ..................................................MTIYY.TLTFG.ILV.LEMVI.FCIL.V........L.P.L...PS.HW........R....RAML.K.............F..A..S.....TS..P......A..V....A..K.AI..H..G........L..............K..I.IFAF......I..FM.......LF..I................DAIN.R......LQ.RIDSSEADSd...............................rSMHH.D.YSYEANNKAK.KF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.TLLIQVLKREEELD--dl....................................................................
G2WT66_VERDV/1-141                     ..................................................MTLYY.TLVFV.LLM.LEMTL.FMLL.I........I.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELAMAtek...........................qnnGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDRVKS-y.....................................................................
A0A1W4VSC8_DROFC/1-134                 ..................................................MSLVW.TLIAG.FLY.AEIAL.VLLL.V........L.P.V...AS.PY........R...wNRLF.K.............S..K..F.....LA..M......L..A....Q..Q.AH..I..Y........F..............F..L.IMGV......L..VL.......FL..L................EAIR.E......MR.KYSNYEQTG.................................E--V.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRRLV.TLVSAQANLLAQSEA-s.....................................................................
U1HSH2_ENDPU/1-127                     ..................................................-----.-----.---.--MVV.FVGL.I........I.P.L...PY.KL........K....KGLF.T.............F..I..S.....ES..P......L..V....A..K.IQ..Y..A........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELAAYskd..........................gsgaGAAA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNQTY.VMILNVLRLEEKLK--my....................................................................
G8Y9N0_PICSO/1-139                     ..................................................MALYY.NLVFG.LLV.IEVGF.FTVL.S........L.P.F...PR.QV........R....RKVL.S.............T..A..S.....AP..F......R..N....E..Q.FQ..I..A........I..............K..C.ILGF......V..LV.......LF..I................DSVN.R......LV.AVTRELQSKps.............................esKVTG.I.INDRAEVQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.TL........ILMRTY.SLVGELILTKDKLDN-a.....................................................................
A0A0C2XVX9_HEBCY/1-140                 ..................................................MTIYY.SLTFM.LLA.AEMVT.FCIL.V........A.P.L...PY.SI........K....KRLF.H.............F..L..S.....ES..K......I..V....A..K.VA..Y..G........L..............K..I.SFIF......I..GI.......LF..V................DAVQ.R......MF.RVTAEADLAkn............................nkqGVVQ.D.IRTDTGLAAR.KF.Y.A...QRN.T..YLT..GFCLF.L.SL........VLARTF.YIILELIRTQEEYAK-l.....................................................................
A0A0R3QT98_9BILA/339-475               ..................................................MTLQW.FVVAL.ILY.LEIAV.VLLL.L........L.P.W...IR.PT........L...wSKFF.K.............S..R..V.....VN..T......F..E....K..H.AT..V..Y........F..............I..S.ALCI......L..LL.......LF..A................DAIR.E......VR.KYANEVAIE................................gSIRH.T.ADSENVVHMR.LF.R.A...QRN.L..YIS..GFALL.L.FL........IIKRLV.ALLSRGALLEAAAEA-a.....................................................................
F2UBF9_SALR5/1-131                     .................................................m---LW.RLIEF.LLL.AEVAT.VILL.C........I.P.L...PM.-W........R....KLVL.K.............-..C..L.....PL..F......R..N....P..N.LR..K..A........I..............M..A.TQFL......C..GV.......LF..L................DALI.G......VY.RPKHQYFPD.................................RRQA.A.VHDEHHHMVR.KF.R.A...ERN.I..HIS..GFCLL.L.LF........LINRLM.AFILELEETHKKL---nik...................................................................
F0ZYQ2_DICPU/1-112                     ..................................................-----.-----.---.-----.----.M........L.P.I...SM.QK........R....KSIY.E.............K..I..K.....PL..I......N..G....P..N.TR..I..V........L..............R..V.VALL......L..LI.......VF..V................DSIV.N......SY.NINKKLHSP.................................E-FA.S.KIDRQNEYTR.MF.R.Y...QRN.I..YIS..GFSLF.L.YF........LIFRSQ.SIVADLSKMEVNQD--ai....................................................................
A0A166C726_9HOMO/1-124                 ..................................................-----.-----.---.--MVT.FCLV.V........A.P.L...PY.KI........R....KRLF.H.............F..L..S.....ES..P......I..V....G..K.VA..Y..A........L..............K..I.SFIF......V..AI.......LF..I................DALQ.R......MF.RITAEAEMSks.............................ggQAVQ.N.VQTETNIAAR.KF.Y.A...QRN.T..YLT..GFCLF.L.SL........ILTRTF.YIILDLIHTQEEYAK-l.....................................................................
A0A0P1BLA1_9BASI/27-162                .................................................q--IHY.SLCFG.LLV.SEMIV.FLLL.I........L.P.F...PF.KI........R....RAIF.R.............F..F..A.....TN..A......I..V....G..K.VL..Y..G........V..............K..I.SIIF......V..SI.......LF..V................DACQ.R......LL.KTMAERQQAk...............................eQLGV.R.DTAHHDMLLR.LA.F.A...QRN.C..YLC..GFCLF.C.SL........ILARTY.ALITELIQAQEAA---gkt...................................................................
A0A2I4BXV0_9TELE/1-126                 ..................................................MTLQW.TTVAV.FLY.SEIAV.NLIL.W........-.-.-...--.--........-....RLVF.N.............W..R..I.....WS..W......L..S....L..Y.WN..K..C........F..............F..A.IIMV......L..IV.......LF..L................DAIR.E......VQ.KYSDADMQD.................................-ANA.N.PNLYDHVHMK.LF.R.A...QRN.L..YIC..GFSLF.L.WL........VMRRVV.TLLSQVAATLEDS---agl...................................................................
R9AUW8_WALI9/1-138                     ..................................................MTLYY.SLVFG.LLS.AEVLT.FLVL.V........A.P.M...PF.AF........K....QRFF.K.............F..L..S.....TN..P......L..V....A..K.LQ..Y..S........L..............K..I.SLIF......T..SI.......LF..F................DAVQ.R......ML.KVVKEGQAAk..............................eeHSFN.D.VRSESNFAAR.KF.Y.S...QRN.V..YLT..GFTLF.L.SL........ILSRVF.GIIMDLIKAEEEL---slm...................................................................
A0A0R3TNB8_HYMNN/1-139                 ..................................................MSLMW.VLVAS.GLY.AEIAI.ITIL.L........L.P.F...IS.SR........V...wNRLF.K.............S..N..F.....VA..W......F..S....S..Y.AS..F..Y........F..............R..A.CVVA......L..GL.......TV..F................EAWR.Q......VR.DKSEMYHEYk..............................sdPSNF.K.AGTEALYLMK.LF.R.A...QRN.L..YIS..GFALF.L.WF........VFNRLV.RLIADHARVTAAGE--as....................................................................
A0A164YZD4_9CRUS/1-139                 ..................................................MSFQW.GLIAT.FLY.VEIAV.VFLL.L........L.P.F...IS.AQ........R...wNKLF.K.............S..S..F.....LR..G......L..G....Q..Q.VH..I..Y........F..............Y..V.ILAF......L..VL.......CL..F................DAIR.E......MR.KYDVGHDGKa..............................keQQHQ.H.LEQELRNSMV.LF.R.A...QRN.F..YIT..GFSLF.L.IF........VIRRLM.TLLAAQATLAASSEA-a.....................................................................
A0A158NXT1_ATTCE/1-135                 ..................................................MSLQW.TLIAG.FLY.IEVAI.VLLL.V........L.P.V...AS.PT........R...wQKFF.K.............S..R..F.....LQ..S......L..N....N..Q.AS..I..Y........F..............V..V.LLGV......L..VL.......FL..L................DAIR.E......MR.KYSTSLDHT.................................D-HH.Q.LNVEMQENMR.LF.R.A...QRN.F..YIS..GFALF.L.SL........VIRRLV.ILISTQASLLAQNEA-a.....................................................................
B7XJ91_ENTBH/1-75                      ..................................................MEVQI.TIIYI.VIM.INLLF.NIIL.L........F.P.F...FD.SL........K....KWFL.A.............F..Y..T.....KS..L......F..M....K..G.LS..Y..M........L..............N..I.LYVM......I..II.......LF..L................DSMY.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------knsitdsk..............................................................
A0A1I8ACG0_9BILA/1-136                 ..................................................MTIQW.TVVAA.TLY.VEIVA.VLVL.L........L.P.W...IR.PT........L...wNKFF.K.............S..R..A.....MS..A......I..S....R..F.AT..V..Y........S..............Y..V.GISI......L..VL.......LF..F................DAIR.E......VR.KYSDSQIIE.................................RSSH.M.ADADALMHMR.LF.R.A...QRN.L..YIS..GFALL.L.FL........IIKRIC.GLIIRGAQLEAASEA-a.....................................................................
A0A0G4KMG9_9PEZI/1-141                 ..................................................MTLYY.TLVFV.LLM.LEMTL.FMLL.I........I.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELAMAtek...........................qnnGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDRVKS-y.....................................................................
A0A1X2IXD4_9FUNG/1-136                 ..................................................MTIYY.TLTFG.ILV.IEMLM.FGIL.V........L.P.L...PS.HW........R....RAML.K.............F..V..S.....TS..P......L..V....A..Q.AL..Y..V........L..............K..I.VFGF......I..FV.......LF..I................DTVN.R......LQ.RIDVSEEGE................................qRTAH.D.YSYEANLKAN.KF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.TLVIQMLKREEELEN-a.....................................................................
A0A088AVC4_APIME/1-134                 ..................................................MSLQW.TLIAG.FLY.VEILV.VLLL.L........L.P.I...IS.PL........T...wQRFF.K.............S..K..F.....LK..R......L..T....N..Q.AT..F..F........F..............L..L.LLGI......L..VL.......FL..L................DAIR.E......MR.KYSTNIEHK.................................D--Y.H.LDTEMQGNMR.LF.R.A...QRN.F..YIC..GFALF.L.SL........VIRRLV.TLISAQAILLAQNEA-a.....................................................................
R1E7E6_BOTPV/1-143                     ..................................................MTLYY.SLVFM.LLV.AEMVV.FMSL.I........V.P.L...PF.TW........R....RKLF.T.............F..I..S.....ES..P......L..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAssae.........................kqgrAAVI.G.GPERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEENKS-l.....................................................................
Q2F602_BOMMO/1-134                     ..................................................MSIQW.TFIAG.YLY.FEIAL.VMLM.I........L.P.I...FS.PR........R...wNQFF.K.............S..R..L.....FS..M......F..R....E..N.VA..V..Y........F..............Y..V.FIGV......L..AL.......FL..I................DAVR.E......IR.KYSNVTDVS.................................--HT.H.LATEMKTHVK.LF.R.A...QRN.F..YII..GFAIF.L.TF........VIRRLI.TMLIIQDELKQKAEK-i.....................................................................
A9P867_POPTR/2-124                     ...............................................iqp-----.--VYV.AIF.SEMGV.ILTL.I........F.-.-...-R.NP........L....RKFV.I.............M..G..L.....DR..V......K..R....G..R.GP..V..V........V..............K..T.VAGT......I..LV.......LL..L................SNVY.S......IG.NMQNRKMEA.................................-GAL.N.PTEEVLMAMQ.LL.Q.A...S--.-..-LL..GFLLF.L.SL........MIDRLH.HYIRELRLLRKAMEA-a.....................................................................
A0A2B7XBW4_9EURO/1-142                 ..................................................MTLYY.SLVFL.LLV.VEMVI.FLGL.I........I.P.L...PF.TV........K....RKLF.A.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELSSYskd..........................mggpGAAA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEDKVKQ-i.....................................................................
M1WH41_CLAP2/1-141                     ..................................................MTLYY.TLVFF.LLV.IEMTL.FMLL.L........V.P.L...PF.TA........K....RKVF.S.............F..I..S.....GN..P......I..V....S..K.VM..H..W........L..............R..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEVIAAgea...........................tskGPAV.L.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRMY.HLILDNMHLEDKVKA-f.....................................................................
A0A059EKT0_9MICR/67-117                ........................................kgssledvll-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.KY.Y.H...RSN.S..YLT..GFTLF.N.AL........ILYRFI.QVYNEFMEEEEKT---nil...................................................................
A0A1Y2EXL0_9FUNG/1-138                 ..................................................MTPYI.AYISY.ILV.FQCVL.IFYM.A........V.P.W...RV.PF........R....RTII.E.............K..VttS.....NS..G......I..L....N..K.VR..F..C........Y..............G..I.LQVF......I..VF.......LF..A................DNIK.Q......LK.YLNEQVDRV................................yKSPT.S.QEIIADTTKR.LH.K.T...QRD.F..YIL..AFTIY.C.GV........VVYLLH.LVVLRS----------gryrkernal............................................................
A0A0D1Y9L8_9EURO/1-143                 ..................................................MTLYY.SLVFV.LLV.AEMTL.FVAL.I........I.P.L...PY.AA........K....RRLF.N.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMAALakdt.........................tgagRAAA.I.GSERMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKLK--ly....................................................................
I3JBN9_ORENI/1-136                     ..................................................MTLQW.TAVAL.FLY.VEIGV.IVIL.C........L.P.F...IS.AR........R...wQSIF.H.............L..R..I.....WS..W......M..S....R..F.WN..K..V........F..............L..T.MIII......L..IV.......LF..L................DAVR.E......VR.KYSSKEHGA.................................DAKL.Q.PNMFDHLHMK.LF.R.A...QRN.L..YIS..GFAVF.L.WL........VMKRLI.TLINQLASVSGTTA--al....................................................................
A0A1S3ZX92_TOBAC/1-129                 ..................................................MALEW.VVLGY.AAA.AEAVM.VILL.T........L.P.G...AY.AV........R....KGLI.S.............V..T..-.....--..-......-..-....R..N.LL..K..P........F..............L..S.VVPF......C..VF.......LL..L................DIYW.K......YE.TRPRCKSA-.................................-ESC.T.PTELMRHQKS.VM.K.S...QRN.A..LLI..AAALM.F.YW........LLYSVT.RLVTRVEMLNQRVEK-lqn...................................................................
A0A0B7NUJ3_9FUNG/1-145                 ..................................................MTIYY.TTVFF.ILV.LEMIS.FGVL.V........F.P.F...PS.RW........R....RAML.K.............F..V..S.....SS..P......L..V....A..K.AV..R..I........L..............K..I.VFGN......C..VMdleidkdFF..K................DAVN.R......LQ.RIDQDEQPEe..............................agRPYH.D.YGYEASQKAR.KF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.TLVIAMLKHEEELE--ya....................................................................
T0KYJ5_9MICR/1-128                     ..................................................MGITT.KLVQS.ILY.TEISL.LSLL.L........S.P.A...PK.NI........K....KSIL.N.............F..T..T.....LK..I......F..K....P..I.LH..I..-........L..............Y..V.IYAM......I..FL.......MF..I................DSVL.K......LT.NLNSNLPNF.................................K---.-.--SISFNHNE.IY.H.T...ERN.F..YLS..GFSLY.I.AI........IFKIFG.RILINLYKEQDA----ihfl..................................................................
G1RBM4_NOMLE/1-137                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKELS-----nkdvl.................................................................
B9T5D1_RICCO/1-126                     ..................................................MALQW.MILTY.VVA.VEAAL.AAVL.T........V.P.S...PK.AL........K....YRLV.S.............L..V..S.....LI..-......-..-....-..-.LQ..P..A........-..............L..F.VVPF......A..GF.......QL..L................DIYW.K......NE.HRLMCTSE-.................................--IC.T.AAERDRYEKS.IY.K.A...QRN.V..ILC..ASACL.L.YW........CVYRIC.HYYKEIQKLEEV----ekrs..................................................................
A0A0C3K298_9HOMO/1-137                 ..................................................MTVYY.TLTFA.LLV.AEMAT.FVAL.L........L.P.M...PF.TA........R....KKIF.T.............F..L..S.....TS..P......V..V....A..K.IA..Y..G........L..............K..I.AFVF......V..AV.......LF..V................DALQ.R......VL.KVTSESDLAr...............................qAGVH.V.GSAETSHAAK.KF.Y.A...QRN.L..YLT..AFTLF.L.SP........LLTRTY.YILLDYIHIQDEYRK-l.....................................................................
G7YLX1_CLOSI/24-161                    ................................................im---LW.HLTAA.FLY.LEMFT.VFLL.I........I.P.L...FS.SR........S...wAKFF.K.............T..E..W.....VQ..K......F..A....A..F.ST..Y..Y........F..............N..F.FLVL......L..GL.......VL..L................EALR.Q......VM.NQRSAYETLk..............................shPSEL.R.PETESLYLMR.MF.R.A...QRN.L..YIA..GFALF.M.WF........VFRRLI.RLISEHAQMSASQEA-s.....................................................................
B6K3Q3_SCHJY/1-136                     ..................................................MTLYY.SLVFL.LLM.MEIIV.FLVL.I........I.P.L...PR.RL........R....KSVF.N.............F..C..A.....SS..P......F..I....G..K.VQ..Y..S........M..............K..I.TFIF......I..IV.......LF..I................DSVS.R......VM.KVTEEYNYA................................rVSAH.P.ESMRSEVQAR.KF.Y.A...QRN.M..YLC..GFTLF.L.SL........ILNRHY.VALSKLFTTQDRVDA-l.....................................................................
A0A183IH85_9BILA/1-137                 ..................................................MTLQW.TAVAI.FLY.IEIGT.LMLL.M........L.P.W...IR.PP........V...wKKIF.K.............S..R..I.....VR..A......F..E....S..Y.SY..I..Y........S..............Y..A.LGGI......L..FL.......LF..F................DAIR.E......VK.KYGFTESLS................................dFQYQ.V.AQVDAVVHMR.LF.R.A...QRN.L..YIS..GFALF.L.WL........VIRRMV.DLLSREANLMASAEA-s.....................................................................
C9IYK6_HUMAN/1-137                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A1V4JSQ6_PATFA/29-162                ..................................................MSLQW.TAVAT.FLY.AEVFL.VLLL.C........V.P.F...VS.AA........R...wQRIF.R.............S..R..L.....VG..L......A..V....A..Y.GN..T..A........F..............I..V.LIAV......L..VL.......LL..L................DAFR.E......TQ.RYSSPERSA.................................L--Q.T.PGAIEHYHMK.LF.R.A...QRN.L..YVA..GFSLL.L.SF........LLRRLV.TLISQQAVLGAASEA-f.....................................................................
M0RRW1_MUSAM/1-126                     ..................................................MGLQW.VILGA.VVA.AEAAV.AALL.I........L.P.A...PR.VI........K....SRIV.A.............L..A..S.....L-..-......F..L....Q..P.GA..G..I........-..............-..-.-LPF......A..AF.......QL..L................DLHW.K......NE.H---RLMCT.................................SDVC.T.IEERTRYEKS.IF.K.A...QRN.I..ILC..VLACL.L.YW........CIFRIC.KYHKEIRELEE-----vekrl.................................................................
A0A1A9ZRG5_GLOPL/1-135                 ..................................................MGLLW.TLIIG.FLY.AEIAV.VICL.V........F.P.I...GS.PR........K...wDRFF.K.............S..N..F.....LS..K......L..S....K..K.AQ..A..Y........F..............I..I.VMSV......L..LL.......LL..L................DAFL.E......MR.KYSNEEYRT.................................-VDP.R.LNSKMPQNTR.LF.R.A...QRN.F..YVS..GFAIF.L.ML........VIRRLV.TLISIQASLLTDMD--sl....................................................................
A0A091P0H6_HALAL/1-137                 ..................................................MTFQW.TAVAA.FLY.GEIGV.ILVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSAVHVNE................................kAANV.N.TNAFDHIQMK.LF.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTV.TLLTQLAKGMASHA--al....................................................................
A0A1V8UKA6_9PEZI/1-141                 ..................................................MNLIY.SPVFG.LLV.FEMAL.FVAL.I........V.P.M...PF.RI........K....RGLF.T.............F..I..S.....EN..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQIELHNAkqa...........................ggvAVGV.A.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEEEVKR-l.....................................................................
A0A1B7MJ97_9HOMO/1-140                 ..................................................MTIYY.SLTFL.LLA.AEMIT.FCLL.V........S.P.L...PY.TI........R....KKLF.Q.............F..L..S.....ES..P......I..I....A..K.VA..Y..V........L..............K..I.SFIF......V..GI.......LF..V................DALQ.R......MF.RVTAESDMAkt............................ssgQGMH.D.VRTETNFAAR.KF.Y.A...QRN.T..YLT..GFCLF.L.SL........VLTRTF.SIMLDLIHTQEEYAK-l.....................................................................
G3SAF0_GORGO/1-137                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
B6QAV1_TALMQ/1-142                     ..................................................MTLYY.TLVFM.LLV.FEMLV.FLAL.I........V.P.L...PY.TF........K....RKLF.A.............F..I..S.....ES..P......V..V....A..K.LQ..Y..G........L..............R..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEMSAFskd..........................stgiGAAA.L.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMIVEVLRLEDRIK--ll....................................................................
A0A0E0NS84_ORYRU/1-126                 ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..VSACL.L.YW........CIFRIC.KYNKDIKALEET----ekrl..................................................................
G3P1V0_GASAC/1-136                     ..................................................MTLQW.TVVAL.FLY.VEIGV.LIIL.C........L.P.F...IS.AR........R...wQSIF.Q.............L..R..I.....WS..F......M..A....R..F.WN..K..V........F..............L..T.MIIV......L..IV.......LF..L................DAVR.E......VR.KYSSRDLGT.................................EAKL.Q.PNMFDHLHMK.LF.R.A...QRN.L..YIS..GFAVF.L.WL........VMKRVV.TLINQLASVSGSTA--al....................................................................
E9IC03_SOLIN/1-45                      .................................................e-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.-------NMR.LF.R.A...QRN.F..YIS..GFALF.L.SL........VIRRLV.NLISAQASLLAQNEA-a.....................................................................
D8R629_SELML/1-126                     ..................................................MALEW.GALAL.VVA.AEGIL.LLFA.T........F.P.G...SH.KF........V....KGIV.-.............-..-..-.....-A..V......L..R....S..A.LQ..P..L........L..............S..I.VPFA......L..-F.......LL..L................DL--.-......YW.KYENHPRCE.................................GPSC.T.IVEREHHAKS.QM.K.S...QRN.L..LLV..IAALF.L.YW........VLYRVT.AMLVRIDHLQRKT---kiq...................................................................
A0A1B9G033_9TREE/1-138                 ..................................................MTLYY.TLCFG.LLM.AELTL.FATM.V........C.P.M...PF.AL........R....KKMF.H.............F..L..S.....EN..P......I..V....A..K.VQ..Y..G........L..............M..D.MIRF......V..AV.......LF..V................DAVQ.R......MV.RIAQEGAAAk..............................akPDMV.D.ARTETNYAAR.RF.Y.A...QRN.L..YLT..GATLF.L.SL........LLARVF.YIVLDFIHVQENYT--tl....................................................................
A0A2K1XWB7_POPTR/2-124                 ...............................................iqp-----.--VYV.AIF.SEMGV.ILTL.I........F.-.-...-R.NP........L....RKFV.I.............M..G..L.....DR..V......K..R....G..R.GP..V..V........V..............K..T.VAGT......I..LV.......LL..L................SNVY.S......IG.NMQNRKMEA.................................-GAL.N.PTEEVLMAMQ.LL.Q.A...S--.-..-LL..GFLLF.L.SL........MIDRLH.HYIRELRLLRKAMEA-a.....................................................................
I0Z7B1_COCSC/1-137                     ..................................................MSLWK.MVVEI.CLP.IPIVL.LALL.C........F.P.A...PR.VF........H....RGVL.Kv..........vdS..T..L.....GI..N......L..V....G..N.VL..S..L........L..............H..F.MLVV......S..GA.......AL..L................ATIR.T......TY.QLKDQKLDP.................................-SSV.T.PNVLSANLGK.RW.R.A...ERN.F..WIA..FITFT.L.WC........LLARFY.QILKHKAEVEDSLA--rl....................................................................
A0A132AHA8_SARSC/1-97                  ...............................................mti-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......L..T....T..Q.SY..I..Y........F..............F..V.ISII......L..LL.......FF..A................ESIR.E......IY.KYTTKVNLH.................................DLKY.AgSSAFYEDQMR.IF.R.G...QRN.F..YIT..GFALL.C.MF........IIKRLN.RLYGEMSRLEAQAEA-s.....................................................................
A0A094CG72_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMGL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAte............................qsqTGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
A0A1J7IF63_9PEZI/1-141                 ..................................................MTLYY.TLVFL.LLV.AEMGL.FMLL.I........V.P.L...PF.TL........R....RKMF.T.............F..I..S.....EN..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAAAteg...........................gqnGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEEKVK--vy....................................................................
A0A0L0NB04_9HYPO/87-227                ..................................................MTLYY.TLVFV.LLM.FEMAL.FMLL.L........V.P.L...PF.GV........K....RKVF.T.............F..I..S.....EN..P......I..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLELLAAteq...........................tskGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDRSEK-l.....................................................................
E4V1P1_ARTGP/1-139                     ..................................................MTLYF.TLVFV.LLV.TEMAI.FVGL.I........V.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELTGFda.............................anSGHA.I.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDILRLEDKVK--my....................................................................
A0A158R4A0_9BILA/338-449               ...........................................lhangqw-----.-----.---.-----.----.-........-.-.-...--.--........-....SKLF.R.............S..R..L.....IL..W......I..E....K..H.GN..V..V........Y..............V..A.ALCI......L..LL.......LF..S................DAIR.E......VN.KYSNEISSD................................sLARH.T.ADTETSIHMR.LF.R.A...QRN.L..YIS..GFALL.L.FL........VIKRIS.ALLIRVSQLQAAAEA-a.....................................................................
A0A2H0ZN25_CANAR/1-136                 ..................................................MALYY.NLVFG.LLV.IEMVF.FTIL.S........L.P.F...PR.KV........R....RTVL.A.............T..V..S.....KP..F......T..S....E..H.VQ..I..I........T..............K..C.VFGF......V..AV.......LF..I................DSVN.R......VY.SVTADLNNA................................gGERA.G.LVDRSEIQAR.KF.Y.A...QRN.M..YLC..GFALF.L.TL........LTTRAY.SLVAELVFTKDKLD--dy....................................................................
A0A163AT55_PHYB8/1-136                 ..................................................MAIYY.TLTFA.ILV.TEMVI.FGIL.V........M.P.L...PS.RW........R....RAMM.K.............G..L..T.....SS..P......L..I....G..K.AL..Y..G........L..............K..I.AFGF......I..FL.......LF..L................DTVN.R......LQ.RIGSDVTEE................................qRHHH.D.FGFEANLKAT.TF.Y.T...QRN.L..YLT..GFTLF.L.SL........ILDRTS.TLVIEVLKREEELES-v.....................................................................
A0A1E5WG98_9POAL/1-126                 ..................................................MALQW.MILAC.VVA.VEAAV.AALV.T........L.P.A...PR.AV........R....GQIV.A.............L..T..S.....LL..-......-..L....Q..P.L-..-..-........-..............A..T.VIPF......A..AF.......QL..L................DIYW.K......KE.HRLMCT---.................................SEIC.T.AEERIRFEKS.IF.K.A...QRN.V..ILC..VSACL.L.YW........CIYRIV.KYNKDIKALEETE---krl...................................................................
J4TUR7_SACK1/1-122                     ..................................................-----.-----.---.--MAI.LFVL.V........L.P.L...PQ.RV........R....KWLY.M.............R..C..T.....AI..G......S..N....K..K.FR..T..Y........M..............V..G.IMIF......V..GL.......LF..I................DSWK.R......SQiKVSTYHSQK................................pPYVI.N.SVTPVDALAS.RA.Y.N...QRN.V..YIS..GFIIY.F.CI........CILTVM.SILRRIVEWNDKIR--ag....................................................................
H0GDS0_SACCK/1-140                     ..................................................MSLYY.TLVFA.ILV.VEIFM.FSIL.A........L.P.I...PS.RY........R....RPLT.L.............L..L..L.....KP..F......K..S....S..T.VQ..V..A........I..............K..C.ILGF......I..LL.......LF..I................DCIN.R......VY.SIDKELQLSsa............................sqnNGAI.I.AQDRIEVLSR.KF.F.A...QRN.M..YLT..GITLF.L.TF........VVVRTF.GLVIELLTMKDIYR--as....................................................................
I3LRE0_PIG/1-137                       ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..S..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSSAHAIE................................rSSAS.R.PAAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A2H3CCJ3_ARMGA/1-139                 ..................................................MTIYY.SLTFF.LLA.AEMGT.FCLI.V........L.P.L...PH.TV........K....KRVF.S.............F..L..S.....TS..P......F..V....A..K.IA..Y..V........L..............K..I.SFIF......V..GI.......LF..F................DALQ.R......MF.RVTAEAELAks.............................gqQGIS.D.VRTETNLAAR.KF.Y.S...QRN.V..YLT..GFTLF.L.SL........VLTRTF.SIILDLIQVEEEV---lky...................................................................
V4LCI5_EUTSA/1-126                     ..................................................MALQW.LILSY.VVA.AEVAI.VIIL.T........L.P.Y...PM.LL........K....KRIV.S.............L..I..S.....LI..L......Q..P....A..-.AS..I..V........-..............-..-.--AF......A..GF.......QL..L................DLYW.K......N-.--EHRLMCS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VMC..AAGIL.L.YW........CIFRIC.KYNKDLERLEE-----lekry.................................................................
W5NFQ8_LEPOC/1-136                     ..................................................MTLQW.TAVAA.FLY.VEVGV.LLVL.C........I.P.F...IS.AQ........R...wQKIF.K.............F..S..L.....WD..K......I..A....P..Y.WN..K..G........F..............L..T.MIII......L..IV.......LF..L................DAIR.E......VR.KYSGAERTM.................................SDKL.H.PNMFDHHHMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........TLRRVI.SLINQLATVVGT----geal..................................................................
A0A1A9ULX3_GLOAU/1-134                 ..................................................MGLVW.TLIAG.FLY.AEICV.VLLL.V........L.P.V...AS.PY........K...wNRFF.K.............S..K..F.....LA..M......I..A....R..Q.AH..L..Y........F..............F..L.IMGV......L..VL.......FL..L................EAIR.E......MR.KYSNQEHSS.................................D--V.H.LNTEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRRLV.TLISVQANLLAQSEA-s.....................................................................
D8SGV1_SELML/1-126                     ..................................................MALEW.AGLMI.VVA.AESLL.LLFL.T........F.P.W...PA.KF........R....SSII.G.............V..S..-.....--..-......-..-....S..S.IL..R..P........L..............L..A.VLPF......A..GF.......LL..L................DVY-.-......-M.KYENRIQCQ.................................AGSC.T.AMDREHYAKS.VM.K.S...QRN.G..ILG..VFAIL.L.YW........FSYRVT.HILVDLEKTTKQI---svk...................................................................
A0A136J1Z3_9PEZI/1-141                 ..................................................MTLYY.TLVFL.LLV.AEMAL.FMLL.V........I.P.L...PF.SL........R....RRIF.T.............F..I..S.....EN..P......L..I....G..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELASAveg...........................skgAAAI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILETLRLEQKLKQ-y.....................................................................
H2LWC2_ORYLA/1-136                     ..................................................MTLQW.TAVAL.FLY.AEIGV.ILIL.C........L.P.F...IS.AR........R...wQSIF.K.............F..R..I.....WS..W......M..A....N..F.WN..K..V........F..............L..T.MIII......L..II.......LF..L................DAVR.E......VR.KYSSKDLVV.................................GAKL.Q.PNMFDHMHMK.LF.R.A...QRN.L..YIS..GFSVF.L.WL........VMKRLI.TLINQLASASATTAA-l.....................................................................
A0A0D2P0I0_GOSRA/1-126                 ..................................................MALQW.MILTY.MVA.AEAAL.ALLL.T........L.P.S...PK.LL........K....NRLV.S.............L..I..S.....L-..-......-..-....-..I.LQ..P..A........L..............-..F.IVPF......A..GF.......QL..L................DIYW.K......NE.HRLMCTSE-.................................--IC.T.AAERDRYEKS.FY.K.S...QRN.V..ILC..VTACL.L.YW........CIQRIC.KYNKEIQSLEE-----iekry.................................................................
A0A1I8QA16_STOCA/1-134                 ..................................................MSLVW.TLIAG.FLY.AEIAL.VLLL.V........L.P.V...AS.PY........K...wNRFF.K.............S..K..F.....LA..M......L..A....R..Q.AH..L..Y........F..............F..L.IMGV......L..VL.......FL..L................DAIR.E......MR.KYSHHDHSS.................................D--V.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRRLV.TLISTQAGLLAQSEA-s.....................................................................
A0A1E3BD90_9EURO/1-142                 ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........I.P.L...PF.PI........K....RKLF.T.............F..I..S.....ES..P......V..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFske..........................ggamGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILELLRLEGKVKH-l.....................................................................
A0A0W4ZGJ1_PNEJ7/1-63                  ..................................................MTLYY.SLVFS.LLV.IQMAL.FCLL.V........M.P.L...PK.RL........R....RRMF.S.............F..I..S.....TS..T......I..I....A..K.IR..Y..G........S..............K..V.CLKL......L..NI.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------rnl...................................................................
B6SIK5_MAIZE/1-127                     ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.GL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........-..............M..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCDDE-.................................-HAC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.QLVVRLEQMQQRVDK-l.....................................................................
A0A168ACU0_9HYPO/1-141                 ..................................................MTLYY.TLVFF.LLV.LEMAL.FMLL.L........I.P.L...PF.TA........K....RKVF.T.............F..I..S.....EN..P......I..I....S..K.VM..H..W........L..............R..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEVMAAseq...........................tskGPAV.L.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRMY.HMILDNMHLEDKVKA-f.....................................................................
A0A1E3I1Z6_9TREE/1-126                 ..................................................-----.-----.--M.AELGL.FCTI.V........C.P.M...PF.AL........R....KKMF.H.............F..L..S.....EN..P......I..V....A..K.VQ..Y..G........L..............K..I.TFIF......V..AV.......LF..V................DALQ.R......MV.RIAQEGATAk..............................mkSDIS.D.VRAETNYAAR.RF.Y.A...QRN.L..YLT..GATLF.L.SL........LLARVF.YIILDFITVQESYTA-l.....................................................................
B4J2Q6_DROGR/1-134                     ..................................................MSLVW.TLIAG.FLY.AEIAV.VLLL.V........L.P.V...AS.PY........K...wNRFF.K.............S..K..F.....LA..M......I..G....K..Q.SH..I..Y........F..............F..V.IMSV......L..VL.......LL..L................DAIR.E......MR.KYSSTDNVG.................................--EV.H.LNVEMQHSMR.LF.R.A...QRN.F..YIC..GFAVF.L.VL........VIRRLV.TLISSQANLLAQSEA-s.....................................................................
A0A1C7MDC5_GRIFR/70-208                ..................................................MTVYY.TLTFM.LLA.AEMAT.FCVL.V........A.P.L...PH.VV........R....KKLL.R.............F..L..S.....ES..P......F..V....A..K.FA..Y..G........V..............K..I.AFIF......V..GI.......LF..V................DAVQ.R......MW.RVTAEADIAks.............................naSGVQ.D.VRSETNFAAR.KF.Y.S...QRN.T..YLT..GFCLF.L.SL........VLTRTF.YILLDLVHTQEEYAK-l.....................................................................
F7CAI0_ORNAN/3-115                     ..............................................sils-----.-----.---.-----.----.-........-.-.-...--.FY........R...wQKIF.L.............F..P..L.....WG..K......I..A....S..F.WN..K..V........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSSHGVE................................kSSSS.N.PSASDHMQMK.LF.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTV.TLITQLAKELG-----akkal.................................................................
A0A0E0BSC4_9ORYZ/1-126                 ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..VSACL.L.YW........CIFRIC.KYNKDIKALEET----ekrl..................................................................
W9YY71_9EURO/1-128                     ..................................................-----.-----.---.--MVL.FIAL.I........V.P.L...PF.TV........K....RKMF.N.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMQSLlkds.........................sgagRAAA.I.GSDRMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVK--my....................................................................
W4H8E4_9STRA/1-133                     ..................................................MTMWA.TWAYV.LLP.PAVVL.LLLL.T........I.P.F...PK.FI........A....KGIV.R.............M..N..E.....FL..F......N..L....E..L.GG..I..P........I..............I..S.--II......T..FF.......AF..V................ALAG.Q......TY.DLQKRYTNKi...............................pGIAK.H.YEADLQQKAS.RW.R.S...ERN.W..WIS..ALTFT.I.YW........MLMAFQ.SLKKQLL---------aanrrtd...............................................................
A0A1G4J8F6_9SACH/1-141                 ..................................................MSVYL.SFLFG.VLT.LEMAI.LFVL.V........L.P.L...HY.RL........R....KAIV.N.............G..Y..D.....KF..M......G..N....L..Q.VK..T..V........I..............W..I.GGAL......V..GL.......LF..V................DSWK.R......AQ.ISVFLHHHKttt...........................gadPSGS.G.SVTPVQALAA.RA.Y.N...QRN.V..YIT..GFILY.F.SL........CIPTVM.SVVRRLVKWEELNR--sl....................................................................
D7KD12_ARALL/1-126                     ..................................................MALQW.LILTY.VVA.AEVVI.TLVL.T........L.P.Y...PM.LL........K....KRVV.Q.............L..V..S.....LI..L......Q..-....-..P.AA..S..-........-..............-..-.IVAF......A..GF.......QL..L................DIYW.K......AE.HR---LSCS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AAGIL.L.YW........CIYRIC.KYNKDLERLEATE---kry...................................................................
A0A194PQY2_PAPXU/1-134                 ..................................................MSLQW.TIIAS.FLY.AEIAF.ILLL.T........L.P.I...AS.PS........K...wQRFF.K.............S..K..F.....LA..Y......I..S....G..Q.AS..I..Y........F..............L..I.LIGV......L..VL.......CL..L................DAIR.E......MQ.KYSNMESSD.................................--HQ.H.LDAEMQGNMR.LF.R.A...QRN.F..YIS..GFALF.L.LI........VIRRLI.QLISELATVLATSEA-n.....................................................................
S3CB06_OPHP1/1-141                     ..................................................MTLHY.TLVFM.LLV.AEIAV.FLLL.A........I.P.L...PL.QA........R....RKIF.N.............F..L..S.....EN..P......F..V....A..K.IQ..Y..G........L..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVLLELSAAekv...........................snsAAAL.L.ASERQEVQAR.KF.Y.N...QRN.M..YLC..GFTLL.L.LI........ILNRTY.TLILDVLHLEEKIEK-y.....................................................................
A0A0F4YI76_TALEM/1-143                 ..................................................MTLYY.SLVFI.LLM.FEIVV.FLAL.I........V.P.L...PL.SV........K....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFskdt.........................tgigRAAA.L.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEEKIKQ-l.....................................................................
W2RM19_9EURO/1-143                     ..................................................MTLYY.SLVFV.LLM.AEMAL.FMGL.I........I.P.M...PF.TV........K....RKMF.N.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQVEMSALmkds.........................tgagRAAA.V.GSERMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.MMILDVLRLEEKVK--my....................................................................
H3ACP1_LATCH/1-137                     ..................................................MTLQW.TAVAT.FLY.VEIGL.LLLL.C........L.P.F...IS.PQ........R...wQKVF.R.............F..Q..L.....WG..K......I..A....S..Y.WN..K..A........F..............L..T.IIVV......L..IV.......LF..L................DAVR.E......VR.KYSAAQVVE................................kDKSL.F.PNVYDHIHMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........SLRRVV.TLLTHLATTAGASEA-l.....................................................................
E4XX96_OIKDI/1-138                     ..................................................MSFQW.QFVAA.ILY.VELGI.TLLL.C........LrP.I...SS.KW........W....SSLF.K.............S..S..I.....AK..K......V..A....S..N.GS..T..V........F..............Y..M.LASI......L..GL.......FC..V................DAWR.E......MQ.KYIDREEQAk...............................aEATV.N.PDTLNHILMW.KF.R.S...QRN.L..YIS..GFSLF.L.WI........VIQRLA.SLLKDKATAKAEASA-a.....................................................................
A0A2I4D007_9TELE/1-135                 ..................................................MSLQW.TAVAT.FLY.IEVFL.VLLL.C........I.P.F...IS.PK........R...wSRIF.K.............S..R..V.....VQ..T......I..A....L..Y.GN..T..W........F..............M..V.AIAI......L..VF.......LL..I................DAFR.E......VR.KYSVTDKVD.................................-VTN.N.PTAIEHIHMK.LF.R.A...QRN.E..YIA..GFALL.L.CL........LLRRLA.TLLSQQATLMASNEA-f.....................................................................
A0A058Z9T8_9EUKA/1-139                 ..................................................MSL-Y.TLVFG.ILV.MEVVA.FLLL.M........L.P.F...SP.AF........R....KKVV.S.............L..I..A.....NS..P......F..A....A..K.LK..I..G........V..............Q..V.VFVL......V..TL.......LF..L................ESIS.R......MY.RLENEISQQqa............................vynKGTA.L.IDPFMNLYTS.KF.Y.A...ERN.V..YLT..GITLF.L.AF........VLHRFQ.AVLLEISTSEAKL---avl...................................................................
A0A1Y2FXH4_9ASCO/1-138                 ..................................................MTLYY.ALVFS.LLV.LEMAM.FCVL.V........L.P.L...PF.KM........R....RSLF.V.............F..I..N.....TS..P......L..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LV.......LF..I................DSVN.R......VF.KVSDDAQARa..............................svDVSM.R.EQYRSDVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRVF.VLANTNLRLQDLVD--ns....................................................................
A0A199UNT0_ANACO/1-126                 ..................................................MALQW.VILSY.VVA.AEAVV.ALLL.T........F.P.A...PK.PL........K....SRLV.A.............L..I..A.....LV..L......Q..P....-..-.AS..G..-........-..............-..-.ILPF......V..AF.......QL..L................DLYW.K......NE.HRLMCTS--.................................-EIC.T.AEERIRYEKS.MF.K.A...QRN.V..ILC..VLACL.L.YW........CIYRIC.KYHRDIKELEEA----ekrl..................................................................
A9PC35_POPTR/1-126                     ..................................................MALEW.VVLGY.AAG.AEAIM.VLLL.T........I.P.G...LD.GL........R....KGLL.A.............V..T..-.....--..-......-..-....R..N.LL..K..P........F..............M..S.VVPF......C..LF.......LL..M................DIY-.-......-W.KYETRPSCE.................................GESC.S.PTEHLRHQKS.IM.K.S...QRN.A..LLI..GAALI.F.YW........LLYSVT.HLVVKIEQLNQRVE--rl....................................................................
A0A1B0G321_GLOMM/201-276               ................................ykrpdkvyayldtqrfsq-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.----MEEKN.................................-AQM.K.FDI--VRENH.FL.K.A...QRN.L..YIS..GFATF.L.IM........VLKRII.ALIAIVNQLLAQSDA-a.....................................................................
G8JRH9_ERECY/1-135                     ..................................................MSLYY.SLVFG.ILI.IETFI.FALL.A........V.P.L...PM.VV........R....RPLT.K.............G..L..A.....QP..F......L..S....P..T.VQ..V..I........I..............K..V.ILGF......I..LL.......LF..V................DTVN.R......MY.TINMEYERS.................................KGAG.Y.AHDRLEILSR.KF.L.A...QRN.M..YLT..GITLF.L.TF........TIVRTF.GLVLELFDLKDKCS--er....................................................................
A0A0M9AAW8_9HYME/1-135                 ..................................................MSLQW.TLIAG.FLY.LEIVV.VLLL.I........L.P.I...IS.PK........S...wQKLF.K.............S..R..F.....LK..S......L..S....N..Q.AS..M..Y........F..............L..I.LLGI......L..VL.......FL..L................DAIR.E......MR.KYSTSLDEH.................................-KDH.H.LDTEMQGNMR.LF.R.A...ERN.F..YLS..GFSLF.L.SL........VIHRLV.ILISTQATLLAQNEA-a.....................................................................
A0A1S3JPA9_LINUN/1-96                  ................................................mi-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......I..T....S..Y.AN..Y..Y........F..............T..V.FIVI......L..MV.......VF..G................DSIR.E......VY.KYNISKESL................................dIKTS.Q.AATLEHVHMR.LF.R.A...QRN.F..YIA..GMSLF.L.LV........VLKRLV.VLISTAATLTAQR---dva...................................................................
A0A091KIY2_9GRUI/1-136                 ..................................................MTFQW.TAVAA.FLY.GEIAV.ILVL.C........L.P.F...IS.PL........R...wQKIF.T.............I..S..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSAVHVNE................................kAVNV.N.TNAFDHIQMK.LF.X.X...X-X.X..XLS..GFSLF.L.WL........VLRRTV.TLLTQLAKGMASHA--al....................................................................
H2UXB8_TAKRU/1-136                     ..................................................MTLQW.TAVAT.FLY.LEIGV.LVIL.C........L.P.F...IS.AR........R...wRSIF.H.............L..R..I.....WG..S......L..A....Q..F.WN..K..V........F..............L..T.MIII......L..IV.......LF..L................DAIR.E......VR.KYSVRDAGT.................................AAKM.Q.PNMYDHLHMK.LF.R.A...QRN.L..YIS..GFAVF.L.WL........VMKRVV.TLINQLAAASASTAA-f.....................................................................
A0A0D2VHC8_CAPO3/1-132                 ..................................................MSLQW.AAVFG.VLC.AEILA.FLVLlV........I.P.H...--.--........-....GPYL.A.............R..I..A.....RS..Q......L..F....A..K.VK..F..G........L..............R..I.LGYI......L..AF.......FF..L................DAMR.L......MY.RIEMEKGTL................................gLTPP.P.ADAYDNFNMR.LF.R.A...QRN.A..YLN..FFAVF.L.LL........VLNRFG.HSIFELAELKEKCA--ll....................................................................
A0A167MQS6_PHYB8/1-141                 ..................................................MTLYY.AIVFA.ILA.IEVFI.FFLL.M........L.P.L...PL.QW........Q....KSVF.H.............W..L..A.....TS..P......T..V....A..H.AH..Y..I........M..............R..I.IFGF......I..FV.......LF..L................DSVN.R......LK.TISDTVTNEeeg...........................gspIAVH.D.IRAEASIAAK.KF.Y.A...QRN.M..YLT..GFSLL.L.LI........ILNRVY.TMTLENMRLEEKVNR-l.....................................................................
E7KR20_YEASL/1-123                     ..................................................-----.-----.---.--MVM.LFIF.V........L.P.L...PF.RI........R....RGIF.S.............T..Y..N.....QL..T......A..K....Q..Q.IK..T..I........I..............F..I.TGCL......V..GL.......LF..I................DSWK.R......SQiRVSLYHNDNs...............................gSIGS.S.AVTPIQALAS.RA.Y.N...QRN.M..YIS..GFILY.F.SI........CIPTVM.SIVKRLVKYQ------glineq................................................................
A0A024GHM5_9STRA/30-166                .................................................m-ATFWsTMTYF.LLP.PAVVL.LLLL.T........I.P.F...PF.LK........L...nRAIV.R.............F..AdfV.....FS..L......E..I....G..T.IK..I..F........H..............L..I.TVVS......F..VV.......LA..A................QTFE.L......QK.RYPTKYDHH.................................-LEA.H.YAADLQERAK.RW.R.F...ERN.W..WIS..ALTFT.I.YW........MLLRFH.ALKKELVF--------qkngtkp...............................................................
A0A0D3FG11_9ORYZ/1-126                 ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..VSACL.L.YW........CIFRIC.KYNKDIKALEET----ekrl..................................................................
A0A2I4HLI0_9ROSI/1-126                 ..................................................MALQW.MILTY.MVA.VEAAI.AVLL.T........L.P.L...PK.LV........K....DRLV.S.............L..V..S.....L-..-......-..-....-..I.LQ..P..C........-..............L..F.VVPF......A..GF.......QL..L................DIYW.K......NE.HRLMCTS--.................................-KIC.T.ASERERYDKS.IY.K.A...QRN.V..ILC..AASIL.L.YW........SVYRIC.KYHKEIQNLEEDEK--ks....................................................................
K7G571_PELSI/1-136                     ..................................................MTFQW.TAVAT.FLY.TEIGV.ILLL.C........I.P.F...IS.PL........R...wQKIF.T.............I..P..L.....WN..K......I..A....N..Y.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAIR.E......VK.KYSTAHVGE................................kGANI.N.PNAFDHIQMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRTV.TLITQLAKE-------mgiqva................................................................
A0A2D3UZR1_9PEZI/1-141                 ..................................................MTLYY.SLVFA.LLM.FEMTV.FMSL.I........I.P.L...PF.TI........K....RKLF.T.............F..I..S.....EN..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQVELAQAkyq...........................ggaAGAV.A.GTERMEVQAR.KF.Y.X...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDTLRLEEKVKN-l.....................................................................
A0A165B578_9APHY/1-138                 ..................................................MTIYY.SMTFA.LLV.AEVAT.FVVI.V........L.P.L...PY.AF........R....KRLF.R.............F..L..S.....ES..P......A..V....A..K.VA..Y..G........I..............K..I.AFIF......V..GI.......LF..V................DAVQ.R......ML.RVTAEADLAk..............................tsGGVQ.D.IRSETNFAAR.KF.Y.A...QRN.T..YLT..GSTLF.L.SL........VLTRTF.YILLDLVQTQEEYAK-l.....................................................................
C7YI95_NECH7/1-127                     ..................................................-----.-----.---.--MAL.FMLL.I........I.P.L...PF.NV........K....RKIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELIAAseq..........................skqgGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRA-y.....................................................................
H0YY43_TAEGU/1-134                     ..................................................---QW.SAVAA.ICT.AKIGV.IIVL.C........V.P.F...IS.PL........R...wQKIF.M.............F..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAIR.E......VR.KYSSVHVNE................................kAAHV.N.SSAFDHIQMK.LF.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTV.TLLTQLAKEMASHAA-l.....................................................................
A0A0P7BCS2_9HYPO/1-47                  ..................................................MTLYY.TLVFV.LLV.FEMTL.FMLL.I........V.P.L...PF.NV........K....RRIF.T.............V..N..R.....V-..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------yrvqlel...............................................................
A0A1S2YL36_CICAR/1-124                 ................................................ml-----.----Q.LLY.TAIFI.EMLL.I........L.T.L...VF.KT........P...lRKLV.I.............V..S..L.....DR..V......K..R....G..R.GP..I..V........V..............T..T.VGAT......L..VV.......VL..S................SSLY.S......MA.KIQQRTIEA.................................G---.I.INPTDQVLMS.KH.M.L...--E.A..SLM..GFMLF.L.SL........MIDRLH.HYIRELRLLRKTMEA-v.....................................................................
A0A0C2H2H2_9BILA/1-59                  .............................................messv-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................--RH.A.ADADAVIHMR.LF.R.A...QRN.F..YIS..GFALL.L.FL........VIKRIM.GLISRGAQLEAASEA-a.....................................................................
A0A182HFS4_ANOAR/1-135                 ..................................................MTLVW.GIIAS.FLY.VEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHTH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
A0A080WIT3_TRIRC/1-139                 ..................................................MTLYF.TLVFV.LLV.TEMAI.FVGL.I........V.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELTGFda.............................anSGHA.I.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDILRLEDKVK--my....................................................................
E7QH91_YEASZ/1-123                     ..................................................-----.-----.---.--MVM.LFIF.V........L.P.L...PF.RI........R....RGIF.S.............T..Y..N.....QL..T......A..K....Q..Q.IK..T..I........I..............F..I.TGCL......V..GL.......LF..I................DSWK.R......SQiRVSLYHNDNs...............................gSIGS.S.AVTPIQALAS.RA.Y.N...QRN.M..YIS..GFILY.F.SI........CIPTVM.SIVKRLVKYQ------glineq................................................................
A0A177VJ52_9BASI/1-138                 ..................................................MTLYY.SIVFM.LLV.LEMAM.FLVL.I........L.P.L...PF.TA........R....RKLF.H.............F..L..A.....TN..S......F..I....G..Q.IQ..Y..G........I..............K..I.TFIF......V..AV.......LF..V................DAVQ.R......MI.KVMNEAQMAk..............................qnKGAA.D.VRTETNLAAK.RF.Y.T...QRN.M..YLT..GFTLF.L.SL........ILSRTH.SLVVDLIKTQEEN---vqm...................................................................
A0A1I8CDB0_9BILA/653-787               ............................................smkdlk-----.----S.ILY.AEIAL.ALLL.V........F.P.W...IR.PT........T...wKKLF.N.............S..R..L.....IS..S......L..T....S..H.AT..V..A........S..............Y..C.SIVV......L..FL.......LF..L................DAAR.E......TN.KYAGADINGv...............................aGGRG.T.AETDAVLHMR.LF.R.S...QRN.L..YIS..GFALI.L.FL........VNKRIV.SLLTRSANLEAASQA-a.....................................................................
G8YLY4_PICSO/1-140                     ..................................................MSIQM.SLIFG.TLL.LQMTA.LLVI.L........L.P.L...PL.KA........R....KAIV.N.............M..A..E.....SL..K......S..S....K..N.FN..I..G........L..............W..F.SLIL......L..GL.......QF..A................DCFN.R......LQ.RFSHIGNPYll............................vssRDID.Y.SAISYDQLAS.KF.Y.S...QRN.L..YLT..GAVLY.L.TL........AINTVL.GILKKLVSKATEYNK-i.....................................................................
S7Z673_PENO1/1-142                     ..................................................MTLYY.SLVFL.LLV.FEMAV.FLAL.I........V.P.L...PF.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELAAFakd..........................gsavSAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.MMILEVLRLEDRVK--ll....................................................................
S0DQ49_GIBF5/1-143                     ..................................................MTLYY.TLVFM.LLV.FEMAL.FMLL.I........V.P.M...PF.NV........K....RKIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAseqs.........................kqggGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRD-y.....................................................................
A0A0D9YXX0_9ORYZ/1-127                 ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.GL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........-..............M..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCDD--.................................EHHC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.SLVVRLDQLQQRVDK-l.....................................................................
A0A2C5YJD4_9HYPO/1-140                 ..................................................MTLYY.SLVFS.LLV.LEMGL.FMLL.V........L.P.M...PF.NA........K....RKLF.T.............F..I..S.....EN..P......L..V....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..L................DSVN.R......VY.RVQLELSSAsd............................askGPAI.I.GSERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEMMRLEDRLRA-f.....................................................................
A0A1B8B2L6_FUSPO/1-144                 ..................................................MTLYY.TLVFM.LLV.FEMGL.FMLL.I........F.P.M...PF.NV........K....RKIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQLELAAAseqa........................khgggGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIIEVMRLEDKVRS-y.....................................................................
W4K1X5_9HOMO/1-139                     ..................................................MTIYY.SLTFI.LLA.AEMVT.FCVF.V........A.P.L...PY.QI........R....RRLF.R.............F..L..S.....ES..P......I..V....A..K.IA..Y..A........L..............K..I.SFIF......I..TI.......LF..V................DAVQ.R......MF.RVTAEVELAka.............................ggQGAQ.D.VRTETNFAAR.KF.Y.A...QRN.T..YLT..GFCLF.L.SL........VLTRTF.YILQELIHSQEEYAK-l.....................................................................
E0VSZ3_PEDHC/1-138                     ..................................................MSIQW.TLIAG.FLY.FEVAV.VLLL.V........L.P.V...AS.PK........K...wQRIF.R.............S..R..F.....LN..A......L..G....A..Q.AS..F..Y........F..............Y..V.LLII......L..VI.......FL..M................DALK.D......MM.KYSNSESGDk...............................sQTHS.H.LDAEMQMNMK.KF.R.A...QRN.F..YIS..GFALF.L.SL........VIRRLC.HLISNLAVMQAQSEA-a.....................................................................
K4BNU9_SOLLC/1-129                     ..................................................MALEW.VILGY.AAA.AEAVM.VLLL.T........L.P.G...TY.PL........R....SGLL.S.............V..T..-.....--..-......-..-....R..N.LL..K..P........F..............L..S.VVPF......C..LF.......LL..L................DIYW.K......YE.TRPKCKSA-.................................-ESC.T.PTELMRHQKS.MV.K.S...QRN.A..LLI..ASALM.F.YW........LLYSVT.RLVTRVELLNQRVE--klkn..................................................................
E5SY79_TRISP/58-196                    ictfmyassvdsteqvvtlatsvsksfftfysdvfivlhllfcvnvastv-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.FG..L..S........L..............F..F.TRLH......E..MM.......IL..L................DALR.E......VR.KYSDADLVK.................................QSVG.N.VQGEFNTHMR.LF.R.A...QRN.L..YIS..GAALF.L.WF........AIQRVA.SMISREAMLIASAEA-a.....................................................................
Q7SG21_NEUCR/1-142                     ..................................................MTLYY.SLVFM.LLV.AEMSI.FMLL.I........V.P.L...PF.TI........R....RRLF.T.............F..I..S.....EN..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAAAtda..........................skgnAAAI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEEKLKK-f.....................................................................
N1R6W3_FUSC4/1-143                     ..................................................MTLYY.TLVFM.LLV.FEMAL.FMLL.I........F.P.M...PF.NV........K....RKIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAseqs.........................kqggGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRA-y.....................................................................
D8QG24_SCHCM/1-141                     ..................................................MTIYY.SLTFL.MLA.AEVAL.SFVI.I........A.P.L...PH.AV........R....KRLF.G.............F..L..A.....NN..K......I..V....S..K.IA..Y..G........V..............K..I.SFIF......I..GI.......LF..L................DALQ.R......MF.RVTAESDAAran...........................gtaQPQG.A.AFGDGGLAAR.KF.Y.A...QRN.T..YLT..GFTLF.L.SL........LLTRTF.YLVLELIHVQDEYAK-v.....................................................................
A0A090LLR9_STRRB/1-138                 ..................................................MSIQW.TIVAG.ILY.TEIAF.VILL.V........L.P.W...IR.PT........I...wKKFF.N.............S..R..F.....VT..A......I..S....H..K.ST..I..A........S..............Y..S.TIFV......L..TL.......LF..L................DAAR.E......CA.KYSNTAIVEn...............................tLIKG.A.ADVDTALHMR.LF.R.S...QRN.L..YIS..GFALL.L.FL........VINRII.GLLVRSAQLQASAEA-a.....................................................................
A0A0D9R3J7_CHLSB/1-112                 ..................................................-----.-----.---.-----.----.-........-.P.F...CR.LH........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
W5P6Z7_SHEEP/1-137                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..S..V.....WG..K......I..A....S..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF.lV................DAVR.E......VR.KYSSTHTIE................................kSSAS.R.PAAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKE-------lsnkgv................................................................
YET3_YEAST/1-140                       ..................................................MSLYY.TLVFA.ILV.VEIFM.FSIL.A........L.P.I...PS.RY........R....RPLT.L.............L..L..L.....KP..F......K..S....S..T.VQ..V..A........I..............K..C.VLGF......I..LL.......LF..I................DCIN.R......VY.SIDKELQLSsa............................sqnNGAI.I.AQDRIEVLSR.KF.F.A...QRN.M..YLT..GITLF.L.TF........VVVRTF.GLVIELLTMKDIYR--as....................................................................
E9GHY5_DAPPU/1-139                     ..................................................MSFQW.GLIAT.FLY.IEIAV.VFLL.L........L.P.F...IS.AQ........R...wNKLF.K.............S..S..F.....LR..G......L..G....Q..Q.VH..I..Y........F..............Y..V.ILAF......L..VL.......CL..F................DAIR.E......MR.KYDVTHDGKa..............................keQQHQ.H.LEQELRNSMV.LF.R.A...QRN.F..YIT..GFSLF.L.IF........VIRRLM.TLLAAQATLAATSEA-a.....................................................................
A0A182J513_9DIPT/1-135                 ..................................................MTLVW.GIIAS.FLY.LEIFI.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHTH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAMLLAQAEA-s.....................................................................
H0GM04_SACCK/1-83                      ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.-MIF......V..GL.......LF..I................DSWK.R......SQiRVSTYRNQK................................nPYII.N.SVTPVDALAS.RA.Y.N...QRN.V..YIS..GFIIY.F.YI........CILTVM.SILRRIVEWNDKMKA-g.....................................................................
A0A0B2V8Z9_TOXCA/1-137                 ..................................................MTLQW.LAVAF.ILY.AEIAI.VLLL.L........L.P.W...IR.PS........M...wSKIF.K.............S..R..V.....VK..T......L..E....R..N.AN..V..Y........S..............V..A.AIAV......L..LL.......LF..F................DAIR.E......VR.KYAGEIVAD................................sPIRP.T.ADADNALHMR.LF.R.A...QRN.L..YIS..GFALL.L.FL........VIKRIM.ALLSRGAQLEAAAEA-a.....................................................................
A0A1Y2FIW4_9ASCO/1-112                 ..................................................-----.-----.-LC.IEMVL.FVIL.V........L.P.L...RS.KG........R....HMVI.N.............F..L..N.....NT..L......V..A....S..K.LL..H..G........F..............K..I.SVIF......V..FV.......LF..L................DACR.G......VS.KKAEVSSD-.................................----.-.LTMSDKLANA.KL.V.S...QRN.L..YLC..GFSLF.L.AF........ALWRVE.GLLEE-----------idgss.................................................................
A0A0N4ZN06_PARTI/1-138                 ..................................................MSIQW.TIVAG.ILY.AEVAF.VILL.V........L.P.W...IR.PT........V...wKKIF.N.............S..R..L.....IK..A......V..S....D..K.ST..I..A........S..............Y..S.TIFV......L..SL.......LF..L................DAAR.E......CA.KYSHSTLLDn...............................sVLKG.A.ADVDTAIHMR.LF.R.S...QRN.L..YIS..GFALL.L.FL........VINRII.GLLVRSAQLQASAEA-a.....................................................................
A0A183LF61_9TREM/1-63                  .................................................m---LW.HIVVT.FLY.SEMFV.VLLM.I........L.P.F...FS.SQ........T...wSKFF.K.............F..S..I.....IQ..K......I..S....E..K.SS..F..Y........F..............R..L.FLVM......L..VC.......VL..-................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------ag....................................................................
F4S136_MELLP/1-138                     .................................................l---YN.WMVFA.LLI.FEIVT.FIVL.V........M.P.L...PF.TW........R....RSIF.K.............F..L..S.....TS..P......L..I....A..K.LQ..Y..G........L..............K..I.LFIF......V..GV.......LF..V................DSVQ.R......MT.KIHNEGQAAre............................qgaGVGR.D.LRSETDWRSR.KF.L.S...ERD.M..YMR..GFTLF.L.SL........ILSRTF.GLILDLIKAQEDL---avl...................................................................
R0MCF0_NOSB1/1-67                      ..................................................-----.-----.VLY.AEMSL.FALL.I........L.P.L...PN.YV........S....RMFI.S.............M..F..H.....ES..Q......F..S....R..P.FA..H..I........L..............W..V.LYIM......I..FI.......LF..I................DSIY.R......QY.N--------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------tiedri................................................................
D6WDF1_TRICA/1-134                     ..................................................MSLQW.TLIAG.FLY.VEIAI.VLLL.V........L.P.V...AS.PK........R...wNAFF.K.............S..R..F.....LQ..G......L..Q....R..Q.AG..M..Y........F..............M..I.LLAI......L..VL.......FL..L................DAIR.E......MR.KYSQIESEE.................................-QHS.H.LDREMQGSMR.LF.R.A...QRN.F..YIS..GFALF.L.SL........AQSATT.A---------------aksllaqrgeiaqn........................................................
A0A0A2JUD2_PENEN/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMAV.FLAL.V........I.P.L...PH.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELSAFtkd..........................gpgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRVR--mf....................................................................
C1H3V0_PARBA/1-142                     ..................................................MTLYY.SLVFL.LLV.VEMVI.FVGL.I........I.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......L..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQMELSSYske..........................lggaGTAA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEDKVK--ly....................................................................
A0A0H5C2U3_CYBJA/1-117                 ..................................................-----.-----.---.--MTA.LAIL.V........F.P.L...PL.VL........R....KKAF.M.............I..Y..Q.....RA..Y......D..S....K..E.LR..T..V........G..............V..V.TTVL......I..GL.......QF..S................DSLR.S......SW.KWHREYTQN.................................---H.S.MVTSADLLAR.RF.Y.S...QRN.L..YIS..GAILF.L.TL........AIPTVF.SIVRRLIKYEELKR--ka....................................................................
A0A024GGJ7_9STRA/30-166                .................................................m-ATFWsTMTYF.LLP.PAVVL.LLLL.T........I.P.F...PF.LK........L...nRAIV.R.............F..AdfV.....FS..L......E..I....G..T.IK..I..F........H..............L..I.TVVS......F..VV.......LA..A................QTFE.L......QK.RYPTKYDHH.................................-LEA.H.YAADLQERAK.RW.R.F...ERN.W..WIS..ALTFT.I.YW........MLLRFH.ALKKELVF--------qkngtkp...............................................................
A0A1E4SJT5_9ASCO/1-142                 ..................................................MALYY.NLVFG.LLI.VEMVF.FTIL.S........L.P.Y...PR.NI........R....RTVL.T.............T..V..S.....AP..F......R..N....E..Q.FQ..I..A........I..............K..C.ILGF......I..LV.......LF..I................DSVN.R......VY.SVTSELRAAsps..........................ghqtTVTG.I.MNDRSEVQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.TL........IITRTY.SLVAELIATKDKLDA-k.....................................................................
W1QBU6_OGAPD/1-146                     ..................................................MSLQM.MIVFG.LLV.TEMTL.MTIL.V........M.P.L...PH.KV........Q....DGFV.N.............L..A..Y.....KL..L......Q..N....P..N.VK..V..G........L..............V..F.GASV......L..GM.......MF..M................DALR.T.....aVP.KIPKEYHPGmpasg.......................nvppvPTMM.A.GATWSEVRVR.KF.Y.S...QRN.M..YLT..GGTLF.L.GI........AIYFNI.ILLKSMVKNKEKL---iqa...................................................................
K3YWN4_SETIT/1-127                     ..................................................MALEW.VVLGY.AAG.AEAVM.LLLL.T........L.P.G...LD.GL........R....RGMV.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........M..............-..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCDDE-.................................-HAC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.SLVVRLQQLQQRVDK-l.....................................................................
A0A1B8CKT9_9PEZI/1-141                 ..................................................MTLYY.SLVFM.LLV.AEMGL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAteq...........................sqtGRAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLKLETKLKQ-y.....................................................................
A0A0K6G4Y8_9HOMO/1-138                 ..................................................MTIYY.TLTFL.LLA.AEMVT.FCLL.V........M.P.L...PF.TA........R....QKLF.R.............F..L..S.....TS..V......I..V....A..K.IA..Y..A........L..............K..I.SFIF......I..AV.......LF..V................DAVQ.R......MM.RVSAEGQQAk..............................qaAGAT.D.VRTETNYAAK.KF.Y.T...QRN.M..YLT..GFTLF.L.SL........ILTRTY.YILLDLIHAQEQYAE-l.....................................................................
E9EBZ2_METAQ/1-141                     ..................................................MTLYY.SLVFF.LLV.LEMVL.FMLL.L........I.P.L...PY.TA........K....RKVF.T.............F..I..S.....EN..P......I..I....S..K.VM..Y..W........L..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLEVVAAgeq...........................askGTAI.L.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIIDNIKLEDKVKA-f.....................................................................
A0A078JWE9_BRANA/1-126                 ..................................................MALQW.LILSY.VVA.AEVAI.AVIL.T........L.P.Y...PM.LL........K....KRIV.S.............L..V..S.....LV..L......Q..P....A..A.--..-..-........-..............-..S.IVAF......A..GF.......QL..L................DIYW.-......--.KNEHRLECS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AAGIL.L.YW........CIYRIC.KYNKDLDHLEE-----lekry.................................................................
A0A1J9R254_9PEZI/1-143                 ..................................................MTLYY.SLVFM.LLV.AEMVI.FMSL.I........V.P.L...PF.TW........R....RKLF.T.............F..I..S.....ES..P......L..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELSAAsnae.........................kqgrAAVI.G.GPERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEENNS-l.....................................................................
F9WZ12_ZYMTI/1-141                     ..................................................MTLYY.SLVFG.LLV.FEMVV.FVSL.I........V.P.M...PF.AV........K....RKLF.T.............F..I..S.....EN..P......L..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAQAkhq...........................ggaAGGV.A.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDTLRLEAEVKK-l.....................................................................
A0A087VHC9_BALRE/1-134                 ..................................................MTFQW.TAVAA.FLY.GEAGI.ILVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSAIHVNE................................kVANI.N.TNAFDHIQMK.LF.-.-...-RN.L..YLS..GFSLF.F.WL........VLRRTV.TLLTQLAKGMASHA--al....................................................................
V4LWE8_EUTSA/1-103                     ..................................................MALQW.LILSY.VVA.AEVAI.VIIL.T........L.P.Y...PM.LL........K....KRIV.S.............L..I..S.....LI..L......Q..P....A..-.AS..I..V........-..............-..-.--AF......A..GF.......QL..L................DLYW.K......N-.--EHRLMCS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VMC..AAGIL.-.--........------.----------------ly....................................................................
A0A120E7B6_9BASI/1-141                 ..................................................MAIQN.LIAFG.ILV.LELIT.FGIL.I........V.P.L...PF.TW........R....RALF.K.............A..I..A.....ES..Q......I..I....A..Q.IQ..Y..G........L..............K..I.TFIF......I..AL.......MF..V................DAVN.Q......ML.KIHREKEFTata...........................ggpGAVP.D.MRTQSDFRSR.KF.L.S...ERN.F..YLH..GSCLV.L.SL........ILSRTY.SLVLDLIKAQEEL---aii...................................................................
A0A0J0XTX4_9TREE/1-126                 ..................................................-----.-----.--M.AEVGL.FTTI.I........A.P.M...PF.TM........R....KRLM.R.............F..L..S.....DN..P......I..I....A..K.IQ..Y..G........L..............K..I.TFIF......I..AV.......LF..V................DALQ.R......MI.RIAQEGAKAk..............................aqPDIT.D.ARTEMAYAAR.RF.Y.A...QRN.L..YLT..GATLF.L.SL........VLSRVF.YILLDFITTQEQLNA-l.....................................................................
A0A1A9W7N9_9MUSC/1-134                 ..................................................MGLVW.TLIAA.FLY.AEILV.VLLL.V........L.P.V...AS.PY........K...wNRFF.K.............S..K..F.....LA..M......I..A....R..Q.AH..L..Y........F..............V..L.IMGV......L..IL.......FL..L................EAIR.E......MR.KYSNQEHSS.................................D--I.H.LNTEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRRLV.TLISVQANLLAQSEA-s.....................................................................
H0EVL4_GLAL7/38-113                    .................................................i-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................--VN.R......VY.RVQVELAETnk............................nagGTVV.M.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEEKVKA-y.....................................................................
A0A093F8X8_TYTAL/1-136                 ..................................................-TFQW.TAVAT.ILY.GEIGV.LLVL.C........L.P.F...IS.PL........R...wQKIF.T.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSAVHVNE................................kAANV.N.TNAFDHIQMK.LF.R.S...QRN.L..YLS..GFCLF.L.WL........VLRRTV.TLLTQLAKGMASHA--al....................................................................
A0A068XJG8_HYMMI/22-160                ..................................................MSLMW.VMVAG.GLY.AEIAV.ITIL.L........I.P.F...IS.SR........V...wNRVF.K.............S..N..F.....IT..W......L..S....S..Y.GS..F..Y........F..............K..A.CVIA......L..CL.......TV..V................EAWR.Q......VR.NKSEMYNEYk..............................sdPSNF.K.AGTESLYLMK.LF.R.A...QRN.L..YIS..GFALF.L.WF........VFNRLV.RLIADHARVTAAGE--as....................................................................
A0A1E4RZL7_CYBJA/1-128                 ...............................................fik-----.--LFT.LLV.LQMTA.LAIL.V........F.P.L...PL.VL........R....KKAF.M.............I..Y..Q.....RA..Y......D..S....K..E.LR..T..V........G..............V..V.TTVL......I..GL.......QF..S................DSLR.S......SW.KWHREYTQN.................................---H.S.MVTSADLLAR.RF.Y.S...QRN.L..YIS..GAILF.L.TL........AIPTVF.SIVRRLIKYEELKR--ka....................................................................
Q75DD2_ASHGO/1-135                     ..................................................MSMYL.TLLFL.VLI.LEMSV.LFVL.V........L.P.L...PF.RI........R....RLFV.R.............S..Y..D.....KL..Q......E..L....G..Q.LR..T..V........G..............V..I.LYGL......V..GM.......LF..L................DSWW.R......AQ.RATQRFSEG.................................ATQD.P.LNTGLQTFAT.KA.Y.N...ERN.L..YIS..GFILY.F.SI........CIPTVI.NILKSLIRQY------elgaaa................................................................
A0A0F4XD17_HANUV/1-131                 ..................................................MAVYL.TILFG.LLV.LQLTS.LLIL.S........L.P.L...PT.LL........R....RALV.K.............I..Y.dQ.....FL..F......K..S....S..Q.VK..T..I........L..............I..V.VNIL......V..VS.......LF..V................DSYK.R......AS.VP---LPKT.................................--EN.G.LMLQPEILAT.KA.Y.H...QRN.V..YIS..GFILY.S.MI........VIPIML.GLITKVTKLSTEIS--ty....................................................................
S3CDX9_GLAL2/1-140                     ..................................................MTLYY.SLVFV.LLV.AEMAL.FMLL.I........V.P.L...PF.TI........R....RRMF.T.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAETnk............................nagGTVV.M.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEEKVKA-y.....................................................................
D4B0C4_ARTBC/123-236                   ...................................yrqaealhlhiresh-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....-R..R......Q..A....A..V.WN..E..V........P..............Q..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELTGFda.............................anTGHA.I.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDILRLEDKVK--my....................................................................
A0A1Y1S623_9MICR/70-118                .............................................sitdn-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.-------KIL.EF.Q.S...QRN.M..YLS..GFVLF.L.AF........NLSRLV.KIIHVRFAVSKDY---kyv...................................................................
V9EFF2_PHYPR/1-126                     ..............................................mlln-----.QLMFW.LMI.SEAII.CLLL.S........L.P.F...GQ.WI........A....HAVI.T.............F..L..A.....KT..L......K..D....T..P.AN..T..V........A..............T..V.VLSI......I..SL.......LF..I................SDVM.T......VY.KHSSSDEVL.................................----.-.---GDGMRIR.LL.T.A...QRD.M..YIT..GFCLF.L.FL........LLRLVY.ITLATNLRLEKSL---gam...................................................................
F0UGD3_AJEC8/1-142                     ..................................................MTLYY.SLVFL.LLV.VEMVI.FVGL.I........I.P.L...PF.TV........K....KKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELSAYske..........................lggaGSAA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVKQ-l.....................................................................
A0A0V0QVK4_PSEPJ/4-142                 ...............................................fek-----.-IVYY.ATC.AQVIL.FVLM.T........I.P.Y...TR.PL........I....KFIF.S.............P..C..S.....NE..K......M..K....L..F.AS..W..S........S..............K..T.WIII......V..LG.......YL..I................HTLM.H......ME.NIDKQLQLLneq..........................eedqRIGN.L.TEIEMKNKLV.LF.K.D...QRN.V..YLT..GFYFI.S.LL........AISRFI.RYLFQYYDLEDQNKK-l.....................................................................
J3LGU4_ORYBR/137-263                   ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.GL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........-..............M..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCDD--.................................EHHC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.SLVVRLDQLQQRVDK-l.....................................................................
A0A099Z998_TINGU/1-135                 ..................................................MTFQW.TAVAT.FLY.GEIAV.ILLL.C........L.P.F...IS.PV........R...wQKIF.M.............F..P..L.....WS..K......L..A....V..F.WN..K..A........F..............L..T.IIVL......L..IV.......LF..F................DAVR.E......VK.KYSAVHVSE................................kAVNV.N.TSAFDHIQMK.LX.X.X...X--.X..XXX..XFSLF.L.WL........VLRRIV.TLLTQLAKGMTTQ---aal...................................................................
U3IK65_ANAPL/1-137                     ..................................................MTFQW.TAVAT.FLY.GEVVV.LLVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......I..A....V..F.WN..K..M........F..............L..T.IIVL......L..II.......LF..L................DAFR.E......VR.KYSAIQVTE................................kVANV.N.TNAIDHIHMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRTI.TLLTQLAKSMASHAA-l.....................................................................
F8WDG1_HUMAN/1-66                      ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................E---.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------f.....................................................................
Q6FIM4_CANGA/1-136                     ..................................................MSIYF.STLFV.ILT.VEMAI.LFVL.V........L.P.L...PH.RI........R....KMLY.K.............T..Y..F.....QL..T......S..N....A..Q.FK..T..V........L..............Y..I.FAGI......I..GL.......LF..I................DSWK.R......AN.IPVTLYHHA................................kSDDA.E.LNTSTQVLAT.RA.F.N...QRN.V..YIS..GFILY.F.LI........GIPTVL.SIVRRLVKYQDHLN--dk....................................................................
H2U7F4_TAKRU/1-128                     ..................................................MSLQW.MAVAT.FLY.VEVFF.VLLL.C........I.P.F...IS.PK........R...wNKIF.K.............S..R..I.....IQ..T......V..A....L..Y.GN..T..S........F..............M..V.VIAI......L..IF.......LL..I................DAFR.E......VR.KYSVTEKVD.................................-LTN.N.PTAIEHIHMK.LF.R.A...QRN.Q..YIA..GFALL.L.CL........L-----.----------------hmfktfrasqsskl........................................................
E7NLF6_YEASO/1-83                      ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.-MIF......V..GL.......LF..I................DSWK.R......SQ.IXVSTYRNQk...............................nPYII.N.SVTPVDALAS.RA.Y.N...QRN.V..YIS..GFIIY.F.YI........CILTVM.SILRRIVEWNDKMKA-g.....................................................................
B4LGI7_DROVI/1-134                     ..................................................MSLVW.TLIAT.FLY.AEIGV.VMLL.V........L.P.L...FS.PY........K...wNRFF.K.............S..K..F.....LS..M......L..A....Q..Q.AH..L..Y........F..............F..L.IMGV......L..VL.......FL..L................EAIR.E......MR.KYSNHENSG.................................--EV.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRRLV.TLISAQANLLAQSEA-s.....................................................................
A2X9C1_ORYSI/1-127                     ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.GL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........-..............M..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCDD--.................................EHHC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.SLVVRLDQLQQRVDK-l.....................................................................
A0A151I482_9HYME/1-135                 ..................................................MSLQW.TLIAG.FLY.IEVAI.VLLL.V........L.P.V...AS.PT........R...wQKFF.K.............S..R..F.....LQ..S......L..N....N..Q.AS..I..Y........F..............V..V.LLGV......L..VL.......FL..L................DAIR.E......MR.KYSTSLDHT.................................D-HH.Q.LNVEMQENMR.LF.R.A...QRN.F..YIS..GFALF.L.SL........VIRRLV.ILISTQASLLAQNEA-a.....................................................................
F8WB99_HUMAN/1-137                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A1U7T1U8_TARSY/1-136                 ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LVRRLV.TLISQQATLLASNEA-f.....................................................................
A5DK51_PICGU/1-142                     ..................................................MSLQM.SLIFA.ALC.GEMIT.LFSL.V........C.P.I...PH.PV........R....VRMM.H.............A..I..E.....VL..R......T..S....N..N.FK..I..G........V..............I..F.TTIL......L..GM.......QF..M................DCIN.R......LK.KFSELGNPYfgs..........................fsttNQQI.A.GSLTSGQLAS.KF.Y.A...QRN.L..YLT..GAVLY.L.EL........AIWVVV.GIVEKLVAKETQLR--vl....................................................................
A0A1S3JPA4_LINUN/1-137                 ..................................................MSFQW.TFIAT.FLY.VEIFL.VVLL.L........L.P.F...IS.PT........T...wQKLF.K.............S..R..F.....LM..I......I..T....S..Y.AN..Y..Y........F..............T..V.FIVI......L..MV.......VF..G................DSIR.E......VY.KYNISKESL................................dIKTS.Q.AATLEHVHMR.LF.R.A...QRN.F..YIA..GMSLF.L.LV........VLKRLV.VLISAAATLTAQR---dva...................................................................
Q59UQ1_CANAL/1-132                     ..................................................MSLQM.SLVFC.TLI.GQMIT.LLVL.V........L.P.L...PY.VV........R....QKIV.D.............L..T..F.....VL..Q......K..S....Q..N.FR..V..G........I..............V..F.SIIL......M..SL.......QL..L................DCIQ.R......LN.KYADAETNP.................................---H.F.PGIDYDRLAS.KF.Y.S...QRN.L..YLS..GAVLY.L.QV........AIGTVV.TIVRKMVLKEKLYR--ea....................................................................
A0A0U1M1A4_TALIS/53-195                ..................................................MTLYY.SLVFL.LLV.FEMVV.FMGL.I........V.P.L...PY.AV........K....RKLF.A.............F..I..S.....ES..P......L..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEMAAYskdt.........................tgvgRAAA.L.GAERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILDVLRLEDRVK--ll....................................................................
A3LSR2_PICST/1-141                     ..................................................MSIQM.SLVFA.TLI.GQMVV.LLLL.V........L.P.L...PH.PI........R....AKIV.D.............I..T..W.....VL..Q......K..S....Q..N.FK..V..G........V..............A..F.SIIL......L..VL.......QF..L................DCVN.R......LK.RISGYSDPFfvs...........................sndHRNP.T.QQLTYDQLAT.KF.Y.S...QRN.L..YLS..GAVLY.L.ML........AIGIVI.TIVRKLVKKESEYRS-l.....................................................................
A0A0F4ZCB2_9PEZI/1-148                 ..................................................MTLYY.SLVFF.LLM.FEVAV.FFML.V........V.P.M...PY.TF........K....KKLF.K.............Y..N..LpypirRS..P......L..V....A..K.AQ..Y..W........L..............K..I.TFVF......V..LI.......LF..A................DSVM.R......VY.RVQIELFAAteaa.........................aknaGAGI.L.GHERTEVQAR.KF.Y.A...QRN.M..YLC..GFTLL.L.SL........ILNRTY.SMILELIRLEEKVRT-l.....................................................................
H3FU88_PRIPA/1-93                      ..................................................MTIQW.TFVSG.ILY.GEIAL.TLIL.L........L.P.W...IR.PS........T...wSKLL.K.............S..R..V.....VS..A......I..S....A..F.GQ..V..Y........Y..............I..A.SVVI......L..FV.......LF..A................DALR.E......VR.KYSHVTLD-.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------gtaragedavsqer........................................................
M3X8G3_FELCA/1-137                     ..................................................MTLQW.VAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSSIPAIE................................kGLSS.K.PGAYEHAQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAI--------elsnkgvl..............................................................
BAP29_MOUSE/1-137                      ..................................................MTIQW.AAVAS.FLY.AEIGL.ILLF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..S..V.....WG..K......I..A....S..F.WN..K..A........F..............L..T.IIIL......L..II.......LF..L................DAVR.E......VR.KYSSTNVVE................................kNSAI.R.PSAFEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEI------ankgvl................................................................
A0A1X2IRA6_9FUNG/1-144                 ..................................................MTLYY.SLIFV.ILV.IEILL.FFVL.M........L.P.L...PI.KW........Q....KILI.H.............W..W..S.....TS..P......T..V....S..R.IK..Y..F........T..............K..I.SCVF......I..FI.......LL..L................DSIA.R......ID.IGKEAKNIMntde........................eesnvSAPP.S.HDMEATMFAR.KF.Y.A...QRN.I..YLC..GSTLF.L.DL........ILRRIF.FLLKEKIVLTDKI---fel...................................................................
Q6P890_XENTR/1-135                     ..................................................MSLQW.TAVAT.FLY.VEVFL.VLLL.C........I.P.F...IS.PT........R...wQKIF.K.............S..R..L.....VQ..L......L..V....T..Y.GN..T..F........F..............L..V.LIAI......L..VL.......LL..L................DAFR.E......IQ.KYGVGEQVD.................................-LKN.N.PVAVEHIHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.MLISKQATLLASNEA-f.....................................................................
A0A0V1CPH7_TRIBR/223-341               ..............................laasvsksfftfysdvfivi-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..H.....LL..F......C..V....N..V.AS..T..V........F..............G..L.LFTR......LneMM.......IL..L................DALR.E......VR.KYSDADLVK.................................QSVG.N.VQGEFNTHMR.LF.R.A...QRN.L..YIS..GAALF.L.WF........AIQRVA.SMISREAMLIASAEA-a.....................................................................
V9DZ90_PHYPR/1-135                     ............................................masmws-----.SFTYV.LLP.PAVVL.LLLM.T........I.P.F...PG.LM........L...nRGIV.K.............FgdF..V.....FN..I......R..I....G..T.LS..V..F........S..............V..I.TFIS......F..VV.......LV..A................QTYD.L......QK.RYSLPSDPH.................................-LEV.H.YSADLQKKAS.RW.R.S...ERN.W..WIS..ALTFT.I.YW........MLLRFH.AMKKKLLKAQH-----ed....................................................................
G8C1A3_TETPH/1-133                     ..................................................MGVYF.SLLFG.LLA.VEMCV.LFIM.S........L.P.L...GL.RV........R....KGLY.N.............Q..Y..E.....TL..L......W..N....S..T.FQ..T..V........A..............A..I.VAIL......V..GL.......LF..V................DSLN.K......SS.FPVSKNYEY.................................-GNN.G.GITPIQVLAS.RA.Y.N...QRN.V..YIS..GFILY.F.GF........CIVTIM.SLVGRLVKY-------galvdg................................................................
A0A0A2L790_PENIT/1-142                 ..................................................MTLYY.SLVFL.ILV.FEMAV.FLAL.V........I.P.L...PH.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELSSFakd..........................spgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRVR--ll....................................................................
G3UD72_LOXAF/1-136                     ..................................................MSLQW.VAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAGR.E......IW.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A1U8HUH1_GOSHI/1-126                 ..................................................MALQW.MILTY.VVA.AEAAL.ALLL.T........F.P.S...PK.LL........K....NRFV.S.............L..-..-.....--..-......I..S....L..I.LQ..P..T........L..............-..F.IIPF......A..GF.......QL..L................DIYW.K......NE.HRLMCTSE-.................................--IC.T.AAERDRYEKS.VF.K.A...QRN.V..ILC..TTACL.L.YW........CIYRIC.KYHKEIQSLEE-----vekry.................................................................
A0A067PMF0_9HOMO/1-138                 ..................................................MTIYY.SLTFM.LLA.SEMVT.FCIL.V........A.P.M...PY.AA........K....KRLF.R.............F..L..S.....EN..P......I..V....A..K.IA..Y..G........L..............K..I.SFIF......V..GI.......LF..L................DALQ.R......MF.RVTAESDLAk..............................hgGQAQ.D.VRTETNFAAR.KF.Y.S...QRN.V..YLT..GFTLF.L.SL........VLTRTF.YIILDLIHTQEEYAK-i.....................................................................
A0A1V6TE50_9EURO/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMAV.FLAL.I........V.P.L...PF.TV........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VF.RVQQELAAFskd..........................gagvGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEDRVK--ll....................................................................
A0A1E5RY24_9ASCO/1-139                 ..................................................-----.-----.---.--MVL.FLAL.I........I.P.L...PS.KV........Tp.ikKHFV.R.............S.lN..Y.....IA..Y......T..N....E..T.TK..I..V........S..............R..S.IFVF......I..FL.......MF..V................DSIK.K......LQ.NISLTSNTYrnnelfs..................kslnneytGSQI.E.ALNKNEYYRE.KF.F.A...QRN.M..YLT..GFTLF.L.CF........LILRTI.HITNELLDS-------laikkqh...............................................................
A0A163EC60_PHYB8/1-134                 ..................................................MPIYY.SLTFG.ILL.TEMIA.FGIL.V........T.P.L...PT.RW........R....RAMM.K.............F..A..S.....TS..P......V..I....A..N.GL..Y..G........L..............K..I.VFAF......I..FV.......LF..L................DTLN.R......LH.RIESEVSDE.................................-HKH.D.YNYEANLKAK.RF.Y.A...QRN.I..YLT..GFTLF.L.SL........ILERTS.KLVLDMLKREEELDN-a.....................................................................
J7S1J6_KAZNA/1-143                     ..................................................MSLYF.ALLFT.VLS.VEIGV.LFLL.V........C.P.L...PL.RV........R....KLLY.R.............G..C..Q.....SC..L......A..K....Q..E.FR..V..V........A..............S..I.IGVI......V..GL.......LF..V................DSFK.R......AN.VPVNLPRHSqqrv.........................geppVGGY.D.PITSIQALAS.RS.Y.N...QRN.A..YIS..GFILY.F.AV........GIMTVM.SVVRRVIKYQELI---nkg...................................................................
A0A1Q8RJ95_9PEZI/1-141                 ..................................................MTLYY.TLVFM.LLM.AEMAL.FMLL.I........V.P.L...PF.AV........K....RKLF.T.............F..I..S.....ES..P......V..V....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELALAtek...........................qnsGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRS-y.....................................................................
A0A1E4RCY5_9ASCO/1-139                 ..................................................MSLQM.SLVFG.ALI.GQMGI.LVLL.L........L.P.L...PL.SV........R....TKIV.E.............I..Y..D.....LL..G......N..S....T..N.VK..V..G........I..............V..F.SVSL......L..GL.......SF..I................DCVQ.R......LG.RYGFNSPYFtn.............................fnAVAS.Q.GNLTYDQLAT.KF.Y.T...QRN.L..YLN..GAVLY.L.TL........SIYTMI.TIIKKLVKKEIEYRN-l.....................................................................
A0A182RLQ5_ANOFN/1-135                 ..................................................MTLVW.GIIAS.FLY.VEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHTH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
A0A0M3K7F9_ANISI/1-132                 ..................................................MTLQW.TAIAL.ILY.AEIFI.VLAL.L........L.P.W...IR.PS........R....SRLM.K.............-..-..-.....--..M......F..E....K..Y.TN..V..Y........S..............V..A.AIAV......L..LL.......LF..F................DAIR.E......VR.KYSSEIRLDs...............................hSSYV.T.ADSGNVLHMR.LF.R.A...QRN.L..YIC..GFALL.L.FL........VIKRLV.ALLSRGAQLEAAAEA-a.....................................................................
A0A099P4N5_PICKU/1-132                 ..................................................MSIQM.SLVFA.LTT.LEMVI.VGLL.L........L.P.L...PP.KL........Q....TVLI.S.............N..Y..D.....KL..I......S..N....P..N.IS..I..I........L..............S..F.IDVL......I..GI.......MF..V................DAFK.N......GF.GMIGKEDEV.................................I--E.Y.SKNLWETRSR.KF.Y.S...QRN.M..YIL..GAVLS.F.QV........CIWFIM.MLLKSTVKHND-----llsg..................................................................
B0X4Z1_CULQU/1-134                     ..................................................MSLVW.SLIAS.FLY.VEIFI.VLML.V........L.P.V...AS.PQ........R...wQRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLFV......L..VL.......FL..L................EAIR.E......MR.KYSHNEPTA.................................E--Q.H.LNVGMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.CM........VIRRLV.SLITTQAQLLAQSEA-s.....................................................................
A0A086T844_ACRC1/1-142                 ..................................................MTLYY.TLVFV.LLM.VEMTL.FMLL.I........V.P.L...PF.SL........K....RKIF.T.............F..I..S.....EN..P......I..V....A..K.VQ..Y..W........M..............K..I.CFVF......I..LI.......LF..I................DSVN.R......VY.RVQIDLAMAtes..........................ankgSAGV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDRLKS-y.....................................................................
Q22R59_TETTS/4-139                     ..............................................itln-----.QVIFF.VAL.LELAV.SVLF.I........I.P.L...PK.GW........K....PGLL.R.............F..V..E.....ES..P......T..M....K..K.IM..E..Y........H..............K..F.IIAI......V..AL.......QW..M................YSIK.I......AA.DYQEQHLIEr..............................etHFNA.I.NQRDLHILEK.KF.A.A...EGD.I..YLN..GTLLF.V.SV........FINRLF.ALLQYYYQIKQ-----msei..................................................................
H0Y7N8_HUMAN/1-51                      ................................................xd-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.--AYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A232FFH5_9HYME/1-136                 ..................................................MSLQW.TLIAT.FLY.AEIAV.VLLL.V........L.P.I...AS.PQ........R...wQRFF.K.............S..R..F.....LQ..S......L..S....A..Q.AS..M..Y........F..............L..V.LLAI......L..VL.......FL..L................DAIR.E......IR.KYSSHEVTE.................................HAHS.H.LDTEMQGNMR.LF.R.A...QRN.F..YIS..GFALF.L.SL........VIRRLV.TLISAQATLIAQSEA-s.....................................................................
A5DBS2_PICGU/1-142                     ..................................................MALYY.NLVFG.LLV.IEMSF.FTVL.S........L.P.Y...PR.KV........R....KSVL.S.............T..V..S.....AP..F......R..N....E..Q.FQ..V..A........I..............K..C.ILGF......V..LV.......LF..I................DSVN.K......VW.TVTTELHATspg..........................ghtgSVTG.V.INDRSDVQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.TL........ILTRTY.SLVTELIDTKDKLD--ga....................................................................
A0A1C7N478_9FUNG/1-136                 ..................................................MAIYY.ALTFG.ILV.TEMIL.FGLL.V........L.P.L...PS.RW........R....HLSL.K.............F..I..S.....TS..P......A..M....A..K.AM..Y..V........L..............K..I.VFGF......I..FV.......LF..I................DTIS.R......LQ.RIDSEMEHD................................qQQHH.D.YSYETSIKAK.RF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.ALVLELLQREEDLKK-a.....................................................................
E7KEX4_YEASA/1-126                     ..................................................-----.-----.---.--MVM.LFIF.V........L.P.L...PF.RI........R....RGIF.S.............T..Y..N.....QL..T......A..K....Q..Q.IK..T..I........I..............F..I.TGCL......V..GL.......LF..I................DSWK.R......SQiRVSLYHNDNs...............................gSIGS.S.AVTPIQALAS.RA.Y.N...QRN.M..YIS..GFILY.F.SI........CIPTVM.SIVKRLVKYQG-----lineqekq..............................................................
A0A2G3CXI7_CAPCH/1-126                 ..................................................MALQW.MILTY.VVA.AEAAV.AILL.T........L.P.Y...PK.AL........K....NRFV.S.............L..I..S.....LT..L......Q..P....S..-.--..-..-........-..............L..F.IIPF......A..GF.......QL..L................DIYW.K......NE.HRL---MCT.................................GEIC.T.AAERDRYERS.IY.K.A...QRN.A..ILC..VAACL.L.YW........CIYRVC.KYYKEIQSTEEV----ekrl..................................................................
A0A2H3EN64_9HELO/1-40                  ..................................................MTLYY.SLVFL.LLV.AEMTL.FMLL.I........V.P.L...PF.TI........R....RKMF.T.............F..I..V.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------n.....................................................................
A0A0L0DUF5_THETB/1-131                 ..................................................MSIIL.AGVYY.TLI.VQALI.CAVL.L........V.P.L...FV.SW........K....HTLI.S.............K..-..L.....VT..L......S..G....A..R.GQ..L..A........Y..............Y..A.LLVF......V..AL.......VF..A................DSFR.T......AT.TIADEREHG.................................D---.A.HANSKANQIR.YF.R.A...QRN.M..YLT..LMLLV.L.SA........VNKGLF.SLNYKLKSAREEIKA-l.....................................................................
A0A1I8M2V4_MUSDO/1-134                 ..................................................MSLVW.TLIAG.FLY.AEIAV.VLLL.V........L.P.V...AS.PY........K...wNRFF.K.............S..K..F.....LA..M......L..A....R..Q.AH..L..Y........F..............F..L.IMGV......L..VL.......FL..L................DAIR.E......MR.KYSHHDHSS.................................D--V.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRRLV.TLISTQANLLAQSEA-s.....................................................................
T0Q9N5_9STRA/1-132                     ..................................................MSMWA.TWTYV.LLP.PAVVL.LMLL.T........I.P.F...PR.MI........A....KGVV.R.............F..V..D.....ML..F......K..I....E..L.AG..I..P........V..............V..S.VITF......L..A-.......-F..V................SLAG.Q......TY.DLQKRYTHPv...............................eGLEK.H.YSADLQQKAS.RW.R.S...ERN.W..WIS..ALTFT.I.YW........MLIRFQ.AMKKQLLAAQ------rrd...................................................................
C3YAE4_BRAFL/1-139                     ..................................................MTIQW.TIVAT.FLY.AEIGV.CVLL.C........I.P.F...IS.AR........R...wQKIF.K.............S..A..L.....LN..W......F..V....Q..H.GN..L..Y........F..............N..V.LIAI......L..LL.......LF..G................DAIR.E......MF.KYGSSPKVAg..............................gqDASF.Y.PQAEINLHMK.LF.R.A...QRN.F..YIA..GFALF.L.FV........ILRRLV.TVISNTATLEAKSEA-f.....................................................................
A0A1B0ARI9_9MUSC/1-135                 ..................................................MGLLW.TLIIG.FLY.AEIAA.VICL.V........F.P.I...GS.PR........K...wDRFF.K.............S..K..F.....LS..R......L..S....K..K.AQ..A..Y........F..............I..I.VMSV......L..LL.......LL..V................DAFL.E......MR.KYSNEEYRN.................................-VDL.R.LNSKMHQNTR.LF.R.A...QRN.F..YVS..GFAIF.L.MM........VIRRLV.TLISIQASLL------idvdsl................................................................
A0A1M2V513_TRAPU/1-130                 ..................................................-----.----M.LLA.SEMVT.FCVL.V........A.P.L...PH.VV........R....KKLF.H.............F..L..S.....ES..P......I..I....A..K.LA..Y..G........V..............K..I.AFIF......I..AI.......LF..V................DAVQ.R......MM.RVTAEADLAks.............................ngAGAG.D.IRTETNVAAR.KF.Y.A...QRN.T..YLT..GFCLF.L.SL........VLTRTF.YILLDLVHTQEEYAK-l.....................................................................
M7YJS9_TRIUA/1-127                     ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.AL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........M..............S..-.VVPF......C..LF.......LL..M................DIYW.K......YE.MRPTCDDE-.................................-HAC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.SLVVKLDHLQQRVDK-l.....................................................................
A8XI37_CAEBR/1-134                     ..................................................MTLQW.TIVAG.VLY.AEIAA.TFIL.L........L.P.W...VR.PT........L...wSKLF.K.............S..R..L.....FT..A......L..S....K..H.AH..I..Y........S..............M..T.FGFV......L..FI.......LF..A................DGVR.E......TM.KYNELEDKM.................................--HR.T.AEADATYHMR.LF.R.A...QRN.L..YIS..GFSLL.L.WM........VIQRIM.TLLSRAAQLEAAGEA-a.....................................................................
A0A0G2H1Z0_9EURO/1-141                 ..................................................MTLYY.SLVFV.LLV.AEMVI.FMGL.I........L.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.LQ..Y..A........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVEVEVASYsek...........................ygaGAAS.L.GSDRMEVQAR.KF.Y.S...QRN.L..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEKLK--my....................................................................
H2U7F6_TAKRU/1-135                     ..................................................MSLQW.MAVAT.FLY.VEVFF.VLLL.C........I.P.F...IS.PK........R...wNKIF.K.............S..R..I.....IQ..T......V..A....L..Y.GN..T..S........F..............M..V.VIAI......L..IF.......LL..I................DAFR.E......VR.KYSVTEKVD.................................-LTN.N.PTAIEHIHMK.LF.R.A...QRN.Q..YIA..GFALL.L.CL........VAAVVA.AVVAAEVVV-------avvvaav...............................................................
A0A151GC38_9HYPO/1-168                 ..................................................MTLYY.TLVFF.LLM.MEMAM.FMLL.I........L.P.M...PF.TI........K....RKIF.T.............F..I..S.....EN..P......I..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..V................DSVN.R......VY.RVQLELLAAteqtskgayvtqtpphpplpsqpstfvdrptlgSATV.L.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDRLR--vy....................................................................
A0A1F5LPR1_9EURO/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMAV.FLAL.V........V.P.L...PH.TI........K....RKLF.A.............F..V..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELSAFtkd..........................gpavGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDRVR--ll....................................................................
A0A2K1Y8P9_POPTR/1-130                 ..................................................MALQW.MILTY.LVA.AEAVI.AVLL.T........L.P.S...PK.--........-....--LL.K.............Y..R..L.....VS..L......I..S....L..V.LQ..P..A........L..............F..-.VVPF......A..GF.......QL..L................DIYW.K......ME.HRLMCTGET................................cTAAE.R.DRYEKSSAVQ.IY.K.A...QRN.V..ILC..ISACL.L.YW........CVYRVC.KFYKEIQSLEEV----ekry..................................................................
A0A0D3ACR9_BRAOL/1-126                 ..................................................MALQW.LILSY.VVA.AEVAI.AVIL.T........L.P.Y...PM.LL........K....KRIV.S.............L..V..S.....LV..L......Q..P....A..A.--..-..-........-..............-..S.IVAF......A..GF.......QL..L................DIYW.-......--.KNEHRLECS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AAGIL.L.YW........CIYRIC.KYNKDLDHLEE-----lekry.................................................................
C5GK62_AJEDR/1-144                     ..................................................MTLYY.SLVFL.LLV.VEMVI.FVGL.I........I.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQTELSTHskem........................ggagrRTAA.L.GAERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVKQ-l.....................................................................
G1TH64_RABIT/1-138                     ..................................................MTIQW.VAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..S..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF.lV................DAVR.E......VR.KYSSAHAVE................................kGSTV.K.PGGFEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A061IZU7_TRYRA/2-134                 ...........................................lslftle-----.--VTY.LIM.PATVL.FILF.I........L.P.V...PR.LS........R....---Y.V.............S..C..V.....VS..F......V..E....R..P.NF..Y..G........V..............S..L.LLLV......A..LV.......TF..V................SCAT.Q......FV.EWRKKYGQG................................kPRFA.D.LSLEVDWEAK.KW.R.H...ERN.M..YIH..ALATV.L.CA........AIMKFT.RLHTALERRKA-----aatef.................................................................
N1PVB2_DOTSN/1-141                     ..................................................MTLYY.SLVFA.LLV.FEMVV.FMSL.I........V.P.L...PF.KI........K....RGLF.T.............F..I..S.....EN..P......L..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELSQAkyq...........................ggaAAAV.A.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.ILILDTLRLEEELKA-y.....................................................................
A0A024GM54_9STRA/1-126                 ................................................ml--LNY.VL-LA.ILG.AEALI.SILL.S........I.P.Y...GN.RL........A....QHSV.Q.............F..V..S.....YQ..V......R..N....N..YsVA..V..F........A..............N..V.VLAL......I..AI.......LC..L................SNLN.T......CW.SYRQETVLS.................................----.-.----DGLRIR.HL.T.A...QRD.L..CIT..GFTLF.L.ML........LLRLVY.NLIEINLELEEKVN--ag....................................................................
A0A1D1UUN3_RAMVA/1-138                 ..................................................MSLQW.TVIAA.ILY.AEIAF.TVLM.L........M.P.F...IS.PT........T...wNKFF.N.............S..R..L.....VL..L......-..I....K..K.YK..Y..I........Q..............H..I.LVGV......M..GL.......LL..L................DAVR.D......VS.RYTKSFVDMs..............................dvGGAQ.A.PAAEVQFHMK.LF.R.A...QRN.F..YIA..GFALF.M.FF........IIKSLA.GKLA------------yeaqliisnsav..........................................................
A0A200QL82_9MAGN/1-126                 ..................................................MALEW.VVLGY.AAG.AEVIM.LLLL.T........L.P.G...LD.RL........R....KGLI.T.............V..T..-.....--..-......-..-....R..N.LL..K..P........F..............L..S.IVPF......C..LF.......LL..M................DIY-.-......-W.KYETRPSCE.................................EQSC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALV.F.YW........LLYSVT.NLVVRLEQLNQRVEK-l.....................................................................
A0A061FW21_THECC/1-126                 ..................................................MALQW.MILTY.VVA.AEAAV.ALLL.T........L.P.Y...PK.LL........K....NRLV.S.............L..I..S.....L-..-......-..-....-..I.LQ..P..A........L..............-..F.IVPF......A..GF.......QL..L................DIYW.K......NE.HRLMCTSE-.................................--IC.T.AAERDRYEKS.VF.K.A...QRN.V..ILC..ATACL.L.YW........CIYRIC.KYNKEIQSLEE-----vekry.................................................................
A0A162KDW0_9HYPO/1-143                 ..................................................MTLYY.TLVFA.LLM.FEMAL.FMFL.I........V.P.L...PH.NA........R....RTIL.T.............F..I..S.....EN..K......T..V....G..Q.IQ..H..G........L..............K..I.TFIF......I..LV.......LF..I................DSVN.R......VY.RVQMELSDTmeka.........................arsgGTVV.L.GHERTEVQAR.KF.Y.A...QRN.M..YLC..GFTLF.L.SL........ILNRTY.AMIKDIVRLEERLRA-y.....................................................................
A0A0R3W8C7_TAEAS/7-145                 ..................................................MSLFW.TITAV.CLY.TEAGV.ITLL.L........M.P.F...IS.SK........I...wNSVF.K.............S..R..I.....VS..R......L..S....S..Y.AS..F..Y........F..............N..G.CLVI......L..GM.......MV..F................EAVR.Q......VR.YQNHVYQELk..............................sdPSIY.K.PETESVYLMK.LF.R.A...QRN.L..YIS..GFCLY.L.WF........VFKRLV.TLIADHARVTAAGE--as....................................................................
A0A167ND04_9BASI/1-137                 ..................................................MTLYY.SMCFV.LLT.GEMVF.FLLL.I........A.P.L...PF.AA........R....RKFF.T.............F..L..S.....ES..P......I..V....G..K.VA..Y..A........L..............K..I.MFIF......V..AI.......LF..V................DAVQ.R......MF.RTTAEADMAk...............................aGQGG.D.VRAETNFAAK.KF.Y.A...QRN.M..YLT..GFTLF.L.SL........ILTRTY.YIILDLIHTQEEYAK-l.....................................................................
A0A081CBF7_PSEA2/1-138                 ..................................................MTLYY.SIVFA.LLC.FEMSM.FMVL.I........V.P.L...PF.TW........R....RKLF.H.............F..L..A.....TN..P......V..V....A..K.IQ..Y..G........L..............K..I.TFIF......V..AI.......LF..V................DAVQ.R......MV.KVMSEGETAr..............................dnRGVQ.D.VRTETNYAAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILSRTY.SLILDLINTQEELV--al....................................................................
M1D7G5_SOLTU/1-126                     ..................................................MALQW.MILTY.VVA.AEAAI.AILL.T........L.P.S...PK.AI........K....SRFV.S.............L..I..S.....LT..L......Q..P....S..-.--..-..-........-..............L..F.IIPF......A..GF.......QL..L................DIYW.K......NE.HRL---MCT.................................GEIC.T.AAERDRYERS.IY.K.A...QRN.A..ILC..VAACL.L.YW........CIYRVC.KYYKEIQSVEE-----vekrl.................................................................
M7PKA1_PNEMU/1-136                     ..................................................MTLYY.SLVFT.LLV.IQMVL.FCFL.I........L.P.L...PK.RL........K....RRLF.T.............F..I..S.....TS..W......F..I....A..K.IR..Y..I........S..............K..I.IFIF......I..LV.......LF..F................DSVN.R......VF.RTVEEAKLG................................tSGSL.R.DAYRSDIQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........IIDRVY.ALTLQVLKYEELV---nti...................................................................
T1KL93_TETUR/1-136                     ..................................................MSLQW.TLVAT.FLY.IEIAI.VIIL.L........L.P.I...IS.PR........K...wQSFF.K.............S..R..F.....LQ..S......I..E....R..Q.SN..L..Y........F..............T..G.FLLI......L..VL.......LF..L................DSIR.E......MR.RYSVGREHD.................................EHAG.H.LNTELAHSMK.LF.R.A...QRN.F..YIA..GFALF.L.CL........VIRRIA.SLLSQTAQLKNQLEA-v.....................................................................
A0A1Y3ASI4_EURMA/3-55                  ..............................................vgss-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.--AFYEDQMR.VF.R.G...QRN.F..YIS..GFALL.C.VF........IIKRLI.RLFGEMAQLKAESEA-s.....................................................................
A9UY83_MONBE/1-122                     .................................................m---LW.FAVHV.LLW.LELAL.CLLC.C........I.P.G...AR.-W........R....RAI-.R.............W..F..I.....DL..P......F..V....H..V.TT..K..G........L..............P..Y.LVVI......L..MA.......LL..V................QSIYiQ......VN.ARQHGEEAR.................................VMAG.Q.STTITLYEAN.MY.R.A...QRN.T..YMA..AIALL.G.ML........MLREII.QCV-------------tpp...................................................................
I2JVF0_DEKBR/1-154                     ..................................................MALQY.TLVFS.LLM.VEMAL.FAII.S........L.P.L...PP.KV........R....KPLL.N.............S..I..N.....IP..F......H..S....E..K.FQ..I..F........F..............K..C.VIGF......I..GV.......LF..V................DSLH.R......MN.KVTNELYNMdnggfvpeh..............sgmxpppqgnPGIA.S.GSTRAEIQSR.RF.Y.A...QRN.V..YLC..GLTLF.F.SL........VVKRTY.DLVYDLLNVKEELA--rq....................................................................
A0A1E5RXW4_HANUV/1-131                 ..................................................MAVYL.TILFG.LLV.LQLTS.LLIL.S........L.P.L...PT.LL........R....RALV.K.............I..Y.dQ.....FL..F......K..S....S..Q.VK..T..I........L..............I..V.VNIL......V..VS.......LF..V................DSYK.R......AS.VP---LPKT.................................--EN.G.LMLQPEILAT.KA.Y.H...QRN.V..YIS..GFILY.S.MI........VIPIML.GLITKVTKLSTEIS--ty....................................................................
A0A0E0KB36_ORYPU/1-59                  ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....M-..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------llqpfagilpfaafqlldi...................................................
E9EMH1_METRA/1-141                     ..................................................MTLYY.SLVFF.LLV.LEMVL.FMLL.L........I.P.L...PH.TA........K....RKVF.T.............F..I..S.....EN..P......I..I....S..K.VM..Y..W........L..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLEVVAAgeq...........................askGAAI.L.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIIDNIKLEDKVQA-f.....................................................................
W2PPB3_PHYPN/1-135                     ............................................masmws-----.SFTYV.LLP.PAVVL.LLLM.T........I.P.F...PG.LM........L...nRGIV.K.............FgdF..V.....FN..I......R..I....G..T.LS..V..F........S..............V..I.TFIS......F..VV.......LV..A................QTYD.L......QK.RYSLPSDPH.................................-LEV.H.YSADLQKKAS.RW.R.S...ERN.W..WIS..ALTFT.I.YW........MLLRFH.AMKKKLLKAQH-----ed....................................................................
G0WAD6_NAUDC/75-216                    ..................................................MSLYY.SLVFA.ILV.TEIIL.FAIL.A........L.P.I...PS.KF........R....KPLT.L.............I..L..L.....KP..F......K..I....P..P.IQ..I..A........L..............K..C.ILSF......I..LL.......LF..I................DSIN.K......VI.NINKELSTTssn..........................snptPAIS.S.SNDRIEILSR.KF.F.A...QRN.M..YLT..GITLF.L.TF........IVMRTF.TLVNELLDLKDRY---rii...................................................................
L0PAQ5_PNEJ8/1-139                     .................................................m-----.-LVFS.LLV.IQMAL.FCLL.V........M.P.L...PK.RL........R....RRMF.S.............F..I..S.....TS..T......I..I....A..K.IR..Y..GskvladvlI..............K..I.TFIF......I..LV.......LF..F................DSVN.R......VF.RAADDAKPG................................aGGAL.R.DVYRSDIQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........IIDRVY.GLTLQVFKYEDMVN--am....................................................................
A0A091UXX8_NIPNI/1-107                 ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSAVHVNE................................kAANI.N.TNAFDHIQMK.LF.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTI.TLLTQLAKGMASHAA-l.....................................................................
A0A1B0A7G7_GLOPL/1-133                 ..................................................MDLAL.TLIAG.FSY.AEVCM.VLLL.V........L.P.V...AS.PH........K...wNRFF.K.............S..K..F.....LA..M......V..A....R..R.AY..L..C........F..............F..F.ASVV......L..VL.......FL..L................ETIR.E......MR.KYSNQEQSA.................................D--V.R.LNTEMQRRMR.-F.K.A...QRS.L..CIS..GFPIF.L.AL........VIRRLV.TLISAQANLLDQNEA-t.....................................................................
M3W1G2_FELCA/118-253                   ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....M..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A0F9WFT3_9MICR/76-118                ..............................................dvvy-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.H.T...ERN.V..YLT..GFTLY.L.SL........ILKIFV.NMLNTLYKEEEAVN--vl....................................................................
A0A0M9WK28_9EURO/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMAV.FLAL.V........I.P.L...PH.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELSSFtkd..........................gpgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRV---rif...................................................................
C9JSP1_HUMAN/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......L..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A0P1ACX2_9STRA/1-135                 ..................................................MTSMWsSFTYV.LLP.PAVVL.LLLM.T........I.P.F...PG.RM........L...nRGIV.M.............LgdL..I.....FN..I......R..I....G..T.LS..I..F........S..............V..I.TFVS......F..VV.......LG..A................QTYD.L......QK.RYSLTSDPH.................................-IEA.H.YSADLQKKAS.RW.R.S...ERN.W..WIS..ALTFT.I.YW........MLLRFH.AMKKKLLM--------vqlhe.................................................................
A0A182KCE0_9DIPT/1-135                 ..................................................MTLVW.GIIAS.FLY.LEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHTH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAMLLAQAEA-s.....................................................................
A0A1Z5TRZ6_HORWE/1-141                 ..................................................MTLYY.SLVFG.LLM.FEMSV.FMAL.I........V.P.L...PF.DW........K....RKLF.E.............F..I..S.....HS..P......I..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQMELSMSknq...........................ggaAAAV.A.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TLILDTLRLESEVKS-l.....................................................................
D0NXN6_PHYIT/1-135                     ............................................masmws-----.SFTYV.LLP.PAVVL.LLLM.T........I.P.F...PG.LM........L...nRGIV.K.............FgdV..V.....FN..I......R..I....G..T.LS..V..F........S..............V..I.TFVS......F..VV.......LV..A................QTYD.L......QK.RYSLPSDPH.................................-IEA.H.YSADLQKKAT.RW.R.S...ERN.W..WIS..ALTFT.I.YW........MLLRFH.AMKKKLLKAQH-----ed....................................................................
A0A2D0T5P8_ICTPU/1-136                 ..................................................MTLQW.TAVAL.FLY.IEIGI.LLLL.C........L.P.F...IS.AQ........R...wQMIF.S.............L..N..I.....WN..R......V..A....W..V.WK..R..G........F..............L..A.MIII......L..IV.......LF..L................DAVR.E......VR.KYSGAQINK.................................ESKM.Y.PNMIDHVHMK.LF.R.S...QRN.L..YIS..GFALL.L.WL........VMQRVI.QLINQLAAAVNTNS--al....................................................................
I3JPB8_ORENI/1-136                     ..................................................MTLQW.TVVAF.FLY.AEITV.NLIL.C........V.P.L...IS.AQ........R...wRLIF.S.............W..R..I.....WS..W......L..S....P..Y.WN..K..C........F..............F..T.IIMV......L..IV.......LF..L................DALR.E......VQ.KYSGPEPMQ.................................DAKV.N.PNVYDHVHMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........IMRRVA.SLLNQVAVTMEDS---agl...................................................................
A0A1E3QZF3_9ASCO/1-140                 ..................................................MALYY.NIVFS.ILV.TEMAM.FGLL.S........L.P.L...PR.NI........R....GTLL.S.............V..L..S.....KP..F......Q..S....A..Q.FQ..I..A........I..............K..C.ILAF......I..LI.......LF..V................DSVN.R......VY.KVSAELQAPtn............................hpeAAMQ.G.FIDRSDVQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.TL........ILTRTY.ALVDELVVVKTKLAA-l.....................................................................
G3QS23_GORGO/68-203                    ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......L..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
M5EAS3_MALS4/1-146                     ..................................................MTLYY.SIVFA.LLL.LEMAM.FMVL.IvralysrqV.P.L...PF.SA........R....RKLF.R.............F..L..A.....TS..Q......I..V....A..K.IN..Y..C........V..............R..I.TFIF......V..AV.......LF..I................DAFQ.R......MM.KIKAESAVTe..............................thQGFQ.D.FRTETNYHAK.KF.Y.A...QRN.V..YLT..GFTLF.L.SL........ILARTH.SLVLDLINAQEELA--an....................................................................
W4XKT2_STRPU/86-169                    ...................ylnvkkslclkrsthvlkgsasvqyteiefd-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..-L.......VL..Q................YSVR.E......VS.KYTDAKDEL.................................D-VA.I.PNAEAILNMK.LF.R.A...QRN.F..YVA..GFAFF.L.FM........------.----------------......................................................................
A0A218XE16_PUNGR/1-126                 ..................................................MALQW.MLLTY.AVA.AEAVV.AILL.T........L.P.S...PK.LL........K....YRIV.S.............F..V..S.....L-..-......-..-....-..I.LQ..S..A........L..............-..F.VVPF......A..GF.......QL..L................DLYW.K......NE.HRLMCTS--.................................-EVC.T.AAERDRYEKS.IY.K.A...QRN.V..ILC..ASACL.L.YW........CIYRIC.KFYKKIQSLEEAE---krm...................................................................
K1VBV4_TRIAC/128-162                   .................................................p-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.V..YLT..GTTLF.L.SL........VLSRVF.YILLDFIQTQEELT--tl....................................................................
A0A1B7TCN3_9ASCO/1-131                 ..................................................MAIYL.SILFV.LLV.AQMGV.LLIL.S........L.P.L...PT.LL........R....NVIV.K.............V..Y.dN.....FL..T......K..S....S..Q.IK..T..V........L..............V..V.LNCI......V..LS.......LF..V................DSYK.R......S-.NVKLPLSDT.................................----.G.LPLDPKLLVT.KA.Y.H...QRN.V..YIS..GFILY.Y.MI........CIPFMI.RLISKVAKVSSSER--ka....................................................................
A7TGE5_VANPO/1-142                     ..................................................MSLYN.QLVFI.ILI.VEIVS.FTIL.S........L.P.L...PS.KY........R....KPLT.L.............L..L..I.....KP..F......Q..N....E..K.IQ..T..A........I..............K..C.IIAF......I..LI.......LF..I................DSIN.K......VY.RIDNELKFNklk..........................gtngGGLV.N.SSDRVEIYSR.KF.L.A...QRN.M..YLT..GITLF.L.TF........TVVRTF.NLVTELLKLKESYR--se....................................................................
A0A1E3PIZ8_9ASCO/1-137                 ................................................mm---LY.PIVFV.ILM.MEIVS.FFVL.L........V.P.L...PL.GI........R....HKAL.A.............L..L..Ad...qTS..E......L..Y....Q..Q.VK..L..G........M..............K..F.VLGF......V..AL.......LF..V................DGVR.R......VY.NSTANFNRL.................................KISGgV.SINLNDLRAT.KF.Y.S...QRN.M..YLC..GFTLF.L.AI........ILVQVY.NIILESLNLKAEIR--ss....................................................................
A0A238FH43_9BASI/1-130                 ...............................maipnhivfglllfesqsl-----.-----.---.-----.----.-........-.-.-...-V.SW........R....RALF.K.............A..I..A.....ES..Q......L..V....A..K.AQ..Y..A........L..............K..I.TFIF......V..FL.......LF..V................DAVN.H......ML.KIQREGVLNk..............................qlGQRS.D.LRGESDYRSR.KF.L.S...ERN.F..YLH..GFTLF.L.SL........ILSRTY.SLVLDLIKAQEDL---all...................................................................
A0A1E3PB69_WICAO/1-146                 ..................................................MALYY.NLVFG.LLV.IEMVL.FAIL.S........L.P.L...PS.KI........R....KPIL.T.............A..I..S.....KP..F......E..K....T..E.FN..I..A........I..............K..C.ILVF......I..FI.......LF..I................DSVN.R......VN.SVNEELTGFstken......................lnpvqqTSFN.P.TADRSEIQAR.RF.Y.A...QRN.M..YLT..GFTLF.L.TL........IVTRTY.RLVAELLNLKETYR--sd....................................................................
Q757E4_ASHGO/1-134                     ..................................................MSLYY.SLVFA.MLV.CESAV.FALL.A........V.P.L...PM.AV........R....RPLT.R.............A..L..A.....RP..F......E..S....A..T.VQ..M..V........L..............K..V.LLGF......V..LL.......LF..V................DTTN.R......LY.VVNREYERA.................................RHVE.F.AHGRRELLSR.KF.L.A...QRN.M..YLT..GITLF.L.TF........MLGQTF.NLVLELLALKGA----ter...................................................................
H9JK13_BOMMO/1-134                     ..................................................MSLQW.TIIAT.FLY.TEIAV.VLLL.T........L.P.I...AS.PS........R...wQKFF.K.............S..K..F.....LA..Y......I..S....G..Q.AS..I..Y........F..............L..I.LIGV......L..VL.......CL..L................DAIR.E......MQ.KYSNIEPSD.................................--HQ.H.LDAEMQGNMR.LF.R.A...QRN.F..YIS..GFALF.L.LV........VIRRLV.QMISQLATLLAQSEA-n.....................................................................
A0A1L9TWW1_9EURO/1-127                 ..................................................-----.-----.---.--MGV.FMGL.I........V.P.L...PF.AV........R....RKLF.T.............F..V..S.....ES..P......V..I....A..K.LQ..Y..G........L..............R..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEVSAFske..........................ggnvGGAA.L.GTDRSEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRVK--ll....................................................................
F6W5U4_XENTR/1-135                     ...............................................ftm-----.KTTAL.FVP.FSLGE.VICI.I........Y.A.C...IY.LS........R...wKKIF.R.............F..Q..L.....WS..K......V..S....P..Y.WN..K..A........F..............L..S.IIVV......L..IV.......LF..L................DAAR.E......VK.KYSANHLTD................................kNAKL.Y.PSSYDHIHMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRVV.SLIMQLASEIES----ngam..................................................................
M3IM88_CANMX/1-132                     ..................................................MSLQM.SIVFC.TLI.VQMVI.LLTL.V........L.P.L...PY.VV........R....KKIV.D.............V..T..F.....TL..Q......K..N....Q..N.FR..V..G........V..............V..F.SIVL......M..SL.......QL..F................DCIQ.R......LN.KYADSELNK.................................---N.F.PGIDYDRLAS.KF.Y.S...QRN.L..YLS..GAILY.L.MI........AIQTVI.TIVRKMVLKEK-----ifres.................................................................
G3W549_SARHA/1-136                     ..................................................MSLQW.SAVAT.FLY.AEVVA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..S..L.....VQ..L......I..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LL..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..HIA..GFSLL.L.SF........LIRRLV.TLISQQATLLASNEA-f.....................................................................
G4ZJV0_PHYSP/71-198                    ..............................................mlln-----.HLMFW.MMM.TEGAI.CLVL.S........L.P.F...GQ.WV........S....HAVI.S.............F..L..M.....KH..Lg....gK..D....S..P.AN..M..V........A..............T..V.VLAI......V..SL.......LF..I................SDVT.T......VY.KHHSSDEVL.................................----.-.---SDGMRIR.LL.T.A...QRD.M..YIT..GFCLF.L.FL........LLRLVY.IALATNLRLEKSL---gam...................................................................
M2VZ48_GALSU/65-204                    .................................................n--MLW.LLVYL.FLC.TEVVI.VALL.V........L.P.L...PK.RV........R....RLVL.R.............V..L..A.....TG..S......Q..F....L..H.LR..K..F........I..............N..Y.ISLS......L..FF.......GI..V................ESLT.D......AY.RVQLKLSEQtts..........................ngmfS-NA.V.SFEVRTLKQR.QF.R.S...QRN.F..YLA..SFSLT.L.LF........VIGKLF.ELTSRINVLESQLEA-k.....................................................................
V5ELG0_KALBG/1-123                     ..................................................-----.-----.---.--MAM.FMVL.I........V.P.L...PF.TW........R....RKLF.H.............F..L..A.....VN..P......V..V....A..K.IQ..Y..G........L..............K..I.TFIF......V..AV.......LF..V................DAVQ.R......MV.KVMSEGETAr..............................dnRGVQ.D.VRTETNYAAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILSRTY.SLILDLINTQEELV--al....................................................................
E2LBH9_MONPE/1-141                     ..................................................MTIYY.TLTFL.LLA.AEMTT.FCVL.V........A.P.L...PY.KV........R....KSLF.R.............F..L..S.....ES..K......L..V....G..K.VA..Y..A........L..............K..I.SFIF......V..GI.......LF..F................DALQ.R......MF.RITAEAEMArsg...........................aggAGVG.D.VRTETNLAAR.KF.Y.A...QRN.T..YLT..GFTLF.L.SL........VLTRTF.YITLDLIHVQEEYAK-i.....................................................................
A0A0A1N867_9FUNG/1-139                 ..................................................MTLYY.TIVFA.ILI.AEIFT.FFLL.M........L.P.I...ST.RW........K....KPVF.R.............W..L..A.....TS..P......T..I....A..H.AS..Y..I........L..............K..I.VFGF......I..FV.......LF..I................DSVN.T......LR.AFYEVVHEEen.............................vtPGTS.D.FRAQVNQAAK.KF.Y.A...QRN.L..YLT..GFTML.L.LL........ILNTIK.TMTLEYIRLEDEY---lel...................................................................
M4CBV1_BRARP/1-125                     ..................................................MALQW.LILSY.VVA.AEVVI.AVIL.T........L.P.Y...PM.LL........K....KRIV.S.............L..V..S.....LI..L......Q..-....-..P.AA..S..I........-..............-..-.-VAF......A..GF.......QL..L................DLYW.K......N-.--EHRLMCS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AAGIL.L.YW........CIFRIC.KYNK------------dldyleelekr...........................................................
A0A087ST33_AUXPR/29-162                ...........................................wwrflaw-----.----V.LLP.LPVVL.VVLL.S........A.P.A...PR.LV........R....RGVL.R.............F..V..E.....TL..L......V..A....R..V.RG..PieI........I..............H..F.ALLI......A..GL.......SV..T................FCIG.P......ML.SSEAEVAKL.................................ENRR.D.PNILVMLLAR.QY.R.N...ERN.F..WLA..LFTLS.S.WA........VLWVVY.QVNRD-----------khvlrgklla............................................................
H0UYG0_CAVPO/1-153                     ..................................................MTIQW.VAVAT.FLY.TEIGL.ILLF.C........V.P.F...IP.PQ........R...wQKIL.S.............F..N..L.....WG..K......L..A....T..L.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSYAHSLE................................kVSNA.K.TSAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.SLITQLAKEL------tnrtvlktqaentnkaarkfme................................................
A0A1Y1W340_9FUNG/2-135                 .................................................a-TIQY.TGVFA.LLI.AEVVT.FLTL.I........I.P.F...PN.RW........K....RSVF.T.............W..A..S.....RS..P......V..V....K..K.II..Y..G........V..............K..I.AFVF......V..FV.......LF..C................DAVV.R......LN.KVRKDRSSH.................................-HII.D.DHALCQFKVQ.QF.Y.A...QRN.T..YLT..GITMF.L.GL........ILVSTY.ALIGQMLETDNQVDS-l.....................................................................
C5M6A9_CANTT/1-141                     ..................................................MALYY.NLVFI.LLA.VEMVF.FGVL.S........L.P.Y...PR.KI........R....RTVL.S.............A..V..S.....AP..F......R..N....E..Q.FQ..I..A........I..............K..C.VLGF......V..LV.......LF..I................DSVN.R......VY.AVTSELHAStgv...........................spgGGPA.V.VNDRSEIQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.TF........ILTRTY.SLVAELIATKDKVDD-l.....................................................................
A0A1Y1UIE0_9TREE/1-138                 ..................................................MTLYY.TLCFG.LLM.SELLL.FTTI.I........C.P.M...PF.AM........R....KKMF.H.............F..L..S.....EN..P......V..V....A..K.VQ..Y..A........L..............K..I.TFIF......V..AV.......LF..I................DALQ.R......MV.RIAQEGAGAk..............................mkNEMP.D.VRTETNYAAR.KF.Y.A...QRN.L..YLT..GATLF.L.SL........ILSRVF.YIILDFIHVQENYS--tl....................................................................
Q9LSH0_ARATH/1-126                     ..................................................MALQW.LILSY.VVA.AEVAI.AVIL.T........L.P.Y...PM.LL........K....KRIV.S.............L..I..S.....LI..L......-..N....P..A.AS..I..V........-..............-..-.--AF......A..GF.......QL..L................DIYW.K......NE.---HRLLCS.................................SEVC.T.TTERDRHEKS.VY.K.A...QRN.G..VLC..AAGIL.L.YW........CIFRIC.KYHKDLERLEQ-----lekry.................................................................
M3CJM4_SPHMS/1-140                     ..................................................MTLYY.SLVFG.LLM.FEMAV.FVTL.I........I.P.L...PL.KI........K....RALF.T.............F..I..S.....EN..P......L..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELASAks............................sqtAAVV.A.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDTLRLEEKIRS-y.....................................................................
A0A1U7YBW4_NICSY/1-129                 ..................................................MALEW.VVLGY.AAA.AEAVM.VILL.T........L.P.G...AY.AV........R....KGLI.S.............V..T..-.....--..-......-..-....R..N.LL..K..P........F..............L..S.VVPF......C..VF.......LL..L................DIYW.K......YE.TRPRCKSA-.................................-ESC.T.PTELMRHQKS.VM.K.S...QRN.A..LLI..AAALM.F.YW........LLYSVT.RLVTRVEMLNQRVEK-lqn...................................................................
A0A1R3JGQ6_9ROSI/1-126                 ..................................................MALEW.VVLGY.AAG.AEAIM.VLLL.T........L.P.G...LD.GL........R....KGLI.A.............V..T..-.....--..-......-..-....R..N.LL..K..P........F..............M..S.VVPF......C..LF.......LL..M................DIY-.-......-W.KYETRPHCE.................................GDSC.S.PSEHLRHQKS.II.K.S...QRN.A..LLI..GAALM.F.YW........ILYSVT.NLVVKIEQLNQRIE--rl....................................................................
A0A0P7WQ68_9TELE/108-243               ..................................................MTLQW.TAVAV.FLY.VEIGV.LVIL.C........L.P.F...IS.AR........R...wQTIF.K.............L..G..I.....WN..K......M..A....P..F.WN..K..G........F..............L..T.MIIV......L..IV.......LF..L................DAVR.E......VR.KYTGAQQSK.................................DPKL.H.PNIFDHMHMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........VMRRII.TLINQLATATAAV---avl...................................................................
B6QAV2_TALMQ/1-143                     ..................................................MTLYY.TLVFM.LLV.FEMLV.FLAL.I........V.P.L...PY.TF........K....RKLF.A.............F..I..S.....ES..P......V..V....A..K.LQ..Y..G........L..............R..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEMSAFskds.........................tgigRAAA.L.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMIVEVLRLEDRIK--ll....................................................................
F6UGY2_CALJA/1-138                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..L.WN..K..A........F..............L..T.IIIL......L..IV.......LFlvI................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKE-------lsnkgv................................................................
G5C2D0_HETGA/1-58                      ..................................................MTIQW.VAVAT.FLY.TEIGL.ILLF.C........V.P.F...IP.PQ........Rv..lRRLV.T.............L..I..T.....Q-..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------lakelsnkgvlktqae......................................................
A0A091RDX4_9GRUI/1-130                 ..................................................MTFQW.TAVAT.FLY.CEIAV.ILVL.C........L.P.F...IS.PL........R...wQKIF.T.............I..P..L.....WS..K......I..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAIR.E......VR.KYSAVQVNE.................................K---.-.---AANVNTN.VFdH.I...QIN.L..YLS..GFSLF.L.WL........VLRRTV.TLLTQLAKGMASHA--al....................................................................
A0A1G4K451_9SACH/1-135                 ..................................................MTLYY.TFVFG.ILA.FEMVM.FLLL.A........L.P.V...PS.KY........R....KPVT.M.............A..L..I.....RP..F......R..L....T..Q.VQ..V..A........V..............K..C.ILAF......I..LL.......LF..V................DTIN.R......VY.SVNAELSQT.................................SLAS.G.VSDRNEVQSR.KF.Y.A...QRN.M..YLT..GITLF.L.TF........TVFRTY.GLVWELLELKESYRA-e.....................................................................
A0A1Y2F031_9FUNG/1-137                 ................................................mt--PFI.AIISY.ILV.FQCIL.ILYM.A........V.P.W...RV.PF........R....RTII.E.............K..F..T.....TS..Nf....gL..L....N..K.IR..F..A........Y..............G..V.LQVF......I..AL.......LF..C................DNIR.N......LK.NCNEQVDRA................................yKSST.S.QDVIAEATKR.LH.K.T...QRD.F..YIL..AFTLY.C.GI........VVYLLH.LVVL------------rsgryrkerng...........................................................
A0A1C1WXD5_9PEZI/1-141                 ..................................................MTLYY.TLVFM.LLM.AEMAL.FMFL.I........V.P.M...PF.SL........K....RRVF.T.............F..I..S.....EN..P......F..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELSAVteg...........................gnnAAAI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILDVLRLEEKLKQ-y.....................................................................
F6RHI2_CALJA/1-139                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..L.WN..K..A........F..............L..T.IIIL......L..IV.......LFlvI................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
E7KSI5_YEASL/1-83                      ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.-MIF......V..GL.......LF..I................DSWK.R......SQiRVSTYRNQK................................nPYII.N.SVTPVDALAS.RA.Y.N...QRN.V..YIS..GFIIY.F.YI........CILTVM.SILRRIVEWNDKMKA-g.....................................................................
A0A0L0SSA8_ALLMA/1-142                 ..................................................MSLAN.QISFA.VLA.VEGVV.VVLL.S........I.P.L...PA.KA........R....KALA.R.............L..L..T.....ES..A......I..A....K..Q.AS..V..P........F..............W..F.LAIF......L..AV.......NF..A................DATL.R......QY.KLSQQHHGVeid..........................shhhHHVG.Y.PINDMDPRAK.LF.Q.A...QRN.M..YLT..GSALF.L.LF........VINVLR.GLLVDIVRAETKLAA-l.....................................................................
A0A183BL93_GLOPA/1-137                 ..................................................MTLQW.TVIAF.VLY.SEIAT.IVVL.L........L.P.W...IR.PT........M...wKKVF.N.............S..R..I.....LH..K......L..K....Q..F.ST..V..Y........S..............Y..S.FIFV......L..IL.......LF..I................DATR.E......VR.KYSHVDASK................................eLTGR.V.AEADAVIHMR.LF.R.A...QRN.L..YLS..GFSLL.L.AL........IISRIV.TLLARCAHLELAAE--aa....................................................................
A0A1V4JZX3_PATFA/1-137                 ..................................................MTFQW.TAAAT.FLY.GEIGV.LLVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..I................DAVR.E......VR.KYSAVHVME................................kAVNV.N.ANAFDHIQMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRTV.TLLTQLAKGMASHA--al....................................................................
A0A091HVD3_CALAN/1-85                  ..................................................MTFQW.MAVAT.VLY.GEIAV.LLVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WN..K......M..A....A..F.WN..K..I........F..............L..T.IIVL......L..IV.......LF..L................DAFR.E......VR.KYSSLQVNE.................................K---.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------takn..................................................................
A0A1S3UGQ8_VIGRR/1-126                 ..................................................MALQW.LILTY.VVA.AEAAV.AILL.T........L.P.T...PK.LL........R....NRFA.S.............L..V..S.....LI..-......-..-....-..-.LQ..P..A........L..............-..F.IVPF......A..GF.......HL..L................DIYW.K......NE.HRLMCT---.................................SEVC.T.AAERDRYEKS.IY.K.A...QRN.V..ILC..ITSIL.L.YW........SISRIC.KYQKDVESMEE-----vekry.................................................................
A0A1U7VZM1_NICSY/1-126                 ..................................................MALQW.MILTY.VVA.AEAAV.AILL.T........L.P.S...PK.AI........K....SRIV.S.............L..I..S.....LT..L......Q..P....S..-.--..-..-........-..............L..F.IVPF......A..GF.......QL..L................DIYW.K......NE.HR---LMCT.................................GEIC.T.AAERDRYEKS.IY.K.A...QRN.A..ILC..LAACL.L.YW........CIYRVC.KYYKEIQSIEE-----vekrl.................................................................
A0A1L9X7Y3_ASPAC/1-141                 ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........I.P.L...PF.TV........K....RKLF.A.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFkeg...........................gpmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDRVK--ll....................................................................
C4M666_ENTHI/2-103                     .................................................a-SILY.TLNFV.ICI.ILIVT.LTLL.L........I.P.I...PN.IL........K....KQIL.S.............L..S..H.....WI..V......K..K....-..-.-R..I..F........S..............I..T.LLVI......V..SI.......LF..I................DAFS.R......MK.HCEGVKQSLaf.............................daPINT.R.ISTYSETNIL.LF.-.-...---.-..---..-----.-.--........------.----------------mstkq.................................................................
A0A0D9VRQ8_9ORYZ/1-126                 ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..VSACL.L.YW........CIFRIC.KYNKDIKALEE-----aekri.................................................................
S2JM45_MUCC1/1-93                      .................................................m-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....A..K.AM..Y..A........L..............K..I.IFGF......I..FV.......LF..I................DTIS.R......LS.RIESEVEGE................................kSHHH.D.YSYETSIKAK.RF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.ALVLELLQREEELKK-a.....................................................................
R9PB83_PSEHS/1-138                     ..................................................MTLYY.SIVFA.LLC.FEMAM.FMVL.I........V.P.L...PF.TW........R....RKLF.H.............F..L..A.....VN..P......V..V....A..K.IQ..Y..G........L..............K..I.TFIF......V..AV.......LF..V................DAVQ.R......MV.KVMSEGETAr..............................dnRGVQ.D.VRTETNYAAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILSRTY.SLILDLINAQEELV--al....................................................................
H1VQF2_COLHI/1-141                     ..................................................MTLYY.TLVFV.LLM.AEMGL.FMLL.I........V.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......V..V....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELALAtek...........................qnsGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRS-y.....................................................................
A0A093RUN0_9PASS/1-107                 ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSSVHVNE................................kAANI.N.SSAFDHIQMK.LF.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTV.TLLTQLAKEMASHAA-l.....................................................................
F4PAM6_BATDJ/1-135                     ..................................................MTLYY.QIVFA.MLV.YEMAL.FLLL.L........A.P.F...PT.TW........R....RSML.K.............W..V..S.....NS..K......I..V....V..K.IS..Y..V........M..............R..I.MFVF......V..VV.......LF..V................DSLN.N......VM.KKHEHDEHG.................................HSHA.D.AHTESMVRAK.MF.Y.A...QRN.L..YLT..GSVVF.L.SL........VLNRFF.AMVFELMKNEEKSEE-l.....................................................................
A0A077ZIX5_TRITR/41-100                ..........................................sliakydc-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..A................DGVR.E......VR.KYSEADKSM................................dSQFH.T.AQADAIVHMR.LF.R.A...QRN.L..YIS..GFALF.L.WL........------.----------------......................................................................
A0A151NP58_ALLMI/1-137                 ..................................................MTFQW.TAVAT.FLY.AEIGV.LLLL.C........L.P.F...VS.PV........R...wQKIF.M.............I..P..L.....WN..K......I..A....I..Y.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAIR.E......VK.KYSAAHATE................................kVASV.H.QNAFDHIQMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRTI.TLITQLAKE-------mgiqval...............................................................
A0A146FB73_9EURO/1-131                 ..................................................-----.-----.---.--MAV.FMGL.I........I.P.L...PF.TV........K....RKLF.A.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFgkegg......................tmgfrhRAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEDRVR--ll....................................................................
G3AWS5_CANTC/1-137                     ..................................................MALYY.NLVFG.LLV.VEVAF.FTVL.S........L.P.Y...PR.KI........R....RTVL.T.............T..V..S.....AP..F......R..N....E..K.FQ..I..A........L..............K..C.ILGF......V..LV.......LF..I................DSVN.R......VA.SVSNELQGSa...............................iRGSA.I.VNDRSEIQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.TL........ILLRTY.SLVTELLVTKDKVDA-l.....................................................................
BAP29_PONAB/1-137                      ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
G1TER3_RABIT/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LISI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A1S7ULV1_ROSNE/1-141                 ..................................................MTLYY.TLVFL.LLV.AEMTL.FMLL.V........I.P.M...PF.AV........K....RRMF.T.............F..L..S.....EN..P......I..I....A..K.IQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQLELAAAtes...........................skgSVAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILDTLRLEEKVKQ-y.....................................................................
U5FP85_POPTR/1-127                     ..................................................MALEW.VAVAY.AAG.AEAMM.LLLL.T........L.P.G...LN.PL........R....NGLL.S.............V..T..K.....--..-......-..-....T..L.LK..P..F........F..............S..I.-LPI......C..LF.......LV..M................DIYW.K......YE.TMPSCKTLN.................................--SC.S.PSENMRHQKS.TI.K.S...QRN.A..LLI..AAALV.F.YW........LLYSVT.KLIDRVEQLQFQI---krs...................................................................
A0A1E4TSG3_PACTA/1-137                 ..................................................MALYY.SLVFS.LLV.IEMGL.FTLL.S........L.P.L...PR.RF........R....RPLL.S.............T..V..S.....KP..L......R..S....Q..E.VQ..I..A........F..............R..C.ILGF......I..LV.......LF..I................DSVN.R......VF.RVTAELGPSskggg......................itsgiiPSAI.A.PDSRAEIQAR.KF.Y.A...QRN.M..YLC..GFTLF.L.TL........ILNRTY.ALVAEL----------l.....................................................................
V4LM48_EUTSA/1-124                     ................................................mi-----.HLLYS.VLF.AEMAL.ILLL.L........F.K.-...-T.P-........L....RKLI.I.............L..T..F.....DR..I......K..R....G..R.GP..V..V........V..............K..T.IGAT......V..FV.......VL..M................SSVY.S......LL.SIQRRSEDG.................................A-AL.N.PTDQVLASKH.ML.E.A...---.-..SLM..GFVLF.L.SL........MIDRLH.HYIRELRLLRKTME--ta....................................................................
A0A2K5HQB0_COLAP/1-137                 ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................rTSTS.R.PDVYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A1Q3E766_LENED/458-575               ................................................ng-----.-----.---.-----.----.V........I.P.F...PF.VV........R....KRVF.T.............F..L..S.....QS..P......I..V....A..K.VA..Y..G........I..............K..I.SFIF......V..GI.......LF..F................DALQ.R......MF.RITAESDLAk..............................tqQSVG.D.VRTETSFAAR.KF.Y.A...QRN.V..YLT..GFTLF.L.SL........VLTRTF.AINLDLIHTQEEYAK-l.....................................................................
M5G901_DACPD/1-138                     ..................................................MTLYY.SMCFI.LLT.AEMVF.FLVL.I........A.P.L...PF.AI........R....RKFF.T.............F..L..S.....ES..P......I..V....G..K.IA..Y..A........L..............K..I.MFIF......V..AI.......LF..V................DAVQ.R......MF.RTTAEADLAr..............................lnQGGA.D.VRAEANFAAK.KF.Y.A...QRN.M..YLT..GFTLF.L.SL........VLTRTF.YIILDLIHTQEEYAK-l.....................................................................
G9P9R2_HYPAI/1-143                     ..................................................MTLYY.SLVFA.LLM.GEMGL.FMLL.L........V.P.L...PF.KI........K....RKIF.T.............F..I..S.....ES..P......L..V....A..K.MQ..Y..W........M..............K..I.TFVF......I..LI.......LF..V................DSVN.R......VY.KVQVELMAAheqs.........................akgnAAAI.M.GSERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVK--my....................................................................
A0A074X1U9_AURPU/1-143                 ..................................................MTLYY.SLVFG.LLV.FEMVV.FMSL.I........I.P.M...PF.TW........K....RTLL.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..W........I..............K..I.TFVF......I..LI.......LF..V................DSVN.R......VY.RVQLELAQAnkan.........................ngagAAAV.G.GIERMEIQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.GMILDVLRLEEENRK-m.....................................................................
K0KLP8_WICCF/1-123                     ..................................................-----.-----.---.--MFI.TTVL.V........L.P.L...PL.RF........R....KQSL.K.............T..Y..E.....FL..F......S..S....R..E.VK..T..S........V..............Y..I.SLTL......V..GL.......LF..I................DSFQ.K......NF.KFKTSNTYDp...............................rYLQS.S.YNQTPDVMAR.IF.Y.N...QRN.L..YIS..GAVLF.F.GI........AIPTVF.NIIRRLIKYEE-----fnlekt................................................................
A0A0D2F5J7_9EURO/1-143                 ..................................................MTLYY.SLVFA.ILV.SEMVL.FMAL.V........V.P.M...PF.TV........K....RKMF.N.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMASLmndg.........................tgagRAAA.M.GSDRMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVK--my....................................................................
A0A0B0P097_GOSAR/1-126                 ..................................................MALQW.MILTY.VVA.AEAAL.ALLL.T........F.P.S...PK.LL........K....NRFV.S.............L..-..-.....--..-......I..S....L..I.LQ..P..T........L..............-..F.IIPF......A..GF.......QL..L................DIYW.K......NE.HRLMCTSE-.................................--IC.T.AAERDRYEKS.VF.K.A...QRN.V..ILC..TTACL.L.YW........CIYRIC.KYHKEIQSLEE-----vekry.................................................................
A0A179U2F9_AJEDR/1-142                 ..................................................MTLYY.SLVFL.LLV.VEMVI.FVGL.I........I.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQTELSTHske..........................mggaGTAA.L.GAERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVKQ-l.....................................................................
I1H7K9_BRADI/1-126                     ..................................................MALQW.MILAC.VVA.AEAAV.AALL.T........L.P.A...PR.AV........R....GQIV.G.............L..T..S.....M-..-......F..L....Q..P.--..-..-........F..............A..G.VLPF......A..GF.......QL..L................DIYW.K......KE.HR---LMCT.................................TEVC.T.AEERVHFEKA.IF.K.A...QRN.V..ILC..VSVFL.L.YW........SIYRIC.KINKDIKALEE-----iekri.................................................................
R7S4E7_PUNST/535-672                   ................................................af----Y.TIAFL.LLG.AEMAM.FCIM.V........A.P.L...PY.GI........R....KRLF.H.............F..L..A.....ES..P......L..V....A..K.VA..Y..G........I..............K..I.AFIS......I..LV.......LF..V................DAVQ.R......MF.RITAEAEAAks............................nnsAVLQ.N.VQTETNFAAR.KF.Y.A...QRN.V..YLT..GFTLF.L.SL........VLTRTF.YIILDLIHAQEEYAK-l.....................................................................
A0A087SMZ5_AUXPR/1-133                 .............................................mvsaw----W.MVAHY.LLP.LPLIL.FALL.A........L.P.G...PK.RG........I....L-LF.C.............T..R..V.....FD..L......P..L....I..G.IF..R..L........L..............H..V.AFFL......T..GI.......AF..F................GAFR.Q......LR.ALRDQQQLG.................................-IYG.S.PNQEIALLSK.KW.R.T...ERN.L..WIA..AFAFA.A.WA........GLAAFY.RETQRRVALEDE----lhg...................................................................
F1S2A8_PIG/1-136                       ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DALR.E......IR.KYDDVTEKV.................................NLQN.N.PGAVEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
C0NEZ9_AJECG/1-141                     ..................................................-----.-----.---.--MVI.FVGL.I........I.P.L...PF.TV........K....KKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........MkeetgqelthmvpyK..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELSAYske..........................lggaGSAA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVKQ-l.....................................................................
G1WZB4_ARTOA/1-143                     ..................................................MTLYY.SLVFA.LLM.FEMGI.FMVL.I........C.P.L...PL.TW........R....RQMF.T.............F..I..S.....TN..P......L..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQRELIDAtsgn........................nsrggSAAI.L.GPERTEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VLILDILRLEEEVK--l.....................................................................
A0A0L7LST0_9NEOP/1-134                 ..................................................MSLQW.SIIAT.FLY.AEIAA.VLLL.T........L.P.I...AS.PS........K...wSKFF.K.............S..K..F.....LA..Y......I..S....G..Q.AY..I..Y........F..............F..I.LIGV......L..VL.......CL..L................DAIR.E......MQ.KYSSMESTD.................................--HQ.H.LDAEMQGNMR.LF.R.A...QRN.F..YIS..GFALF.L.LV........VIRRLV.QMISELATMTAQCEA-n.....................................................................
K7J2I9_NASVI/1-136                     ..................................................MSLQW.TLIAT.FLY.AEIAV.VLLL.V........L.P.I...AS.PQ........R...wQRFF.K.............S..R..F.....LQ..S......L..S....A..Q.AS..M..Y........F..............L..V.LLAI......L..VL.......FL..L................DAIR.E......IR.KYSSHEVTE.................................HAHS.H.LDTEMQGNMR.LF.R.A...QRN.F..YIS..GFALF.L.SL........VIRRLV.TLISAQATLIAQSEA-s.....................................................................
Q4WRX3_ASPFU/1-142                     ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........I.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFtke..........................gnsmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDRVKH-l.....................................................................
A0A1R0H781_9FUNG/2-68                  .....................................kakryhksglepg-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................--NV.D.LDLNNRDLVS.KF.Y.A...QRN.I..YLT..GITLL.L.GL........IMISTY.NLIGKLLAAKNESA--dl....................................................................
A0A0D2XAF4_FUSO4/1-52                  ................................................mg-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.-HERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRA-y.....................................................................
E7LS60_YEASV/1-140                     ..................................................MSLYY.TLVFA.ILV.VEIFM.FSIL.A........L.P.I...PS.RY........R....RPLT.L.............L..L..L.....KP..F......K..S....S..T.VQ..V..A........I..............K..C.ILGF......I..LL.......LF..I................DCIN.R......VY.SIDKELQLSsa............................sqnNGAI.I.AQDRIEVLSR.KF.F.A...QRN.M..YLT..GITLF.L.TF........VVVRTF.GLVIELLTMKDIYR--as....................................................................
A0A183SFM1_SCHSO/795-926               ..................................................MSIVW.TLVAT.FLY.AEGAV.IILL.L........L.P.L...IS.ST........R...wNSLF.K.............S..R..L.....IA..T......F..S....A..Y.GS..F..Y........F..............R..G.CICL......L..TL.......MI..C................EAAR.S......VW.TQNNAYQKLk..............................dnPQDF.R.AETESVFLMR.LF.R.A...QRN.L..YIS..GFSLF.L.WF........AV----.----------------fwinpciqfclkf.........................................................
A0A1I8H8A3_9PLAT/1-134                 ..................................................MSLQW.TVISW.FVY.AEAAL.VLIM.C........L.P.G...VS.VQ........R...wRRIL.R.............S..R..L.....LR..K......F..D....S..S.AY..V..Y........F..............N..V.FFGL......L..IL.......LL..I................DAYR.K......MR.QHALEELSI.................................DERV.N.PHGFALSRMR.KF.R.S...QVN.F..TLS..AGALL.L.WI........VLKWMV.SSLIGRA---------fleqdls...............................................................
G3U1I5_LOXAF/1-138                     ..................................................MTLQW.TAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wRKIF.S.............F..H..V.....WG..K......I..A....T..F.WN..K..V........F..............L..T.IIVL......L..IV.......LF.lV................DAVR.E......IR.KYSYAHAIE................................kSSIS.R.PSAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------stkgal................................................................
A0A0V1L4M4_9BILA/149-284               ..................................................MSLQW.TLVAL.LLY.VEVFV.LSCM.L........L.P.W...IR.PS........S...wQRLF.R.............S..R..F.....LR..F......I..Q....T..Y.SS..L..Y........I..............Y..C.FALM......L..LL.......LF..L................DALR.D......VR.KYSDADLVK.................................QSAG.N.VQGEFNTHMR.LF.R.A...QRN.L..YIS..GAALF.L.WF........VIQRVA.SMISREAMLIASAEA-a.....................................................................
A0A2G5UDU4_9PELO/1-134                 ..................................................MTLQW.TIVAG.VLY.AEIAA.TFIL.L........L.P.W...VR.PT........L...wSKLF.K.............S..R..L.....FT..A......L..S....K..H.AH..I..Y........S..............M..T.FGFV......L..FI.......LF..A................DGVR.E......TM.KYNELEDKM.................................--HR.T.AEADATYHMR.LF.R.A...QRN.L..YIS..GFSLL.L.WM........VIQRIM.TLLSRAAQLEAAGEA-a.....................................................................
H3GDM5_PHYRM/1-128                     ..............................................mlln-----.HLMFW.MMV.TEAAI.CLVL.S........L.P.F...GQ.WL........S....HAVI.S.............F..L..M.....KN..Lg....gK..D....S..P.AN..M..V........A..............T..V.VLAV......V..SL.......LF..L................SDVT.T......VY.KHHSSDEVL.................................----.-.---SDGMRIR.LL.T.A...QRD.M..YIT..GFCLF.L.FL........LLRLVY.LALATNLRLEKSL---gam...................................................................
A0A1R0GUW4_9FUNG/1-44                  ................................................mi-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.---------T.MF.Y.A...QRN.I..YLT..GITLL.L.GL........IMVSTH.KLIVELLEARSKVA--sa....................................................................
G0V5S8_NAUCC/1-141                     ..................................................MSLYY.TLVFG.ILV.AEIIV.FSIL.A........L.P.I...PS.KF........R....KPLT.L.............L..L..L.....RP..F......K..I....P..T.VQ..V..A........I..............K..C.ILGF......I..LL.......LF..L................DSIN.K......VY.NINQELTEAgra...........................tggGAGG.L.GQERIEVLSR.KF.F.A...QRN.M..YLT..GITLF.L.TF........IVTRTF.SLVNELLDLKETYH--tt....................................................................
B9EQV3_DROME/1-134                     ..................................................MSLVW.TLIAG.FLY.AEIAL.VLLL.V........L.P.V...LT.PY........R...wNRFF.K.............S..K..F.....LS..M......L..G....Q..Q.AH..I..Y........F..............L..L.IMGI......L..VI.......FL..L................EAIR.E......MR.KYSGLQQSN.................................--EV.H.LNVEMQHSMK.LF.R.A...QRN.F..YIS..GFAIF.L.AL........VIRRLV.NLICTQANLMAQSEA-s.....................................................................
W6Y3Y0_COCCA/1-141                     ..................................................MTLYY.SLVFL.LLV.TEMLI.FCAL.I........V.P.L...PF.TW........R....RRLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSGSddq...........................grsGVAA.G.GIERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEEVKS-l.....................................................................
M4A1Y7_XIPMA/1-136                     ..................................................MTLQW.TAVAL.FLY.AEIAV.ILIL.C........I.P.F...IS.AR........R...wQIIF.Q.............L..R..I.....WS..W......M..A....R..F.WN..K..V........F..............L..T.MIIV......L..IV.......LF..L................DAVR.E......VR.KYSSKEIGT.................................DAKV.Q.PNMFDHLHMK.LF.R.A...QRN.L..YIS..GFAVF.L.WL........VMKRVI.TLINQLADVSGTT---aal...................................................................
E9CY34_COCPS/1-144                     ..................................................MTLYY.TLVFL.ILM.VEMAI.FMGL.I........V.P.L...PF.TW........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSAYskda........................vgagiRAGA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEILRLEDRVKQ-l.....................................................................
K4C8W4_SOLLC/1-126                     ..................................................MALQW.MILTY.VVA.AEAAI.AILL.T........L.P.S...PK.PL........K....SRFV.S.............L..I..S.....LA..L......Q..P....S..-.--..-..-........L..............-..F.VVPF......S..VF.......QL..L................DIYW.K......NE.---HRLMCT.................................GEIC.T.ASERDRYEKS.IY.K.A...QRN.V..ILC..LAACL.L.YW........CIYRVC.KYYKEIQSIEE-----vekry.................................................................
A0A0P7BCS2_9HYPO/36-113                .................................................t-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................--VN.R......VY.RVQLELLAAteq..........................tkhgGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIIEVMRLEDRIR--dy....................................................................
G8ZQD1_TORDC/1-125                     ..................................................-----.-----.---.--MVT.LFTI.V........L.P.L...PY.RV........R....KVLY.N.............G..Y..Y.....KW..T......A..S....R..Q.FQ..T..V........Y..............Y..I.FGSI......V..GL.......LF..V................DSWK.R......AQvKVSLYHHKKyg.............................qeDSDP.A.AVTPIQALAS.RA.Y.N...QRN.V..YIS..GFILY.F.MV........CIPTVM.TIVRRLVKYQNL----inee..................................................................
A0A1I8IET8_9PLAT/1-135                 ..................................................MSLQW.TVISW.FVY.AEAAL.VLIM.C........L.P.V...VS.VQ........R...wRRIL.R.............S..R..L.....LR..K......F..D....S..S.AY..V..Y........F..............N..V.FFGL......L..IL.......LL..I................DAYR.K......MR.QHALEELSI.................................DERV.N.PHGFALSRMR.KF.R.S...QIN.F..TLS..AGALL.L.WL........VLKWMV.SSLIGRA---------fleqdlsi..............................................................
A0A1X2IAR8_9FUNG/1-136                 ..................................................MTIYY.TLTFG.ILV.TEMFM.FGIL.V........L.P.L...PS.HW........R....RAML.K.............F..V..S.....TS..P......L..V....A..K.AL..Y..V........L..............K..I.VFGF......I..FV.......LF..I................DTIN.R......LQ.RIDSLNEDE................................qRVSH.D.YSYEANMKAK.KF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILDRTS.TLVIQMLKREEELEN-a.....................................................................
H2MWD0_ORYLA/1-135                     ..................................................MSLQW.TAVAT.FLY.VEVFL.VLLL.C........I.P.F...IS.PK........R...wSKVF.K.............S..R..I.....LQ..T......I..A....L..Y.GN..T..W........F..............M..V.AIAI......L..VF.......LL..I................DAFR.E......VR.KYSVSDKVD.................................-VTN.N.PTAIEHIHMK.LF.R.A...QRN.E..YIA..GFALL.L.CL........LLRRLA.TLLSQQASLMASNEA-f.....................................................................
A0A2I2ZPY3_GORGO/1-137                 ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A0C7N894_9SACH/1-137                 ..................................................MTLYY.TFVFG.ILA.FEMVM.FLLL.A........L.P.I...PS.KY........R....KPVT.M.............A..L..I.....RP..F......R..L....T..Q.VQ..V..A........I..............K..C.ILGF......I..LL.......LF..V................DTIN.R......VY.SINTELAQTs...............................iAAGV.G.VSDRNEVQSR.KF.Y.A...QRN.M..YLT..GITLF.L.TF........TVFRTY.GLVWELLELKEKYR--ne....................................................................
A0A0B1PCR1_UNCNE/1-139                 ..................................................MTLYY.SMVFL.LLV.SEMAL.FVLL.I........I.P.L...PF.TI........R....RKIF.I.............F..I..S.....EN..P......T..I....A..K.LQ..Y..G........M..............K..I.AFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELAETnr.............................qqGSAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TLILDVLRLEEKVKK-y.....................................................................
F9FU37_FUSOF/1-143                     ..................................................MTLYY.TLVFM.LLV.FEMAL.FMLL.I........V.P.M...PF.NV........K....RKIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAseqs.........................kqggGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRA-y.....................................................................
I4YHN3_WALMC/1-138                     ..................................................MTLYY.SLVFG.LLS.AEIVT.FLVL.V........A.P.M...PF.AF........K....QKFF.K.............F..L..S.....TN..P......L..V....A..K.LQ..Y..S........L..............K..I.SLIF......T..SI.......LF..F................DAVQ.R......ML.RVVKEGQTAk..............................eeHAFT.D.VRSETNFAAR.KF.Y.S...QRN.V..YLT..GFTLF.L.SL........ILSRVF.GIIMDLIQSQEEL---glm...................................................................
A0A0D2BK14_9EURO/1-143                 ..................................................MTLYY.SLVFA.ILV.SEMVL.FMAL.V........V.P.M...PF.TI........K....RKMF.N.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQIEMASLmndt.........................tgagRAAA.I.GSDRMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILEVLRLEEKVK--my....................................................................
A0A0B4H3J8_9HYPO/1-141                 ..................................................MTLYY.SLVFF.LLV.LEMVL.FMLL.L........I.P.L...PH.TA........K....RKVF.T.............F..I..S.....EN..P......I..I....S..K.VM..Y..W........L..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLEVVAAgeq...........................askGAAI.L.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMMIDNIKLEDKVKA-f.....................................................................
A0A1C7N884_9FUNG/1-135                 ..................................................MTIYY.TAVFL.ILM.VEMVA.FCLL.V........I.P.L...PS.RW........R....RAIL.K.............F..A..S.....TS..P......V..V....A..R.AI..S..T........L..............K..I.VFGF......I..FV.......LF..I................DAVS.R......LQ.RIDQDGASD.................................GHHH.D.YSYETNLKAR.KF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.TLLIQMLKHDEELE--ya....................................................................
A0A1A9ZF13_GLOPL/2-58                  ..................................eeknvqmkfdivqenh-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.FL.K.A...QRN.L..YIS..GFAIF.L.IM........VLKRII.ALISIINQLLAQNDA-a.....................................................................
A0A183PFW1_9TREM/1-82                  .................................................m-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......L..VC.......VL..A................EALR.N......IW.VLRQAYNSIk..............................dhPHEM.R.PETESLYLMR.MF.R.A...QRN.F..YIT..GFSLF.V.WF........VLHRLV.SLLSEHAKMQASEEA-s.....................................................................
I3JPB7_ORENI/1-136                     ..................................................MTLQW.TVVAF.FLY.AEITV.NLIL.C........V.P.L...IS.AQ........R...wRLIF.S.............W..R..I.....WS..W......L..S....P..Y.WN..K..C........F..............F..T.IIMV......L..IV.......LF..L................DALR.E......VQ.KYSGPEPMQ.................................DAKV.N.PNVYDHVHMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........IMRRVA.SLLNQVAVTMEDS---agl...................................................................
A0A0C9N7P7_9FUNG/1-150                 ..................................................MALYY.GIVFG.ILT.FEIIL.FFLF.L........L.P.I...PT.RW........Q....KPVF.R.............W..L..A.....TS..P......T..I....A..H.AQ..Y..I........M..............K..I.VFVF......I..FV.......LF..Lgkl.........lketDSVN.T......LR.AFYEVVGTEdeng.........................gipaAGNS.D.FRAQVGQAAK.KF.Y.A...QRN.L..YLT..GFTIL.L.LL........ILNKIK.TMAMDYIRLEDQF---iel...................................................................
G1KI14_ANOCA/1-136                     ..................................................MSLQW.ATVAT.FLY.AEVLL.VFLL.C........I.P.F...IS.AT........R...wQKIF.K.............S..R..L.....VQ..L......V..V....A..Y.GN..T..F........F..............I..V.LIII......L..IL.......LF..L................DAIR.E......IR.KYDDVTEKV.................................NLQN.N.PGAVEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.M.AF........LLRRLV.TLISQHATILASNEA-f.....................................................................
A0A2I3LHM7_PAPAN/68-203                ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
M2SRT2_COCSN/1-141                     ..................................................MTLYY.SLVFL.LLV.TEMLI.FCAL.I........V.P.L...PF.TW........R....RRLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSGSddq...........................grsGVAA.G.GIERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEEVK--gl....................................................................
A0A154PDS8_9HYME/3-138                 ..................................................MSLQW.TLIAG.FLY.AEVFI.VLLL.V........F.P.I...LS.PT........K...wQRIF.K.............S..R..F.....LQ..S......L..S....D..K.AS..I..F........F..............V..I.LIAI......L..VL.......FL..L................DAMR.E......IR.KYSMVGQLV.................................VEHA.H.LDAEIQGQMK.LF.R.A...QRN.F..FIS..GFTLF.L.SL........VIRRLV.ILISAQATLLAQSEA-a.....................................................................
J5K2P8_BEAB2/1-143                     ..................................................MTLYY.TLVFA.LLM.FEMAL.FMFL.I........V.P.L...PH.NA........R....RAIL.T.............F..V..S.....EN..K......T..I....R..Q.IQ..Y..W........L..............K..I.TFVF......I..LV.......LF..V................DSVN.R......VY.RVQMELAESmeqa.........................arggGTVV.L.GHERTEVQAR.KF.Y.A...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIKDIIRLEERVRA-y.....................................................................
A0A183RJF1_9TREM/1-115                 .................................................m---LW.HIVVA.FLY.SEMFV.VLLM.I........L.P.F...FS.SQ........T...wSKFF.K.............F..S..I.....IQ..K......I..S....E..K.SS..F..Y........F..............R..L.FLVM......L..VC.......VL..A................EALR.N......VW.VLRQAYNSIk..............................dhPHEM.R.PETESLYLMR.MF.R.A...QRN.F..YIT..GFSLF.V.WL........------.----------------......................................................................
A0A091F971_CORBR/1-137                 ..................................................MTFQW.TAVAT.ILY.GEIGV.ILVL.C........L.P.F...IS.PL........R...wQKIF.M.............F..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..II.......LF..L................DAVR.E......IR.KYSSVHVNE................................kAANV.N.SSAFDHIQMK.LF.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTV.TLLTQLAKEMASHAA-l.....................................................................
A0A015LL83_9GLOM/1-83                  .........................................mileliyty-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..-Y.......RY..L................DAAN.R......TF.SVQNQEKTD.................................I--N.D.TRAEVAHHAK.KF.Y.N...QRN.M..YLT..GFTLF.L.SL........ILNRTY.VLVVELLAAEDNLE--vi....................................................................
A0A139AM49_GONPR/1-133                 ..................................................MSIQY.TLAFV.CLV.IEVIA.FVLL.S........L.P.F...GH.KQ........K....AQAI.N.............F..V..S.....TS..P......A..F....K..P.VR..T..L........I..............M..V.VGFL......I..LI.......LF..F................DALN.R......A-.-VLNPPSKV.................................DLQG.Q.PFTEHAVNSK.KF.F.A...QRN.L..YLT..GSTLL.M.FY........ATTQYY.SLMLFHLRTKAELEA-k.....................................................................
I2G544_USTH4/1-138                     ..................................................MTLYY.SIVFA.LLC.FEMSM.FMVL.I........V.P.L...PF.TW........R....RKLF.H.............F..L..A.....TN..P......V..V....A..K.IQ..Y..G........L..............K..I.TFIF......V..AV.......LF..V................DAVQ.R......MV.KVMSEGETAr..............................dnRGVQ.D.VRTETNYAAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILSRTY.SLILDLINTQEELV--al....................................................................
A0A226NVG6_COLVI/1-137                 ..................................................MTVQW.TAVAA.FLY.GEVAV.LLVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..R......M..A....V..L.WN..K..M........F..............L..T.IIVL......L..II.......LF..L................DAVR.E......VR.KYSAIQVNE................................kVANV.N.ANAIDHIQMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRTV.TLLTQLAKTMASHAA-l.....................................................................
A0A2H3HUU1_FUSOX/1-143                 ..................................................MTLYY.TLVFM.LLV.FEMAL.FMLL.I........V.P.M...PF.NV........K....RKIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAseqs.........................kqggGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRA-y.....................................................................
A0A2I4GX48_9ROSI/1-124                 ................................................mi-----.----Q.LLY.SVIVA.QMAL.I........L.T.L...LF.KS........P...lRKLV.I.............L..T..L.....DR..V......K..R....G..R.GP..V..M........V..............K..T.VGGT......I..LI.......VL..A................SSVY.S......MV.KIQSRTMEA.................................G-VA.N.PTDQVLMSQH.ML.E.A...---.-..SLM..GFMLF.L.SL........MIDRLH.HYIRELSLLRKTMEA-a.....................................................................
A0A1V9XB67_9ACAR/1-140                 ..................................................MSLQW.TCVAG.FLY.AEIII.VALL.L........M.P.F...IS.PK........I...wANLF.N.............S..R..F.....LK..S......F..A....A..Q.AN..I..W........F..............T..V.AIGI......L..LL.......FF..V................DSVR.D......VV.KYSSIRYHDed.............................hhHHHA.H.MDIEIQHQMK.MF.R.S...QRN.F..YIA..GFSLF.L.AL........VIRRLA.FLITSQARLIASNDA-l.....................................................................
A0A261APG3_9PELO/1-134                 ..................................................MTLQW.TIVAG.VLY.AEIAA.TFIL.L........L.P.W...IR.PT........L...wSKLF.K.............S..R..L.....FT..A......L..S....K..H.AH..I..Y........S..............M..T.FGFV......L..FI.......LF..A................DGVR.E......TM.KYNGLEDKM.................................Q--R.T.AESDATHHMR.LF.R.A...QRN.L..YIS..GFSLL.L.WM........VIQRIM.TLLSRAAQLEAASEA-a.....................................................................
A0A1G4MD75_LACFM/1-135                 ..................................................MALYY.ALVFG.ILV.TEMTV.FVVL.A........L.P.I...PS.RF........R....RHLT.V.............A..L..V.....KP..F......Q..L....T..Q.VQ..V..A........T..............K..C.VLAF......I..LL.......LF..I................DTIN.R......VY.NVERELRAA.................................GLAT.G.AQDRVEIQSR.KF.Y.A...QRN.M..YLT..GITLF.L.TF........AVVRTL.NIVWELLGLKDEYRA-k.....................................................................
A0A0K0JPS3_BRUMA/19-155                ..................................................MTLQW.FVVAL.ILY.LEIAV.VLLL.L........L.P.W...IR.PT........L...wSKFF.K.............S..R..V.....VN..T......F..E....K..H.AT..V..Y........F..............I..S.ALCI......L..LL.......LF..A................DAIR.E......VR.KYANEVAIE................................gSIRH.T.ADSENVVHMR.LF.R.A...QRN.L..YIS..GFALL.L.FL........IIKRLV.ALLSRGALLEAAAEA-a.....................................................................
W9WA36_9EURO/1-143                     ..................................................MTLYY.SLVFV.LLV.LEMVL.FVAL.I........I.P.M...PF.TA........K....RKLF.N.............F..I..S.....ES..P......I..V....A..K.IQ..Y..A........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMTALtkdn.........................sgagRAAA.I.GSERMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVK--my....................................................................
H2ZU99_LATCH/1-83                      .............................................vvagr-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.---V......V..VF.......FF..F................YAAR.E......VK.KYSIGEKVD.................................-LQN.N.PGAVDHVHMK.LF.R.A...QRN.L..YIA..GFALL.L.WF........LLRRLV.TLVSQHATLLASNEA-f.....................................................................
V4A1M2_LOTGI/1-135                     ..................................................MSVQW.TFIAG.VLY.VQLAV.VFIL.L........L.P.W...IK.PS........R...wQSIF.R.............S..G..I.....LA..K......I..G....S..Y.SH..I..Y........F..............N..V.FIVI......L..VI.......LF..A................DSIR.E......VR.KFSAPIEVD.................................-LNH.H.PDAETKNLMR.LF.R.A...QRN.F..YIA..GFALF.L.WF........IIRRLI.TLIANQARIEAECEA-s.....................................................................
H2V2U4_TAKRU/1-136                     ..................................................MTLQW.TVVAF.FLY.AEIGL.NLIL.C........I.P.F...IS.AK........R...wRLVF.N.............W..R..I.....WK..L......L..S....P..Y.WN..K..C........F..............F..T.MILV......L..IV.......LL..L................DAVR.E......VD.KYSRPEPLQ.................................DAKA.N.PSVYDHVHMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........IMRRIF.SLLNQIAVTLEDN---tsl...................................................................
A0A098VWA4_9MICR/1-162                 ..................................................MSLQY.SIVFS.ILI.GELSI.IALF.L........I.P.I...PF.II........K....SSIE.L.............A..L..I.....KT..S......R..S....S..L.VN..R..I........A..............M..A.IFVL......V..FI.......FF..L................DSFH.K......ML.KFHTAISELtsyagplqtdssef.....gsmnnrnmhrpqshHHHH.N.SFQSSALYST.LF.Y.A...QRN.V..YLT..GMVLV.L.FL........KMQQLI.----------------kermdnrqvisstes.......................................................
C4WVJ6_ACYPI/1-135                     ..................................................MSLQW.TIIAT.FLY.FEVGV.LMLF.L........V.P.Y...MS.AK........R...wNSLF.R.............S..R..F.....YQ..A......L..S....A..Q.AQ..W..Y........F..............T..F.LLFV......L..VL.......FL..L................DSVR.E......MR.KYSNPELSD.................................-AHQ.H.LDHEMQANMR.LF.R.A...QRN.F..YIS..GIALF.L.SF........VIKRFI.ALVTLQASLVAQSEA-s.....................................................................
A0A1E4TUR9_PACTA/1-137                 ..................................................MSIQM.LFIFV.ALI.VEMVM.LSIL.V........L.P.L...PF.VV........R....KKVV.E.............V..F..H.....ML..I......T..I....S..N.FR..I..G........M..............Y..F.IGVI......I..SI.......MF..I................DSFN.R......SS.IKASQYPVVt...............................gGSSS.R.FYLTSTELAS.RN.Y.N...QRN.M..YLT..GAVLY.F.GI........AIPTVI.SILKKLIKHKTKLEN-a.....................................................................
A0A1V6YR12_PENNA/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMAV.FLAL.V........I.P.L...PH.TV........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELSAFtkd..........................gsgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRV---rlf...................................................................
Q9W0M4_DROME/1-134                     ..................................................MSLVW.TLIAG.FLY.AEIAL.VLLL.V........L.P.V...LT.PY........R...wNRFF.K.............S..K..F.....LS..M......L..G....Q..Q.AH..I..Y........F..............L..L.IMGI......L..VI.......FL..L................EAIR.E......MR.KYSGLQQSN.................................--EV.H.LNVEMQHSMK.LF.R.A...QRN.F..YIS..GFAIF.L.AL........VIRRLV.NLICTQANLMAQSEA-s.....................................................................
A0A0C3E008_9HOMO/1-131                 ..................................................-----.-MTFF.LLA.AEMVT.FCIL.V........F.P.L...PY.TI........R....KRLF.R.............F..L..S.....EN..F......I..V....A..K.IA..Y..G........L..............K..I.SFIF......V..GI.......LF..L................DALQ.R......MF.RVAAEADIIk...............................hEGMK.D.VRTESSVAAR.KF.Y.A...QRN.M..YLT..GFCLF.L.SL........VLTRTF.YILLDLIHTQEEYAK-l.....................................................................
A0A094AJQ4_9PEZI/3-137                 ................................................pq-----.--VFM.LLV.AEMGL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAte............................qsqSGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
A0A1V6V7M6_9EURO/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMAV.FLAL.V........I.P.L...PH.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQQELSAFtkd..........................gpgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRVR--ll....................................................................
A2QAU7_ASPNC/21-152                    ..............................................mshq-----.-----.---.-HMAV.FMGL.I........I.P.L...PF.TV........K....RKLF.A.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFgke..........................ggtmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEDRVR--ll....................................................................
A0A1S3JN78_LINUN/1-137                 ..................................................MSFQW.TFIAT.FLY.VEIFL.VVLL.L........L.P.F...IS.PT........T...wQKLF.K.............S..R..F.....LM..I......I..T....S..Y.AN..Y..Y........F..............T..V.FIVI......L..MV.......VF..G................DAIR.E......VY.KYSGEEKML................................dPKTT.H.HDTLEHIQLR.LF.R.S...QRN.L..YIA..GFALF.L.WL........VLKRLV.VLISAAATLTAQR---dva...................................................................
A0A093V8W4_TALMA/1-143                 ..................................................MTLYY.TLVFM.LLV.FEMLV.FLAL.I........V.P.L...PY.TF........K....RKLF.A.............F..I..S.....ES..P......V..V....A..K.LQ..Y..G........L..............R..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEMSAFskds.........................tgigRAAA.L.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMIVEVLRLEDRIK--ll....................................................................
A0A1E3I033_9TREE/1-138                 ..................................................MTLYY.SICFA.LLM.AELGL.FCTI.V........C.P.M...PF.AL........R....KKMF.H.............F..L..S.....EN..P......I..V....A..K.VQ..Y..G........L..............K..I.TFIF......V..AV.......LF..V................DALQ.R......MV.RIAQEGATAk..............................mkSDIS.D.VRAETNYAAR.RF.Y.A...QRN.L..YLT..GATLF.L.SL........LLARVF.YIILDFITVQESYTA-l.....................................................................
A0A024U7N4_9STRA/2-128                 ..............................................finl-----.-MMFW.LMC.VEGLI.CILL.C........I.P.F...FK.HA........T....QAVV.T.............F..L..S.....SN..V......F..T....P..K.SH..LttA........G..............Y..G.ILAL......V..FI.......MF..L................ANLQ.T......TY.NHHMSDEA-.................................----.-.--MSDGFRIR.LL.A.A...QRD.M..YIS..GICLF.L.NL........LLQMLY.SSMVLNIKLEKSL---gam...................................................................
M4E0E6_BRARP/1-126                     ..................................................MALQW.LILSY.VVA.AEVAI.AVIL.T........L.P.Y...PM.LV........K....KRVV.S.............L..V..S.....LI..L......Q..-....-..P.AA..S..I........-..............-..-.-VAF......A..GF.......QL..L................DLYW.K......N-.--EHRLMCS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AAGIL.L.YW........CIFRIC.KYNKDLEHLEE-----lekrc.................................................................
W9IEN6_FUSOX/1-143                     ..................................................MTLYY.TLVFM.LLV.FEMAL.FMLL.I........V.P.M...PF.NV........K....RKIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAseqs.........................kqggGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRA-y.....................................................................
A0A1S3JNW1_LINUN/1-96                  ................................................mi-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......I..T....S..Y.AN..Y..Y........F..............T..V.FIVI......L..MV.......VF..G................DAIR.E......VY.KYSGEEKML................................dPKTT.H.HDTLEHIQLR.LF.R.S...QRN.L..YIA..GFALF.L.WL........VLKRLV.VLISAAATLTAQR---dva...................................................................
A0A1G4JUG6_9SACH/1-141                 ..................................................MSVYL.SVLFA.LLT.FEMAI.LFVL.V........L.P.L...HY.KM........R....KVLV.S.............T..Y..F.....RF..M......S..Y....T..Q.VK..T..V........I..............W..I.VIGL......V..SL.......LF..V................DSWK.R......SQ.ISVFLHHHQtas...........................gadPNAV.G.TVTPVQALAS.RA.Y.N...QRN.I..YIS..GFILY.F.CF........CIPTVI.SVVKRLVKYETLM---rek...................................................................
U6NKJ2_HAECO/1-138                     ..................................................MTLQW.TIIAA.VLY.IEIAV.TFIL.L........L.P.W...IR.PS........I...wSKLF.K.............S..R..I.....LT..S......L..S....A..H.AQ..I..Y........S..............Y..A.GAFV......L..FI.......LF..A................DAVR.E......VN.KYSHVEIAMd...............................nSPRH.A.ADADAIVHMR.LF.R.A...QRN.F..YIS..GFALL.L.FL........VIKRIM.GLLSRSAQLEAASEA-a.....................................................................
A0A1J4KG37_9EUKA/4-135                 ........................................iifnsinfas-----.-----.--I.AFICL.AILL.A........F.P.F...PI.TI........R....RKIS.R.............I..S..I.....KL..F......F..-....-..-.--..-..P........I..............F..G.LISF......F..LI.......IF..L................QEFF.E......QQ.KYGFRRKEA................................aNGEK.G.ASNLRYFASE.YF.R.H...QRN.M..YIA..LTSI-.-.--........------.----------------acgsvfliltrllrsylnehntlleqlevr........................................
A0A093IM91_FULGA/1-137                 ..................................................MTFQW.TAVAT.FLY.GEIGV.ILVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSAVHVNE................................kAANV.N.TNAFDHIQMN.LL.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTV.TLLTQLAKGMASHA--al....................................................................
S7XH23_SPRLO/65-112                    ..........................................kittdyys-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.-I.Y.Y...ERN.A..YIS..GFTLF.L.FL........VYTTFL.SLIKKIIKEEENA---ail...................................................................
A0A0R3UGD3_9CEST/1-139                 ..................................................MSFLW.TLTAA.FLY.TEAAV.ITLL.L........L.P.I...IS.SK........T...wNRIF.K.............S..R..F.....VG..M......F..T....A..Y.AS..L..Y........F..............N..G.CLII......L..GL.......ML..I................EALR.H......VS.AQNKVYQELk..............................snPSLY.K.PETESVYLMK.LF.R.A...QRN.L..YIS..GFSLF.L.WF........VFRRLV.TLIADHARVTVA----geas..................................................................
A0A066WBQ8_9BASI/1-138                 ..................................................MTLYY.SIVFG.LLV.LEMSM.FFVL.I........I.P.L...PF.TW........R....RKLF.H.............F..L..A.....TN..P......I..V....A..Q.IQ..Y..A........L..............K..I.TFIF......V..GV.......LF..I................DAVQ.R......ML.KAVQEDKEKr..............................egRISE.A.LMGGVNYAAR.KF.Y.A...QRN.M..YLT..GFTLF.L.SL........ILSRTY.SLILDLINVQEELV--al....................................................................
W6MS14_9ASCO/1-137                     ..................................................MSLQM.TLIFL.LLL.GDMVL.LSLY.V........L.P.L...PH.TV........Q....KKLV.L.............V..F..N.....KL..R......Q..S....Q..H.AK..I..G........M..............I..F.TMSV......V..GL.......LF..I................DAAR.V......GL.GAPAEPEQHh..............................hhKWSI.P.VSASWPHKAK.IF.Y.A...QRN.L..YIS..GAVLF.F.SF........AILVVH.FHVEALTVAKDS----lsk...................................................................
U5HHU3_USTV1/1-138                     ..................................................MAIPN.QIVFG.LLL.FEIAT.FIVL.I........V.P.L...PF.TW........R....RALF.K.............A..I..A.....ES..Q......L..V....A..K.AQ..Y..A........L..............K..I.TFIF......V..FL.......LF..A................DAVN.H......ML.KIQREGVLNk..............................qlGQRS.D.LRGESDYRSR.KF.L.S...ERN.F..YLH..GFTLF.L.SL........ILSRTY.SLVLDLIKAQEDL---all...................................................................
D7T8H7_VITVI/1-128                     ..................................................MGLQW.MVLGY.VVA.AEAAI.ALVI.T........L.P.S...PK.LV........K....SRIV.S.............L..V..S.....LL..L......S..-....P..-.--..-..-........L..............A..G.VIPF......A..AF.......QL..L................DIYW.K......N-.--EHRLICT.................................SETC.T.AGERDRYEKS.IY.K.A...QRN.A..LLC..GAACL.L.YW........SICAIC.KYYKKIQSLEE-----vekkykd...............................................................
A0A085N902_9BILA/140-216               ...............................................alr-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..I................DGIR.E......VR.KYSEADKSM................................dIQYH.T.AQADAIVHMR.LF.R.A...QRN.L..YIS..GFALF.L.WF........VIRRVV.DLIGREAMLMASAEA-a.....................................................................
E2BQM5_HARSA/1-136                     ..................................................MSLQW.TLIAG.FLY.TEIII.VLML.V........L.P.V...AS.PT........R...wQRLF.K.............S..R..F.....LQ..S......L..S....S..R.AS..F..Y........F..............V..I.LLGV......L..VL.......FL..L................DAIR.E......MR.KYSASLNHS.................................DHHH.Q.LNLEMQENMR.LF.R.A...QRN.F..YIS..GFALF.L.SL........VIRRLV.LLISIQASLLAQNEA-a.....................................................................
A0A0N5BA44_STREA/1-138                 ..................................................MSIQW.TIVAG.ILY.TEVAF.VILL.V........L.P.W...IR.PT........V...wKKFF.N.............S..R..I.....IT..A......I..S....H..K.ST..I..A........S..............Y..S.TIFV......L..TL.......LF..L................DAAR.E......CA.KYSNTSLTEn...............................tLLKG.A.ADVDTALHMR.LF.R.S...QRN.L..YIS..GFALL.L.FL........VINRII.GLLVRSAQLQASSEA-a.....................................................................
W5EJK3_WHEAT/84-209                    ..................................................MGLQW.MLLTC.VVG.AEAAV.AALL.T........L.P.A...PR.AV........R....AQIV.G.............L..T..S.....ML..-......-..L....Q..P.M-..-..-........-..............A..A.VLPF......A..AF.......QL..L................DIYW.K......N-.--EHRLICT.................................GEMC.T.SEERVRFEKS.IF.K.S...QRN.V..ILC..VSVFI.L.YW........SIYRIC.KFNKDIKALE------evekri................................................................
B4QLF9_DROSI/1-134                     ..................................................MSLVW.TLIAG.FLY.AEIAL.VLLL.V........L.P.V...LT.PY........R...wNRFF.K.............S..K..F.....LS..M......L..G....Q..Q.AH..I..Y........F..............L..L.IMGI......L..VI.......FL..L................EAIR.E......MR.KYSGLQQSN.................................--EV.H.LNVEMQHSMK.LF.R.A...QRN.F..YIS..GFAIF.L.AL........VIRRLV.NLICTQANLLAQSEA-s.....................................................................
A0A2A9PIA7_9HYPO/1-142                 ..................................................MTLYY.TLVFM.LLM.FEMGL.FMLL.L........V.P.L...PF.NV........K....RRIF.T.............F..I..S.....EN..P......L..V....A..K.VE..Y..W........M..............K..I.TFVF......I..LI.......LF..V................DSVN.R......VY.RVQQELLAAseq..........................sskgSTTI.I.GSERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIIQVMRLEDRLKS-y.....................................................................
G3ASA5_SPAPN/1-141                     ..................................................MSLQM.SLVFC.TMI.AQMII.LLVL.V........L.P.L...PQ.VV........R....QQIV.S.............L..A..Q.....VC..Q......N..S....Q..N.FK..V..G........V..............I..F.SLML......M..TL.......QF..L................DCLK.R......LH.RYSGAVDNPyfd...........................ssnNHHY.E.HSLSYDQLAS.KF.Y.A...QRN.L..YLS..GAILY.L.ML........AIATVL.AIVKKMVSKEAEYRE-l.....................................................................
R0MCF0_NOSB1/64-109                    .............................................edril-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.AY.Y.T...ERN.F..YLT..GFTLY.L.AL........IFKMFT.TMLIKLYKEEQSA---kil...................................................................
A0A0M3HT46_ASCLU/1-71                  ..................................................MSLQW.SAIAL.ILY.VEIAA.VLML.L........L.P.W...IR.PS........F...wNRVF.K.............S..R..L.....VR..W......F..E....R..H.AH..V..Y........S..............I..A.GTAV......L..IL.......LX..-................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------wavswnrv..............................................................
E3RG76_PYRTT/1-141                     ..................................................MTLYY.SLVFL.LLV.TEMLI.FCAL.I........V.P.L...PF.TW........R....RRLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSGSddq...........................grsGVAA.G.GIERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEEVK--gl....................................................................
A0A091SB79_NESNO/1-99                  ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........R...wQKIF.M.............I..P..L.....WS..K......V..A....V..F.WN..K..M........F..............L..T.IIVL......L..II.......LF..L................DAVR.E......VR.KYSAVHVNE.................................----.-.--KAANVNSS.AF.D.H...IQN.L..YLS..GFSLF.L.WL........VLRRTI.TLLNQLAKEMTSHAA-l.....................................................................
W7TBU6_9STRA/49-187                    .......................................pwqlflyfifp-----.-----.---.IPLVF.LVLI.S........L.P.F...PA.RY........R....AKIR.V.............G..I..L.....NAlnR......I..SflrfD..Y.GG..A..S........I..............S..L.IAII......I..LI.......AL..L................GLIF.S......AN.DSLNARRAE.................................NQAH.F.FAEKKELRCK.RW.R.A...ERN.F..WLS..VLGCV.L.WV........VLLRIQ.TLLMDVGPLEERLK--ra....................................................................
W9XTH3_9EURO/1-128                     ..................................................-----.-----.---.--MVL.FVAL.I........I.P.L...PF.TV........K....RKMF.N.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMSALmkdt.........................sgagRAAA.M.GSDRMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVK--ly....................................................................
C5DFF5_LACTC/200-334                   ..................................................MTLYY.TFVFG.ILA.FEMVM.FLLL.A........M.P.V...PS.KF........R....KPIT.M.............A..L..I.....KP..F......R..L....T..Q.VQ..V..A........I..............K..C.VLAF......I..LL.......LF..I................DTIN.R......VY.SINSELSQT.................................PLAS.G.VSDRNEVQSR.KF.Y.A...QRN.M..YLT..GITLF.L.TF........TVFRTY.GLVWELLEMKEKFRA-v.....................................................................
A0A168KXF8_ABSGL/1-122                 ..............................................mtfg-----.-----.---.-----.ILVI.E........L.P.L...PS.HW........R....RAML.K.............F..V..S.....TS..P......L..V....A..K.AL..Y..V........L..............K..I.VFGF......I..FV.......LF..I................DTIN.R......LQ.RIDSVQEDE................................qRGGH.D.YSYEANMKAN.KF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILDRTS.TLVIQMLKREEELEN-a.....................................................................
E2R4U9_CANLF/22-157                    ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAVEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A0E0K4Z5_ORYPU/1-127                 ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.GL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........-..............M..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCDD--.................................EHHC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.SLVVRLDQLQQRVDK-l.....................................................................
A0A095A6L7_SCHHA/42-145                ..............................iseymscsnvltskipsykc-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.-YRF......F..EI.......LF..I................EALR.N......IW.VLRQAYNSIk..............................dhPHEM.R.PETESLYLMR.MF.R.A...QRN.F..YIT..GFSLF.V.WF........VLHRLV.SLLSEHAKMQASEEA-s.....................................................................
A0A0L8FRT6_OCTBM/1-138                 ..................................................MGLQW.TLISC.FLY.FEIGL.CVLF.M........L.P.F...IS.PQ........V...wRKIF.K.............S..R..L.....LS..F......L..S....N..F.SY..F..Y........V..............R..L.LMLG......L..GV.......AF..L................SSIS.Q......LR.KYDIDSDKLe...............................dVTLS.M.PGAAQNYHIH.LL.R.A...QRN.F..YIS..GFTLF.L.WM........ILNRIV.QLITAQAQLQADLKA-t.....................................................................
A0A0B2WTJ8_9HYPO/1-49                  ..................................................MTLYY.SIVFF.LLV.LEMVL.FMLL.L........V.P.L...PY.TA........K....RKVF.T.............Y..A..S.....PS..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------pppsmfrg..............................................................
A0A0B7NDF8_9FUNG/1-135                 ..................................................MALYY.GIVFG.ILT.FE---.----.-........L.P.I...PT.RW........Q....KPVF.R.............W..L..A.....TS..P......T..I....A..H.AQ..Y..I........M..............K..I.VFVF......I..FV.......LF..L................DSVN.T......LR.AFYDVVNSEdeng.........................gvpsVGNS.D.FRAQVGQAAK.KF.Y.A...QRN.L..YLT..GFTIL.L.LL........ILNKIK.TMAMDYIRLEDQF---iel...................................................................
G3P6P0_GASAC/1-136                     ..................................................MTLQW.TAVAL.FLY.AEIAV.NLIL.C........I.P.F...IS.AR........R...wRSVF.S.............W..R..I.....WN..W......L..S....P..Y.WN..K..C........F..............F..T.MIMV......L..IV.......LF..L................DAVR.E......VH.KYSGPEPMQ.................................DAKV.N.PNVYDNVHMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........IMRRIV.TLLNQLAVTVESS---agl...................................................................
A0A1X7VSC0_AMPQE/1-135                 ..................................................MTLQW.QVVAF.SLY.AEIFL.TIIL.I........L.P.L...LK.PS........T...wKYIF.S.............I..R..I.....FS..G......L..K....A..L.WK..T..I........F..............F..A.SLLI......L..VV.......LF..V................DSIR.T......MN.KYNDASIDK.................................-PGM.T.LDTKLDIRLK.QC.R.G...QRN.F..YIT..GFSLF.L.MF........IIYRLV.VLLFERASLEANHQA-a.....................................................................
J3P9B1_GAGT3/1-141                     ..................................................MTLYY.TLVFV.LLM.TEMAV.FMML.I........L.P.V...PF.TI........R....RKMF.N.............F..I..S.....EN..P......L..V....A..K.VQ..Y..A........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAtdn...........................sknTATI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.SMILEVLRLEEKVKQ-y.....................................................................
A0A1E1LJQ2_9HELO/110-245               ................................................rr-----.NAVFL.LLV.AEMAL.FMLL.I........V.P.L...PF.TI........R....RKMF.T.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELAETnk.............................tpGASV.M.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEEKVKK-y.....................................................................
A0A0L0SXV2_ALLMA/1-145                 ..................................................MSIPN.RLALV.LLI.TEIIV.FLIL.V........L.P.M...PR.SV........R....KTIT.K.............F..I..T.....QS..W......I..V....T..K.LV..T..A........F..............R..W.TFIF......L..TL.......LF..I................DSFT.R......QY.KMTQERAEAieegh.......................yhhqhGNLG.I.ITGDLDPRAK.LY.Y.A...QRN.M..YMT..GFALF.L.MV........VLDRYR.AVLLELVRSEEQVAE-l.....................................................................
A0A165QX07_9HOMO/1-138                 ..................................................MTIYY.NLTFL.LLA.SEMVT.FCVL.V........A.P.L...PY.GV........R....RRLF.H.............F..L..S.....ES..P......I..V....A..K.FA..Y..G........L..............K..I.SFIF......V..GI.......LF..V................DALQ.R......MF.RVTTESDVAk..............................qtGQAH.D.VRTETNFAAR.KF.Y.S...QRN.V..YLT..GFCLF.L.SL........VLTRTF.YILLDLIHTQEEYAK-l.....................................................................
A0A1S3WHX0_ERIEU/1-137                 ..................................................MTLQW.AAVAT.FLY.AEIGL.ILLF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....S..F.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSSTPIIE................................kSSAS.K.PGSFDHIQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
M0TV32_MUSAM/1-126                     ..................................................MGLQW.VILAG.VVA.MEAAV.AVLL.T........L.P.A...PR.LV........K....SRIV.A.............L..A..S.....LL..L......-..Q....P..G.AS..I..L........P..............F..A.AFQF......L..DL.......RW..K................NEHR.L......MC.TFE------.................................--VC.T.TEERTRYEKS.IF.K.A...QRN.V..ILC..VSACL.L.YW........CIFRIC.KYHKEIRELEEV----ekhl..................................................................
W7LMX2_GIBM7/1-143                     ..................................................MTLYY.TLVFM.LLV.FEMAL.FMLL.I........V.P.M...PF.NV........K....RKIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAseqs.........................kqggGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRA-y.....................................................................
H2YK38_CIOSA/1-137                     ..................................................MSIQW.TFVAG.FLY.VEIAL.CILL.C........L.P.F...IS.CK........R...wQSFL.R.............S..R..L.....FA..L......F..I....S..Y.GN..L..Y........F..............L..V.LISI......L..CL.......LF..A................DAVR.E......VR.KYSLPDAQS................................vNLSN.N.PNAQDHVLMM.LF.R.A...QRN.L..YIS..GFALF.L.WL........VLRRLV.LLVSNNATLEAQSEA-f.....................................................................
A0A177WK27_BATDE/1-123                 ..................................................MSLFN.KLTYY.VLW.IEVLF.YLLS.L........I.P.LsfiAA.KT........R....KDAM.N.............W..F..G.....KI..S......S..N....E..Y.AV..W..T........A..............R..I.ALLI......I..SG.......VF..A................DNVL.R......LF.KLESETHDHghh..........................hnhhSGSS.E.YTMELQSKYQ.RF.Y.S...QRN.V..YMS..AFTLF.M.IL........------.----------------......................................................................
A0A1D6M104_MAIZE/1-124                 ................................................mi-----.QLLFS.LLA.AEAAL.VLAL.L........F.P.T...PV.R-........-....-RLA.L.............L..A..I.....DR..A......K..R....G..R.GP..V..M........A..............K..T.IAGT......M..LL.......VL..V................SAFY.S......VA.KIRRREGEL.................................G-QL.T.PTDQVLASRH.LL.E.A...---.-..SLM..GYSLF.L.GL........IIDRLH.HYIRELRMLRKDMEA-v.....................................................................
H6C148_EXODN/1-143                     ..................................................MTLYY.SLVFV.LLV.VEMAL.FIAL.I........V.P.L...PF.TV........K....RKMF.N.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMSALlkdn.........................tgagRAAA.I.GSDRMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVK--my....................................................................
A0A212EZ42_DANPL/1-134                 ..................................................MSLQW.TIIAS.FLY.AEIAF.VLLL.T........L.P.I...AS.PA........R...wNKFF.K.............S..K..F.....LA..Y......M..T....G..Q.AS..I..Y........F..............V..V.LIGV......L..VL.......CL..L................DAIR.E......IQ.KYSNVESSD.................................--HQ.H.LDAEMQGNMR.LF.R.A...QRN.L..YIS..GIALF.L.LV........VIRRLI.QMICELATLYAQSEA-n.....................................................................
A0A063C4V9_9HYPO/1-142                 ..................................................MTLYY.TLVFF.LLV.VEMGL.FMLL.L........V.P.L...PF.TA........K....RKVF.T.............F..I..S.....EN..P......V..I....S..K.IM..H..W........M..............R..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLEVLAAseq..........................tskgTAAV.L.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRMY.HMIIDNMHLEDKVRA-f.....................................................................
A0A087YI64_POEFO/1-135                 ..................................................MSLQW.TAVAT.FLY.AEVFL.VLLL.C........I.P.F...VS.PK........R...wSRIF.K.............S..R..L.....VQ..T......V..A....L..Y.GN..T..W........F..............M..V.AIAI......L..VF.......LL..I................DAFR.E......AR.KYSLTDKVD.................................-VTN.N.PTAIEHIHMK.LF.R.A...QRN.E..YIA..GFALL.L.CL........LLRRLA.TLLSQQATLMASNEA-f.....................................................................
A0A0H2SAK3_9HOMO/1-140                 ..................................................MTLHY.SLTFM.LLA.AEMAT.FVFV.V........A.P.L...PY.AV........R....RKVF.T.............F..L..S.....ES..Y......I..V....S..K.LA..Y..G........L..............K..I.SFIF......V..GV.......LF..L................DAMQ.R......MY.RISAEAEIAkq............................ggtTPIH.D.ARAEASFAAR.KF.Y.A...QRN.V..YLT..GFCLF.L.SL........ILARTF.YIILDFIHTQDSY---lkl...................................................................
A0A2B4RUZ3_STYPI/1-138                 ..................................................MTVQW.TLAAA.FLY.AEIGV.LLLF.C........F.P.Y...IS.AK........R...wNQIF.N.............S..R..T.....VA..T......L..F....E..Y.GN..F..Y........F..............Y..V.FVFV......M..GL.......LL..A................DSIR.E......SR.KYGKTQSSGq...............................vDLHN.N.PQTEAIANMR.LF.R.A...QRN.M..YIS..GFSLF.L.LL........VLRRVI.RLLSQNSVLEASSEA-s.....................................................................
A0A077ZIX5_TRITR/1-49                  ..................................................MTLQW.TVVAV.FLY.LEALL.LGFL.L........L.P.W...IR.PP........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------imlltgsiessliakydca...................................................
A0A287UNZ8_HORVV/66-192                ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.AL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........M..............S..-.VVPF......C..LF.......LL..M................DIYW.K......YE.MRPTCDDE-.................................-HAC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.SLVVKLDHLQQRVDK-l.....................................................................
F6ZWF1_HORSE/1-137                     ..................................................MTLQW.VAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYASTPAIE................................kNSAS.R.PSAYEHIHMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A150GFZ1_GONPE/3-73                  .......................................lasahhtyhls-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.-----QTGM.................................PETL.T.PNQRTALLAR.RW.R.E...ERN.F..WIA..TLTFL.L.WG........LLFRFY.QLMLDHVAVRDRLR--hl....................................................................
B3RYU9_TRIAD/1-134                     ..................................................MGLQW.NIAAG.VLY.TEIFV.LLIL.C........L.P.F...IS.YS........R...wHKIL.R.............S..R..I.....IT..Y......I..R....S..Y.GN..Q..L........F..............V..I.CVAF......L..II.......LL..L................DSIR.E......MM.KDPKIRGQG.................................S--D.K.IHDNLMLQIK.LH.R.A...QRN.Y..YIT..GFALL.C.LL........FLRRIT.SLMSSAAVVEASKEA-a.....................................................................
A0A2H3I1C4_9EURO/1-143                 ..................................................MTLYY.TLVFM.LLV.FEMLV.FLAL.I........V.P.L...PY.TV........K....RKLF.A.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........L..............R..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEMSAFskdt.........................tgvgRAAA.L.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMIVEVLRLEDRVK--ll....................................................................
T1J0F9_STRMM/99-236                    ..................................................MSFQW.TIIAA.FLY.AEIGI.VFIL.L........L.P.F...IS.PH........R...wQKLL.K.............S..R..I.....FL..S......L..G....N..Q.SS..I..Y........F..............N..V.FMII......L..FL.......FF..F................DAIR.E......IK.RYTLEVDNIk...............................hDSHT.H.FDTDLQTHMK.LF.R.S...QRN.F..YIS..GFALF.L.WL........VLRRLI.TLISTQATLANDKEA-a.....................................................................
H2LHS9_ORYLA/1-136                     ..................................................MSLQW.TAVAF.FLY.AEIVV.NLIL.C........I.P.F...IS.AH........R...wRVVF.R.............W..R..I.....WG..W......L..S....S..Y.WN..K..A........F..............F..A.MITV......L..VV.......LF..I................DAVR.E......VQ.KYSAPQSTQ.................................DATV.N.PNLYDNVHMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........TMCRVV.TLLNKTAITLENSA--el....................................................................
A0A094EZB0_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMGL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAte............................qsqTGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
G8BIL8_CANPC/1-133                     ..................................................MSLQM.SLVFG.TMI.FQMIT.LLLF.V........L.P.L...PL.MV........R....SQIV.T.............L..Y..T.....KI..T......T..A....Q..N.FR..I..F........L..............M..F.SITL......M..SL.......QF..Y................DCIQ.R......LE.KYRRVQEND.................................V--L.Q.GFVNYDKLAS.KF.Y.S...QRN.L..YLS..GAILY.L.LM........GIYTVA.SIVKKLVLKEKLYRE-l.....................................................................
H3E114_PRIPA/1-73                      ..................................................MTIEW.SVVAG.LLY.TEIAV.TILL.L........V.P.W...IK.PK........I...wRTIF.K.............S..R..I.....GH..A......I..G....Q..Y.AK..Q..S........A..............L..I.VGAL......L..FM.......LF..V................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------artaaadav.............................................................
A0A0V0U550_9BILA/41-147                ...............................................llw-----.-----.---.-----.----.-........-.-.-...--.--........-....QRLF.R.............S..R..F.....LR..F......I..Q....T..Y.SS..L..Y........I..............Y..C.FALM......L..LL.......LF..L................DALR.E......VR.KYSDADLVK.................................QSVG.N.VQGEFNTHMR.LF.R.A...QRN.L..YIS..GAALF.L.WF........AIQRVA.SMISREAMLIASAEA-a.....................................................................
F6RP12_ORNAN/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..F.....VQ..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDNVTETV.................................NLQT.T.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........HNQKMV.VLASQKRSMGA-----sspsf.................................................................
A0A151U293_CAJCA/1-124                 ................................................mi-----.QLLFT.LLM.IQVAF.IL--.I........L.S.F...AN.PI........R....KLVV.K.............G..L..D.....LL..-......K..Q....G..R.GP..L..V........T..............K..T.VAAT......M..LV.......VF..G................STMY.T......IT.KIQKRSKDA.................................-GIV.N.PTDEVLMAHR.LL.E.A...S--.-..-LL..GFSLF.L.GL........VIDRQH.YYIREINLLRKNLE--ta....................................................................
F7HKA0_MACMU/1-156                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................rSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snksvlktqaentnkaakkfmeene.............................................
M5BY17_THACB/1-138                     ..................................................MTIYY.TLTFL.LLA.SEMVT.FCLL.V........M.P.L...PF.TA........R....QKLF.R.............F..L..S.....TS..V......I..V....A..K.IA..Y..A........L..............K..I.SFIF......I..AV.......LF..V................DAVQ.R......ML.RVSAEGQQAk..............................qaAGAT.D.VRTETNYAAK.KF.Y.T...QRN.M..YLT..GFTLF.L.SL........ILTRTY.YILLDLIHSQEQYAE-l.....................................................................
W9C8N0_9HELO/1-140                     ..................................................MTLYY.SLVFV.LLV.AEMAL.FMLL.I........V.P.L...PF.TI........R....RKMF.N.............F..I..S.....ES..R......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAEAnk............................nqaGNPV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEEKVN--ry....................................................................
A0A1B7NXR8_9EURO/1-127                 ..................................................-----.-----.---.--MVI.FVGL.I........I.P.L...PF.KV........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELSSYske..........................mggpGTAA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDRVKQ-l.....................................................................
F4WLT4_ACREC/1-139                     ..................................................MSLQW.TLIAG.FLY.IEVAI.VLLL.V........L.P.V...AS.PT........R...wQKFF.K.............S..R..F.....LQ..S......L..N....N..Q.AS..I..Y........F..............V..V.LLGV......L..VL.......FL..L................DAIR.E......MR.KYSTSLDHT.................................DHHH.Q.LNVEMQGHKL.CH.Y.SayiNTN.F..YIS..GFALF.L.SL........VIRRLV.ILISTQASLLAQNEA-a.....................................................................
K5URX1_PHACS/1-139                     ..................................................MTVYY.TITFL.LLA.AEMGT.FCVL.V........A.P.L...PY.AV........R....KRLL.R.............F..L..S.....EN..P......L..I....A..K.LA..Y..A........L..............K..I.TFIF......V..GV.......LF..V................DALQ.R......MW.RVTAEADLArn.............................qgGTLH.D.ARAETGFAAR.KF.Y.A...QRN.T..YLT..GFCLF.L.SL........VLTRTF.YILLDLVHTQEEYAK-l.....................................................................
A0A226M9U3_COLVI/1-135                 ..................................................MSLQW.TVVAT.FLY.AEVFL.VLLL.C........V.P.F...VS.PT........R...wQKIF.K.............S..R..L.....VG..L......A..V....A..Y.GN..T..A........F..............V..V.LIVI......L..VL.......LL..L................DAYR.E......TR.KYGAAERAA.................................-LPS.T.PGALEHFHMR.LF.R.A...QRN.L..YLA..GFALL.L.SF........LLRRLV.TLISQQALLGASSQA-f.....................................................................
A0A175W9J1_9PEZI/1-142                 ..................................................MTLYY.TLVFL.LLV.AEMAL.FMLL.I........L.P.L...PF.TM........R....RKMF.T.............F..I..S.....EN..P......V..V....A..K.VQ..Y..W........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAAAten..........................agnpAPAI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEEKIKK-y.....................................................................
J7RL11_KAZNA/1-136                     ..................................................MSLYY.SLIFV.ILV.IEISM.FSLL.A........M.P.I...PT.KF........R....KPLT.Y.............V..L..I.....KP..F......R..Y....N..T.VT..L..S........A..............K..C.VIAF......I..LL.......LF..L................DSIN.K......VY.NIDTRELSG................................pGGII.N.PAEKIEVYSR.KF.L.Q...QRN.M..YLT..GITLF.L.TF........VVVRTF.ALVQELIDLKQVYR--ad....................................................................
A0A0A1TF84_9HYPO/1-142                 ..................................................MTLYY.TIVFM.LLV.FEMGV.FMML.I........I.P.F...PN.TI........R....RKIF.T.............F..L..S.....EN..P......V..V....A..S.IM..Y..A........M..............K..I.TFIF......I..LV.......LF..I................DSVQ.R......VY.RVQLELAIAtek..........................iakgGASV.L.GHERFEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VLITENIRLQDRLTA-f.....................................................................
A0A1S3AH48_ERIEU/1-136                 ..................................................MSLQW.TAVAT.FLY.AEVFL.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............L..V.LIVI......L..VL.......LL..L................DAFR.E......TR.KYDDVTEKV.................................NLQN.N.PGAVEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A1S3SFR6_SALSA/1-136                 ..................................................MTLQW.TAVAL.FLY.VEIGV.LLIL.C........L.P.V...VS.AT........R...wQSIF.Q.............L..R..I.....WN..K......M..A....R..F.WN..K..F........F..............L..A.MIII......L..IV.......LF..L................DAVR.E......VR.KYSGAGNSK.................................DANL.H.PNMFDNLHMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........VLRRVI.TLINQLATASSTT---asl...................................................................
A0A0V1MTD6_9BILA/181-301               ......................................cgsictfmyass-----.-----.---.-----.----.-........-.-.-...MD.ST........E....QRLF.R.............S..R..F.....LR..F......I..Q....T..Y.SS..F..Y........I..............Y..C.FAIM......L..LL.......LF..L................DALR.E......VR.KYSDADLVK.................................QSVG.N.VQGEFNTHMR.LF.R.A...QRN.L..YIS..GAALF.L.WF........AIQRVA.SMIRREAMLIASAEA-a.....................................................................
A0A075AW24_9FUNG/1-54                  ................................................mk-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.D.AHTDTQIHAK.MF.Y.S...QRN.M..YLT..GFTLF.L.AI........VCSRLI.AILSEIMKHEEKIA--vv....................................................................
A0A2A4J9Q0_HELVI/1-134                 ..................................................MSLQW.TIIAT.FLY.AEIAI.VLLL.T........L.P.I...AS.PS........K...wQKFF.K.............S..K..F.....LA..Y......I..S....G..Q.AS..I..Y........F..............V..I.LIGV......L..VL.......CL..L................DAIR.E......MQ.KYSNIESSD.................................--HQ.H.LDAEMQGNMR.LF.R.A...QRN.F..YIS..GFALF.L.LV........VIRRLV.QLISELATLLAQSEA-n.....................................................................
C4XZI1_CLAL4/1-140                     ..................................................MSIQM.SLVFG.ALV.AQMSF.LILL.L........L.P.L...PY.VV........R....TSIL.D.............T..Y..S.....VI..R......K..N....T..N.VK..V..G........F..............N..F.ALLL......L..GL.......QF..F................DCVK.K......LQ.RYSNVQSPYfa............................qmqQQMT.G.GQLSYDQLAS.KF.Y.A...QRN.L..YIT..GAVLY.L.SL........AINTVY.SILVKLVKKETDYRN-l.....................................................................
T0LDA9_COLGC/1-141                     ..................................................MTLYY.TLVFM.LLM.AEMGL.FMLL.I........V.P.L...PF.AI........K....RRLF.T.............F..I..S.....ES..P......I..V....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELALAtek...........................qnsGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRS-y.....................................................................
A0A1G4MEV1_LACFM/1-142                 ..................................................MSVYL.SVLFA.LLT.SEMAV.LFVL.V........L.P.L...HY.KI........R....KAVV.A.............T..Y..D.....RA..M......S..T....T..Q.MQ..T..V........I..............V..I.VGAL......V..AL.......LF..V................DSWR.R......AQ.ISVFLHHHAsaa..........................ssadPAGQ.G.SVTPIQALAS.RS.Y.N...QRN.I..YIS..GFILY.F.SF........CIPTVM.SVVRRLVKYETL----vrdq..................................................................
R7SWD3_DICSQ/1-123                     ..................................................-----.-----.---.--MAT.FVLL.V........S.P.L...PY.VV........R....KRLF.H.............F..L..S.....ES..P......L..V....A..K.LA..Y..G........V..............K..I.AFIF......I..TI.......LF..V................DALQ.R......MW.RITAEADLTk..............................sqQGTA.D.VRAETNIAAR.KF.Y.A...QRN.V..YLT..GFCLF.L.SL........ILTRTF.YILLDLIHTQEEYAK-l.....................................................................
A0A1Y1V628_9FUNG/1-137                 .............................................mtpfi-----.LVISY.ILC.IQCLL.ILYL.A........V.P.W...RV.PF........R....RTIV.Ek...........fT..S..S.....KN..D......L..L....N..K.IR..F..C........Y..............G..V.IQVF......I..AL.......LL..A................DNIR.H......LK.YLNEQVDRV................................yKFPT.S.QEVITQTTKS.LH.K.T...QRD.F..YIL..IFTLY.S.GI........VLYLLH.LVVL------------rsgryrkerng...........................................................
M1CK78_SOLTU/1-126                     ..................................................MALQW.MILTY.VVA.AEAAI.AILL.T........L.P.S...PK.AL........K....SRFV.S.............L..I..S.....LA..L......Q..P....S..-.--..-..-........L..............-..F.VVPF......S..AF.......QL..L................DIYW.K......NE.H---RLMCT.................................GEIC.T.ASERDRYEKS.IY.K.A...QRN.V..ILC..LAACL.L.YW........CIYRVC.KYYKEIQSIEE-----veksy.................................................................
BAP31_MOUSE/1-136                      ..................................................MSLQW.TTVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKVF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IL.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A1L9SEL8_9EURO/1-127                 ..................................................-----.-----.---.--MAV.FLGL.I........I.P.L...PY.TV........K....RKLF.A.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAFtke..........................ggavGAAA.L.GGDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMILDVLRLEDKVR--ll....................................................................
H2LHS8_ORYLA/1-136                     ..................................................MSLQW.TAVAF.FLY.AEIVV.NLIL.C........I.P.F...IS.AH........R...wRVVF.R.............W..R..I.....WG..W......L..S....S..Y.WN..K..A........F..............F..A.MITV......L..VV.......LF..I................DAVR.E......VQ.KYSAPQSTQ.................................DATV.N.PNLYDNVHMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........TMCRVV.TLLNKTAITLENSA--el....................................................................
G0SCT2_CHATD/1-142                     ..................................................MTLYY.TLVFL.LLV.AEIAL.FMLL.I........L.P.L...PF.NV........R....RKLF.T.............F..I..S.....EN..P......I..V....A..K.FQ..Y..W........L..............K..I.TFVF......I..LV.......LF..I................DSVN.R......VY.RVQQELAATsea..........................hgngGHAI.H.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.ILILEVLRLEEKLKQ-y.....................................................................
E6ZV81_SPORE/1-138                     ..................................................MTLYY.SIVFA.LLC.FEMAM.FMVL.I........V.P.L...PF.TW........R....RKLF.H.............F..L..A.....TN..P......V..V....A..K.IQ..Y..G........L..............K..I.TFIF......V..AV.......LF..V................DAVQ.R......MV.KVMSEGETAr..............................dnRGVQ.D.VRTETNYAAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILSRTY.SLILDLINTQEELV--al....................................................................
A0A179FP83_METCM/1-141                 ..................................................MTLYY.SLVFF.LLV.LEMAL.FMLL.L........V.P.L...PY.TA........K....RKVF.S.............F..I..S.....EN..P......I..V....S..K.LM..Y..W........L..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLEVLAAsdq...........................askGAAV.L.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRMY.VMIIDTIKLEDKVRA-f.....................................................................
G7DT92_MIXOS/1-138                     ..................................................MAIYL.QMTFS.LLM.LEMGL.FISL.V........L.P.L...PF.TW........R....RAML.K.............F..L..A.....ES..P......I..V....A..K.LQ..F..G........L..............K..I.LFIF......V..VV.......LF..V................DAVQ.H......ML.RVHAEGKEIr..............................qsGMGQ.N.LRGESDWRTR.KF.L.S...ERN.M..YLT..GSTLF.L.SL........MLSRVY.AVILDLIKVQEDN---all...................................................................
A0A2C5X3L2_9PEZI/1-143                 ..................................................MTLYY.SLVFF.LLM.FEVGV.FFLL.I........V.P.M...PY.KM........K....KKLF.T.............F..I..S.....ES..P......L..I....S..K.IQ..Y..W........L..............K..I.TFVF......V..LI.......LF..A................DSVM.R......VY.RVQIELHAAtesa.........................tknmGAGI.M.GHERTEVQAR.KF.Y.A...QRN.M..YLC..GFTLL.L.SL........ILNRTY.SMILELIRMEEKVR--tf....................................................................
I2GWC3_TETBL/1-134                     ..................................................MSLYY.ALVFC.ILV.VEVVA.FTLL.A........L.P.L...PA.RV........R....RPLA.S.............A..A..A.....RP..F......R..Q....A..S.VQ..V..A........A..............K..C.VAGF......V..LL.......LF..L................DATA.R......AH.RLGAQSAAA.................................-GHV.H.GAERAELLSR.RF.L.A...QRN.M..YLT..GFTLF.L.SF........TVARTS.SLVAELMDLRAAA---ksd...................................................................
A0A1Y2BSP6_9FUNG/1-145                 ..................................................MSIFN.QLTYY.VLL.AELGI.YLIL.L........I.P.F...TFiPI........Ra..rKAAM.E.............F..G..N.....KI..L......R..N....E..T.VV..W..I........S..............R..I.ILLL......V..GG.......VF..V................DTLL.R......MQ.KLDSELHRRdeg..........................dnhhHHHE.S.PLEELQFKSK.LF.Y.S...QRN.M..YLS..LMSLF.M.TL........VIYRRV.KDLYLILQLEDS----sdsq..................................................................
A0A182QA68_9DIPT/1-135                 ..................................................MTLVW.GIIAS.FLY.VEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHSH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
A0A139HSA4_9PEZI/1-145                 ..................................................MTLYY.SLVFA.LLV.FEMTV.FMSL.I........I.P.L...PF.TI........K....RKLF.T.............F..I..S.....EN..P......L..I....A..K.LQ..Y..G........L..............KtqI.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAQAkyqg.........................gaagVAAV.A.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILETLRLEEEVKN-l.....................................................................
A0A0C3Q5S7_9HOMO/1-137                 ..................................................MTVYY.TLTFA.LLV.AEMAT.FVAL.L........L.P.M...PF.AA........R....KRIF.T.............F..L..S.....TS..P......V..V....A..K.IA..Y..G........L..............K..I.AFVF......I..GV.......LF..V................DALQ.R......VL.KVTSESDLAr...............................qTGVH.V.ASAETSQAAK.KF.Y.A...QRN.L..YLT..AFTLF.L.SP........LLTRTY.YILLDYIHIQDEH---ikl...................................................................
A0A0J8RBD8_COCIT/1-144                 ..................................................MTLYY.TLVFL.ILM.VEMAI.FMGL.I........V.P.L...PF.TW........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSAYskda........................vgagiRAGA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEILRLEDRVKQ-f.....................................................................
A0A0M9A8J6_9HYME/1-134                 ..................................................MSLQW.TLIAG.FLY.FEIVV.VLLL.V........L.P.I...IS.PT........R...wQKLF.R.............S..Q..F.....LK..S......L..I....Y..K.AS..I..Y........F..............V..F.LLGI......L..VL.......FL..L................DSIR.E......MR.KYSTVHETK.................................E--L.Y.LNTEMQGSMR.LF.R.A...QRN.F..YIS..GFALF.L.SL........VIRRLV.ILISGQATLLAKSEA-v.....................................................................
Q5KI44_CRYNJ/1-138                     ..................................................MTLYY.SICFV.LLM.AELSL.FCTI.V........C.P.M...PF.AI........R....KKMF.H.............F..L..S.....EN..P......V..V....A..K.IQ..Y..G........L..............K..I.TFIF......V..AV.......LF..V................DALQ.R......MV.RIAQEGATAk..............................mkQDMT.D.ARTETNYAAR.RF.Y.A...QRN.L..YLT..GATLF.L.SL........LLARVF.YIILDFIQVQESYTA-l.....................................................................
G7JZ88_MEDTR/1-126                     ..................................................MALQW.MILTY.VVA.IEAAV.AILL.T........L.P.S...PK.LL........R....NRLT.S.............L..I..S.....LI..L......-..-....Q..P.AL..-..-........-..............-..F.IVPF......A..GF.......QL..L................DIYW.K......AE.HRLMCTSD-.................................--VC.T.AAERDRYEKT.TY.K.A...QRN.V..ILC..ISACL.L.YW........SIYRIC.KFQKDIQSMEE-----vekri.................................................................
A0A0L0F6G2_9EUKA/1-43                  ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.--------MK.QF.R.A...QRN.S..YLA..FFALF.L.LI........VLWRFY.LLSKQVIKAEAIG---kqa...................................................................
S2J3D1_MUCC1/1-138                     ..................................................MTIYY.TTVFF.ILV.LEMIS.FGIL.V........F.P.F...PS.RW........R....RAML.K.............F..V..S.....GS..P......M..V....A..K.AV..R..I........L..............K..I.VFGF......I..FV.......LF..I................DAVN.R......LQ.RIDQDEQPEd..............................asRPYH.D.YSYEASQKAR.KF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.TLVIAMLKHEEELEH-a.....................................................................
A0A0J8QIC5_COCIT/1-144                 ..................................................MTLYY.TLVFL.ILM.VEMAI.FMGL.I........V.P.L...PF.TW........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSAYskda........................vgagiRAGA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEILRLEDRVKQ-f.....................................................................
A0A194PWF0_PAPXU/1-133                 ..................................................MSLQW.TFIAG.YLY.FEIAV.VIIM.I........L.P.I...FS.PR........R...wHQFF.R.............S..R..L.....FA..M......F..Q....Q..H.AA..L..Y........F..............Y..A.FLGV......L..TL.......FL..M................DAIR.E......MR.KYSNSEPLP.................................---S.H.LSTEMKGHVK.LF.R.A...QRN.F..YIT..SFAIF.L.AF........VIKRLV.TMLIIQYELELKAEQ-i.....................................................................
I1C0F3_RHIO9/1-137                     ..................................................MTIYY.TLTFG.ILV.AEMVL.FGLL.V........L.P.L...PS.RW........R....HAML.T.............F..T..L.....KS..P......Q..M....A..K.AM..Y..I........F..............K..I.VFGF......I..FI.......LF..F................DTIN.R......LQ.RMSAENEAEr...............................qQHHH.D.YGYETNFKAK.KF.Y.T...QRN.L..YLT..GFTLF.L.SV........ILERTS.ALVLELVKREEELKN-a.....................................................................
A0A1L9RJD2_ASPWE/1-129                 ..................................................-----.-----.---.--MAV.FMAL.I........I.P.L...PF.VV........K....RKIF.T.............F..I..S.....ES..P......V..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELSTFskeg........................amglgGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDRVKT-l.....................................................................
A0A1L0FWV8_9ASCO/1-141                 ..................................................MALYY.NLVFG.LLV.IEMAF.FTIL.S........L.P.F...PR.AV........R....RKVL.A.............T..A..S.....AP..F......K..S....E..Q.VQ..I..A........L..............K..C.IFGF......V..LV.......LF..I................DSVN.R......VY.SVTSELHAAapn...........................tnaPLTG.V.LNDRSEVQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.TL........ILTRTY.SLVAELITTKDKLDD-l.....................................................................
C6THE6_SOYBN/1-124                     ................................................ml-----.----Q.LLY.TAIFF.EMIL.I........L.T.L...VF.KT........P...lRKLV.I.............V..S..L.....DR..V......K..R....G..R.GP..V..V........V..............S..T.VGAT......L..VV.......VL..A................SSLY.S......MA.KIQQRTLEA.................................G---.I.VNPTDQVLMS.KH.M.L...E--.A..SLM..GFVLF.L.SL........MIDRLH.HYIRELRSLRKTMEA-i.....................................................................
A0A165GC82_9PEZI/1-128                 ..................................................-----.-----.---.--MAI.FMML.I........V.P.L...PF.TW........R....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAskdn.........................sqagRAAV.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEEVKR-l.....................................................................
A0A0M3HT46_ASCLU/137-252               ...............................limllrrricsasgrvqns-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..A.....EQ..K......L..V....T..V.MQ..G..L........S..............K..V.LRMF......D..SP.......AL..A................DAIR.E......VR.KYAAEAVAD.................................TPIH.A.AGVDNAIHMR.LF.R.A...QRN.L..YVS..GFALL.L.FL........VIKRLV.SLLSRGAQLEAAAEA-a.....................................................................
A0A1A0HFD0_9ASCO/1-138                 ..................................................MSIQM.AMVFG.ALV.AQMAV.IALL.L........L.P.L...PH.MI........R....AKIV.R.............G..W..A.....AL..R......Q..N....A..N.YK..V..G........L..............L..F.VSGL......M..VL.......QF..A................DCVQ.K......LQ.KYLRRESPEa..............................vlNPSM.G.VGLLSDKLAS.KF.Y.A...QRN.L..YLS..GAVLY.L.GL........TIHTVL.LIMGKLVAKEVL----crsa..................................................................
A0A0L1IXJ6_ASPNO/46-185                ..................................................MTLYY.SLVFC.LLV.FEMVI.FIGL.I........V.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEVTNFsk............................enmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEDKVKT-l.....................................................................
A0A0K0E537_STRER/20-157                ..................................................MSIQW.TIVAG.ILY.TEIVF.VILL.V........L.P.W...IR.PT........I...wKKFF.N.............S..R..V.....IT..A......I..S....H..K.ST..I..A........S..............Y..S.TIFV......L..TL.......LF..L................DAAR.E......CA.KYSNTTLIEn...............................sLLKG.A.ADVDTAIHMR.LF.R.S...QRN.L..YIS..GFALL.L.FL........VINRIV.GLLVRSAQLQASAEA-a.....................................................................
A0A1S8VFS8_9FUNG/30-155                ..................................................MSLHY.QLVFF.MLA.YEMAL.FLLL.L........A.P.L...PV.TW........R....RGML.K.............W..I..S.....KS..S......F..V....T..K.VS..Y..A........M..............R..I.MFFL......-..--.......--..-................---N.N......IM.TTHFTDEHG.................................HAHA.D.VHAESMVRAK.LF.Y.A...QRN.L..YLT..GSVVF.L.SL........VLNRFF.GMVFELMKNEEKSE--vl....................................................................
B2W4A2_PYRTR/1-141                     ..................................................MTLYY.SLVFL.LLV.TEMLI.FCAL.I........V.P.L...PF.TW........R....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSGSddq...........................grsGVAA.G.GIERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEEVK--gl....................................................................
A0A0F0IAS2_ASPPU/1-140                 ..................................................MTLYY.SLVFC.LLV.FEMVI.FMGL.I........V.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEVTNFsr............................enmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVK--il....................................................................
A0A061B0G1_CYBFA/1-143                 ..................................................MALYY.NLVFA.LLV.LEMAL.FTVL.S........L.P.L...PS.KI........R....RPII.K.............A..V..S.....KP..F......Q..S....R..E.VT..V..A........I..............R..C.ILVF......I..LI.......LF..V................DSVN.R......VQ.SITEELRGFtakn........................eglvqQQTA.F.VGDRSEIQAR.RF.Y.A...QRN.L..YLT..GFTLF.L.TL........IVSRTY.GLVAELLSLKEEV---gk....................................................................
A0A074Z4B8_9PEZI/1-143                 ..................................................MTLYY.SLVFG.LLV.FEMVV.FMSL.I........I.P.M...PF.TW........K....RKLL.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..W........I..............K..I.TFVF......I..LI.......LF..V................DSVN.R......VY.RVQLELATAnkan.........................ngagAAAV.G.GIERMEIQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.GMILEVLRLELENRQ-m.....................................................................
C6HNW2_AJECH/1-142                     ..................................................MTLYY.SLVFL.LLV.VEMVI.FVGL.I........I.P.L...PF.TV........K....KKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELSAYske..........................lggaGSAA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVKQ-l.....................................................................
A0A0W8DXR7_PHYNI/1-126                 ..............................................mlln-----.QLMFW.LMI.SEAII.CLLL.S........L.P.F...GQ.WI........A....HAVI.T.............F..L..A.....KT..L......K..D....T..P.AN..T..V........A..............T..V.VLSI......I..SL.......LF..I................SDVM.T......VY.KHSSSDEVL.................................----.-.---GDGMRIR.LL.T.A...QRD.M..YIT..GFCLX.L.FL........LLRLVY.ITLATNLRLEKSL---gam...................................................................
A0A177C1V8_9PLEO/1-143                 ..................................................MTLYY.SLVFL.LLV.TEMLI.FLAL.I........V.P.L...PF.TW........R....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAAFaknd.........................grggPVAM.G.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEQVKQ-m.....................................................................
D7MS26_ARALL/1-124                     ...............................................mih-----.-LLYT.VIF.AEMAL.ILLL.L........F.-.-...--.KT........P...lRKLI.I.............L..T..F.....DR..I......K..R....G..R.GP..V..V........V..............K..T.IGIT......V..FI.......VL..L................SSIY.S......LV.KIQRRSEDG.................................A---.V.LNPTDQVLAS.KY.L.L...E--.A..SLM..GFVLF.L.SL........MIDRLH.HYIRELRLLRKTME--ta....................................................................
A0A0E9NDC1_9ASCO/229-369               ..................................................MTLYY.SLVFT.VLL.FEMAI.FCLL.I........L.P.L...PF.TW........R....KSLF.R.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LV.......LF..I................DSVN.R......VF.KVSEDAAAArps...........................nggAAVG.A.EAYRSDMQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.ALITDILKMEETLA--rl....................................................................
A0A094IYB4_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMGL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAse............................qsqTGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
A0A0K3CNY5_RHOTO/1-146                 ..................................................MAIQN.LIAFG.IVG.IEILT.FFVL.I........V.P.L...PF.TW........R....RALF.K.............T..I..A.....ES..PppnlvrS..P....T..Q.IQ..Y..G........L..............K..I.TFIF......I..AL.......MF..V................DAVN.Q......MV.KIHREREASan............................vagGLAP.D.ARSQADYRSR.KF.L.S...ERN.F..YLH..GSCLF.L.SL........ILSRTY.SLVLDLIRAQEEL---ail...................................................................
A0A1U7ZL61_NELNU/1-125                 ................................................mi-----.QLLFT.LIF.AEMAL.ILLF.L........F.-.-...KT.P-........L....RKLI.I.............M..G..L.....DR..V......K..R....G..R.GP..V..M........V..............K..T.VCGT......I..LV.......VL..L................SSVY.S......MT.KIQNRSMDS.................................AGIV.N.PTDQVLMAKH.LL.E.A...---.-..SLM..GFSLF.L.AL........MIDRLH.HYIRELRLLRKSMEA-v.....................................................................
H7C5E2_HUMAN/1-94                      ................................................ia-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A162QJG1_MUCCL/1-138                 ..................................................MTIYY.TTVFF.ILV.LEMLS.FGIL.V........F.P.F...PS.RW........R....RAML.K.............F..V..S.....GS..P......M..V....A..K.AV..R..I........L..............K..I.VFGF......I..FV.......LF..I................DAVN.R......LQ.RIDQDEQPEd..............................asRPYH.D.YSYEASQKAR.KF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.TLVIAMLKHEEELEH-a.....................................................................
G3US92_MELGA/1-137                     ..................................................MTVQW.TAVAA.FLY.GEVGV.LLVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..II.......LF..L................DAVR.E......VR.KYSAIQVNE................................kIANV.N.ANAIDHIQMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRTI.TLLTQLAKGMASHA--al....................................................................
W5JI20_ANODA/1-135                     ..................................................MTLVW.GIIAS.FLY.VEIFI.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHTH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
A0A087HAF4_ARAAL/1-126                 ..................................................MALQW.LILSY.VVA.AEVVI.AVIL.T........L.P.Y...PM.IL........K....KRIV.S.............L..V..S.....LI..L......-..N....P..A.AS..I..V........A..............F..A.GFQL......L..DI.......YW..K................NEHR.L......MC.--------S.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AAGIL.L.YW........CIFRIC.KYNKDLERLEEL----ekky..................................................................
C9SH53_VERA1/1-141                     ..................................................MTLYY.TLVFV.LLM.LEMTL.FMLL.I........I.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELAIAtek...........................qnnGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDRVKS-y.....................................................................
G3RJC3_GORGO/1-137                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
G4UBJ2_NEUT9/1-142                     ..................................................MTLYY.SLVFM.LLV.AEMSI.FMLL.I........V.P.L...PF.TI........R....RRLF.T.............F..I..S.....EN..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAAAtda..........................skgnAAAI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEEKLKK-f.....................................................................
H3CEU4_TETNG/1-135                     ..................................................MSLQW.MAVAT.FLY.VEVFF.VLLL.C........I.P.F...IS.PK........R...wNKVF.K.............S..R..L.....IQ..T......V..A....L..Y.GN..T..S........F..............M..V.VLAI......L..VF.......LL..I................DAFR.E......VR.KYSVTEKVD.................................-LTN.N.PTAVEHIHMK.LF.R.A...QRN.Q..YIA..GFALL.L.CL........LLRRLA.TLLSQQASLMASNEA-f.....................................................................
A0A165CKD3_9BASI/1-138                 ..................................................MTLYY.SLCFV.LLT.GEMAF.FLLL.V........T.P.L...PF.AA........R....RRFF.T.............F..L..S.....ES..P......I..V....G..K.IA..Y..A........L..............K..I.MFIF......V..AI.......LF..V................DAVQ.R......MF.RTTAEADMAk..............................qgNGGA.D.VRAETNFAAK.KF.Y.A...QRN.M..YLT..GFTLF.L.SL........ILTRTY.YIILDLIHTQEEYAK-l.....................................................................
F7DHC3_CALJA/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
V5F9J6_BYSSN/1-127                     ..................................................-----.-----.---.--MAV.FMAL.I........V.P.L...PF.TV........K....RKIF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELASFakd..........................gsslGAAA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILDVLRLEDKVKQ-l.....................................................................
B7PYE7_IXOSC/7-146                     ..................................................MSIQW.TIVAA.FLY.AEIAV.VLLL.M........I.P.F...IS.PR........A...wNRIF.K.............S..R..F.....FK..S......L..G....A..Q.AD..I..Y........F..............T..V.MIVV......L..FL.......FF..F................DSIR.E......MR.KYGTQREVAqs.............................ehHHHG.N.LDVEMQQSMK.MF.R.A...QRN.F..YIA..GFSLF.L.WL........VIRRLV.TLISAQAVLLAVNE--as....................................................................
A3LUK6_PICST/1-142                     ..................................................MALYY.NLVFA.LLA.AEMAF.FAIL.S........L.P.F...PR.AI........R....RRVL.L.............T..V..S.....AP..F......K..N....E..Q.FQ..I..A........I..............K..C.ILGF......V..LI.......LF..I................DSVN.R......VY.SVTNELHNSnvi..........................qnggIQPG.I.LNDRSEVQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.TL........ILTRTY.GLVAELIATKDKLDS-y.....................................................................
A0A1B0G321_GLOMM/311-439               ................................................re-----.--VTG.FLY.AEICV.VLLL.V........L.P.V...AS.PY........K...wNRFF.K.............S..K..F.....LA..M......I..A....R..Q.AH..L..Y........F..............F..L.IMGV......L..VL.......FL..L................EAIR.E......MR.KYSNQEHSS.................................D--V.H.LNTEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRRLV.TLISVQANLLAQSEA-s.....................................................................
A0A1W0XA20_HYPDU/73-209                ..................................................MSLQW.TAIAA.ILY.AELAF.TILM.L........M.P.F...IS.PT........T...wHRFF.Q.............S..R..L.....VL..L......-..I....K..K.YK..Y..I........Q..............H..I.MVGV......M..GL.......LL..L................DAIR.D......VS.RYTKSFVDLs...............................eVGAA.A.PTAEVQFHMK.LF.R.A...QRN.F..YIA..GFALF.L.FY........IIKSLA.GKLSYEA---------qliisnsav.............................................................
BAP29_BOVIN/1-136                      ..................................................MTLQW.TAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..S..V.....WG..K......I..A....S..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSTHTIE................................kSSAS.R.PAAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKE-------lshkgv................................................................
A0A0J6YK19_COCIT/1-144                 ..................................................MTLYY.TLVFL.ILM.VEMAI.FMGL.I........V.P.L...PF.TW........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSAYskda........................vgagiRAGA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEILRLEDRVKQ-f.....................................................................
N4V1B3_COLOR/1-58                      ..................................................MTLYY.TLVFM.LLM.GEMGL.FMLL.I........V.P.L...PF.AV........K....RKLF.T.............Y..V..A.....-P..F......L..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------khpheiatiltfaars......................................................
T1ELG9_HELRO/1-136                     ..................................................MTLLW.TLTAT.FLY.AEIVV.CIIL.M........L.P.I...IS.PS........K...wRSLF.K.............S..R..A.....MN..F......I..V....S..Y.AN..F..Y........F..............G..L.FLLL......L..AV.......MF..I................DAIR.E......IR.RFSAPLAND.................................ELKG.N.PMAENMQHMK.LF.R.A...QRN.F..YIA..GFSMF.L.FV........ILRRMV.VMLNNSAILQADCEA-a.....................................................................
E3Q3H2_COLGM/1-142                     ..................................................MTLYY.TLVFV.LLM.AEMGL.FMLL.I........V.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELALAtek..........................qnsgGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRS-y.....................................................................
V8NCI7_OPHHA/1-101                     ................................................mi-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..S..V.....WN..K......I..A....S..Y.WN..K..T........F..............L..T.IIVI......L..IV.......LF..L................DAVR.E......VR.KYSTVQLSE................................dSPHS.S.PTAFDHIHMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRLV.SLITILANEME-----tenil.................................................................
Q17GB1_AEDAE/1-134                     ..................................................MSLVW.SLIAS.FLY.VEIFI.VLML.V........L.P.V...AS.PQ........R...wQRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLFV......L..VL.......FL..L................EAIR.E......MR.KYSHVDPAA.................................E--Q.H.LNVGMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLI.SLITSQAQLLAQSEA-s.....................................................................
A0A226DPC6_FOLCA/2-135                 ..................................................MSLQW.GIVAG.FLY.FEIGV.VVLL.L........L.P.F...IS.AQ........R...wLKIF.R.............S..R..I.....LH..S......L..G....A..Q.TQ..L..Y........F..............Y..G.LFGL......L..CL.......LF..L................DAIR.E......MR.KYSNEEYDL.................................--TV.N.PKAEMQAHMK.LF.R.A...QRN.F..YIS..GFALF.F.SL........IIRRLV.SLISIQATLHAQTEA-a.....................................................................
A5DTS0_LODEL/1-139                     ..................................................MALYY.NLVFG.LLV.IEMIF.FGVL.S........V.P.Y...PR.RI........R....RTVL.T.............T..V..S.....AP..F......K..N....E..Q.FQ..I..A........L..............K..C.VLGF......V..FV.......LF..I................DSVN.R......VY.AVTSELHSStq.............................ahPGSS.V.MNDRSEIQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.TL........ILTRTY.NLVVELIVTKDKVDE-l.....................................................................
A0A0C3KHZ2_9HOMO/1-137                 ..................................................MTVYY.TLTFA.LLL.AEMGT.FVAI.L........L.P.M...PF.AA........R....KKLF.T.............F..L..S.....TS..S......I..V....A..K.IA..Y..G........L..............K..I.AFVF......I..AV.......LF..V................DALQ.R......VL.RVTAESDLAk...............................qAGAH.V.GAAETSHAAK.KF.Y.A...QRN.L..YLT..AFTLF.L.SP........LLTRTY.YVILDHLHTQDEYAR-l.....................................................................
A0A0E0GBG6_ORYNI/1-103                 ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....ML..-......-..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.-..---..-----.-.--........------.----------------ivmwdsqcilf...........................................................
A0A0F2MAR8_SPOSC/1-154                 ..................................................MTLYY.TMVFM.LLM.LEMSL.FVVL.I........V.P.L...PF.TL........K....RRIF.TyvlpyvqarrlapF..L..S.....EN..P......L..V....A..K.VQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELGLSsen...........................aanGAAI.I.GRERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEEKLKK-y.....................................................................
B7XJ91_ENTBH/66-118                    ............................................myknsi-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----TDSKIL.EY.Q.T...QRN.M..YLS..GFALF.L.VF........NFRQLS.KILNMVFVEKKD----hkyi..................................................................
A0A1U7T2V6_TARSY/1-137                 ..................................................MTLQW.TAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WS..R......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSFTHTIE................................kSSTS.S.PNAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snqgvl................................................................
A0A1U7KB62_9APHY/1-133                 ..................................................-----.-MTFM.LLA.SEMVT.FCLL.V........S.P.L...PY.TI........R....KKVF.R.............F..L..S.....ES..P......I..V....A..K.LA..Y..G........L..............K..I.TFIF......V..TV.......LF..V................DALQ.R......MW.RVTAEADMArn.............................sgAPMH.D.ARAETNFAAR.KF.Y.A...QRN.T..YLT..GFTLF.L.SL........VLTRSF.YIILDLIHTQEEYAK-l.....................................................................
V7B912_PHAVU/48-173                    ..............................................tkmi-----.QLLFM.LLI.IQMAL.ILIL.-........-.S.F...AN.PI........R....KLVA.K.............G..L..D.....LS..-......K..Q....G..R.GP..L..V........T..............K..T.VAAT......M..LV.......VF..S................STVY.T......IT.QMQKRLKDS.................................-ATV.N.PTDEVVMAYR.LL.E.A...S--.-..-LL..GFSLF.L.GL........IIDRQH.YYIREINLLRKSLE--ta....................................................................
A0A024U3K6_9STRA/1-132                 ..................................................MTIWA.AWAYV.LLP.PAVIL.LILL.T........I.P.F...PR.PV........A....KGVV.R.............M..N..E.....FI..L......N..F....H..I.A-..-..S........I..............P..V.FSVI......T..GL.......AF..V................ALAG.Q......TY.DLQKRYNYQi...............................tGIEK.H.YEADLQHRAT.RW.R.S...ERN.W..WIS..ALTFT.I.YW........MLMA--.----------------fqsmkkqlllasrrt.......................................................
A0A100I7C7_ASPNG/1-146                 ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........I.P.L...PF.TV........K....RKLF.A.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFgkegg......................tmgfrhRAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEDRVR--ll....................................................................
I1CJ43_RHIO9/1-118                     ..................................................-----.-----.---.--MFV.FCVI.V........L.P.L...PS.RW........R....RAMF.K.............F..A..S.....TS..P......L..V....D..K.AL..N..T........L..............R..I.IFGF......I..FV.......LF..I................DAVN.R......LQ.RLNEHEEES.................................--HH.D.HSYEESLKAS.KF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.SLVIAMLKKEEELED-a.....................................................................
A0A0D1E664_USTMA/1-138                 ..................................................MTLYY.SIVFA.LLC.FEMAM.FMVL.I........I.P.L...PF.TW........R....RKLF.H.............F..L..A.....TN..P......V..V....A..K.IQ..Y..G........L..............K..I.TFIF......V..AV.......LF..V................DAVQ.R......MV.KVMSEGETAr..............................dnRGVQ.D.VRTETNYAAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILSRSY.SLILDLINTQEELV--al....................................................................
A0A1G4B7S2_9PEZI/1-141                 ..................................................MTLYY.TLVFI.LLM.AEMGL.FMLL.L........V.P.L...PF.AI........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELAIAten...........................qnsGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVR--gy....................................................................
V4KTK3_EUTSA/1-126                     ..................................................MALQW.LILSY.VVA.AEVVI.AVVL.T........L.P.Y...PM.LV........K....KRVV.S.............L..V..S.....LI..L......Q..-....-..P.AA..S..-........-..............-..-.IVAF......A..GF.......QL..L................DIYW.K......--.-SEHRLSCS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AAGIL.L.YW........CIYRIC.KYNKDLERLEEAE---kry...................................................................
A0A1W4W3R5_DROFC/1-134                 ..................................................MSLVW.TLIAG.FLY.AEIAL.VLLL.V........L.P.V...AS.PY........R...wNRLF.K.............S..K..F.....LA..M......L..A....Q..Q.AH..I..Y........F..............F..L.IMGV......L..VL.......FL..L................EAIR.E......MR.KYSNYEQTG.................................E--V.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRRLV.TLVSAQANLLAQSEA-s.....................................................................
F2SX06_TRIRC/1-141                     ..................................................MTLYF.TLVFV.LLV.TEMAI.FVGL.I........V.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELTGFdaa...........................nsgHRHA.I.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDILRLEDKVK--my....................................................................
A0A166RE78_9PEZI/1-141                 ..................................................MTLYY.TLVFV.LLM.AEMGL.FMLL.I........V.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......V..V....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELALAtek...........................qnsGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVR--gy....................................................................
G9MID8_HYPVG/1-143                     ..................................................MTLYY.TLVFG.LLM.AEMGM.FMLL.L........V.P.L...PF.NI........K....RRIF.T.............F..I..S.....ES..P......L..I....A..K.LQ..Y..W........M..............K..I.TFVF......I..LI.......LF..V................DSLN.R......VY.RVQLEVMAAheqg.........................lkgnAAAV.M.GSERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKLKA-y.....................................................................
C5KC37_PERM5/7-136                     .......................................eayigiplaav-----.-----.---.-----.VLLL.L........L.S.D...IS.FL........Q....KFAC.K.............L..S..N.....LS..F......T..V....G..D.YG..I..S........L..............S..LgMVTI......A..SA.......LF..V................SQWM.T......LR.GLDAMKETQ................................lSDLT.T.VELQDRFLMK.AW.R.A...ERN.W..WIS..LFSLT.L.WL........MVWRSA.TWVQGLIDEEQKD---sqq...................................................................
C9JMD7_HUMAN/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......L..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A1B0B5F7_9MUSC/1-133                 ..................................................MTFLW.AIIDR.FLC.LEIIV.ILLI.M........L.P.I...IE.PI........H...wSRLF.K.............S..Q..L.....VK..R......I..Q....Q..N.TV..R..F........F..............Y..L.MLGV......L..TI.......CL..A................SAYV.D......MR.KFSQVEEKN.................................-AQM.K.LDIVQEIHF-.-L.K.A...QRN.L..YIS..GFATF.L.II........VMKRII.AFISIINQLLAQNNA-a.....................................................................
A0A182TXA2_9DIPT/1-135                 ..................................................MTLVW.GIIAS.FLY.VEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHTH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
A0A1U7LK25_9ASCO/1-136                 ..................................................MTLYY.SLVFV.LLI.FEMGV.FCAL.I........L.P.I...PF.TW........R....RKLF.K.............F..I..S.....TS..P......L..I....A..K.LK..H..G........M..............K..I.MFIS......V..LV.......LF..I................DSVN.R......VF.KVTEEASLN................................vETGV.R.DSYRTDMQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRLY.LLLNDAIRYEEQLAE-l.....................................................................
M7BQF3_CHEMY/134-211                   .............................................magtd-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................DAIR.E......VK.KYSTAHGTE................................kAANI.N.PNAYDHIQMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRTV.TLITQLAKE-------mgiqvam...............................................................
A0A195FXC2_9HYME/1-135                 ..................................................MSLQW.TLIAG.FLY.IEVAI.VLLL.V........L.P.V...AS.PT........R...wQKFF.K.............S..R..F.....LQ..S......L..N....N..Q.AS..I..Y........F..............V..V.LLGV......L..VL.......FL..L................DAIR.E......MR.KYSTSLDHP.................................E-HH.Q.LNVEMQENMR.LF.R.A...QRN.F..YIS..GFALF.L.SL........VIRRLI.ILISAQASLLAQHEA-a.....................................................................
A0A067NIR7_PLEOS/1-140                 ..................................................MTIYY.SLTFM.LLA.AEMGT.FCIL.V........A.P.L...PY.RI........K....KTLF.T.............F..L..S.....ES..V......I..V....A..K.VA..Y..A........L..............K..I.SFIF......V..AI.......LF..I................DALQ.R......MF.RITADTEASkn............................aqnGGVH.D.VRTETGLAAR.KF.Y.A...QRN.V..YLT..GFCLF.L.SL........VLTRTF.YIILDLIHTQEEYAK-i.....................................................................
T0PVQ5_9STRA/1-128                     ..............................................miln-----.ELLFG.LLC.VEAVV.CLFL.C........L.P.F...FK.HM........T....QATV.A.............F..L..S.....TN..V......FppN....S..G.AA..M..V........G..............N..I.VLAV......V..GL.......LF..L................ANVQ.T......SL.KYRNSDEVL.................................----.-.---SDGLRIR.LL.V.A...QRD.M..YIS..GFCLF.L.FA........LLRLVY.SSMVTNISLEKKYEA-m.....................................................................
G5BQT6_HETGA/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLFL.C........I.P.F...IS.PR........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LL..L................DAYR.E......TC.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A1W4WMV7_AGRPL/1-134                 ..................................................MSLQW.TLIAG.FLY.LEIVI.VLLL.V........L.P.I...AS.PR........R...wNTFF.K.............S..R..F.....LQ..G......I..Q....Q..Q.AG..I..Y........F..............V..V.LLAV......L..VL.......FL..L................DAIR.E......MR.KYSSPEVTD.................................--HQ.H.LDAEMQGNMR.LF.R.A...QRN.F..YIS..GFALF.L.CL........VIRRLV.TLISQQASLLAQSEA-a.....................................................................
A0A0V1HWA0_9BILA/217-326               ......................................fltfhsdvfivl-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..H.....LL..F......C..D....N..V.AS..T..V........F..............G..L.FFTR......L.hEI.......IL..L................DALR.E......VR.KYSDADLVK.................................QSVG.N.VQGEFNTHMR.LF.R.A...QRN.L..YIS..GAALF.L.WF........AIQRVA.SMIRREAMLIASAEA-a.....................................................................
A0A1S3CSB5_CUCME/1-126                 ..................................................MALQW.MLLAY.TVA.VEAAI.AILL.T........V.P.S...PK.LL........K....KRFV.S.............L..I..S.....L-..-......-..-....-..I.LQ..P..A........L..............F..-.VVPF......A..GF.......QI..L................DIYW.K......NE.HRLMCTS--.................................-EIC.T.AAERDRYEKS.IY.K.A...QRN.V..ILC..VAACL.L.YW........CIYRVC.KYNKEIESLEE-----vekry.................................................................
A0A135UJ70_9PEZI/114-254               ..................................................MTLYY.TLVFM.LLM.AEMGL.FMLL.L........V.P.L...PF.AV........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELAIAten...........................qnsGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVR--gy....................................................................
A0A0N1IGZ2_PAPMA/1-134                 ..................................................MSLQW.TIIAS.FLY.AEIAF.VLLL.T........L.P.I...AS.PS........K...wQRFF.K.............S..K..F.....LA..Y......I..S....G..Q.AS..I..Y........F..............L..I.LIGV......L..VL.......CL..L................DAIR.E......MQ.KYSNMESAD.................................--HQ.H.LDAEMQGNMR.LF.R.A...QRN.F..YIS..GFALF.L.LI........VIRRLI.QLISELATVLATSEA-n.....................................................................
A0A0L7LTZ8_9NEOP/1-134                 ..................................................MSIQW.TFIAG.YLY.FEIAL.VIVM.M........L.P.L...FS.PR........R...wHQFF.K.............S..R..L.....FD..L......F..Q....Q..H.AA..M..Y........F..............Y..C.LLGV......L..CL.......FL..I................DAIR.E......MR.KYSHGSETA.................................--HI.H.LSTEMKGSVK.LF.R.A...QRN.F..YIT..GFSIF.L.AF........VIRRLV.TMLIIQDELS------lkaeri................................................................
A0A024GMF0_9STRA/1-128                 .............................................mllny-----.-LMFW.LMC.LEAMI.CLLL.S........L.P.F...GK.TG........A....QRIV.Q.............F..L..S.....CH..Lg....gK..N....S..I.AS..N..T........A..............N..I.ILAV......V..VI.......LF..L................SNAH.T......CA.SYYMSDAM-.................................----.-.--LSDGMRIR.LL.T.A...QRD.L..YIT..GFSLF.L.FL........LLRLVY.HSIETNIRLDKSLQA-m.....................................................................
G3WI29_SARHA/1-136                     ..................................................MTLQW.AAVAS.FLY.AEIGL.ILIL.C........L.P.F...IP.PQ........R...wQKIF.T.............F..S..L.....WG..K......I..A....T..Y.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VK.KYSISHGLE................................kSSST.N.PSAYEHVQMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........VLRRLV.TLITQLAK--------elgikgv...............................................................
A0A1B8F8W7_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMGL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAte............................qsqTGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
W6ZVM7_COCMI/1-141                     ..................................................MTLYY.SLVFL.LLV.TEMLI.FCAL.I........V.P.L...PF.TW........R....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSGSdeq...........................grpGVAA.G.GIERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEEVKS-l.....................................................................
A0A0R3PT54_ANGCS/176-296               ...........................................hpslavd-----.-----.---.-----.----.-........-.-.S...PY.TV........Q...wSKLF.K.............S..R..L.....VS..S......L..A....A..H.GQ..I..Y........S..............Y..S.AAFV......L..FV.......LF..A................DSVR.E......VK.KYSHVEVAMe..............................ssVIHR.V.ADTDAIIHMR.LF.R.A...QRN.F..YIS..GFALL.L.FL........VIKRIM.GLISRGAQLEAASEA-a.....................................................................
A0A139INR0_9PEZI/1-143                 ..................................................MTLYY.SLVFA.LLV.FEMVV.FMSL.I........I.P.L...PF.TI........K....RKLF.T.............F..I..S.....EN..P......L..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAQAkyqg.........................gaagVAAV.A.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILDTLRLEEEVKN-l.....................................................................
L5JQU6_PTEAL/1-137                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......IR.KYSSTSSIE................................kSSPS.R.PGAHEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A0V1A3J8_9BILA/152-287               ..................................................MSLQW.TLVAL.LLY.VEVFV.LSCM.L........L.P.W...IR.PS........S...wQRLF.R.............S..R..F.....LR..F......I..Q....T..Y.SS..L..Y........I..............Y..C.FALM......L..LL.......LF..L................DALR.E......VR.KYSDADLVK.................................QSIG.N.VQGEFNTHMR.LF.R.A...QRN.L..YIS..GAALF.L.WF........AIQRVA.SMISREAMLIASAEA-a.....................................................................
A0A0V0UYQ4_9BILA/3-92                  .....................................ryglsllftrlne-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..MM.......IL..L................DALR.E......VR.KYSDADLVK.................................QSVG.N.VQGEFNTHMR.LF.R.A...QRN.L..YIS..GAALF.L.WF........AIQRVA.SMISREAMLIASAEA-a.....................................................................
M4APT3_XIPMA/1-136                     ..................................................MTLQW.TAVAF.FLY.AEIVF.NLIL.C........I.P.F...IS.AH........R...wHLVF.H.............W..R..I.....WS..W......L..S....P..Y.WN..K..F........F..............F..A.MIMA......L..VV.......LF..C................DAIR.E......VQ.KYSGPEPMH.................................DAQA.N.PNLYDHVHMK.LF.R.A...QRN.L..YIC..GFSLF.L.LL........VMRRIV.TLQNQIAETSVN----tagl..................................................................
A0A1S3SFR4_SALSA/1-142                 ..................................................MTFLW.TAVAF.FLY.VEIGV.LLIL.C........L.P.F...IS.IT........R...mQSIF.Q.............L..R..I.....WN..K......M..S....R..I.WT..K..F........Flni........klsY..I.MITI......L..IG.......LL..I................DSLR.E......MW.KYSGAKNNK.................................DAIL.Q.PNMFNHLHMK.LF.R.A...QRN.L..FIA..GFSLF.L.WL........VLRRVI.TLINQLATASSTT---asl...................................................................
C4QWM4_KOMPG/1-132                     ..................................................MSLQL.SIIFG.ILM.GEMFI.ITLL.V........L.P.L...GS.NV........R....RSVV.R.............L..F..N.....WT..A......R..K....P..T.CN..V..T........T..............Y..I.VLGL......V..GL.......FF..I................DSFR.S......VN.SARHTPVS-.................................--NY.D.AAVNQQAYMK.KF.Y.N...QRN.M..YIT..GATLF.Y.AA........SIKCII.NLINQILRNEEKLSK-v.....................................................................
A0A182LQ26_9DIPT/1-135                 ..................................................MTLVW.GIIAS.FLY.VEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHTH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
D8LCD9_ECTSI/8-138                     .....................................pllikiifpipas-----.-----.---.----F.LLLI.C........L.P.L...ST.QS........R...iMRWT.R.............R..L..Y.....DK..I......F..S....F..Q.VM..S..I........P..............L..I.YLIM......A..AS.......CA..L................FAAM.C......LE.TYGLRVREV.................................N-AT.H.FDEKMNLRGR.RW.R.A...ERN.F..YIS..FMFLS.C.SV........LANRVR.LMLKEVDSLNEQIRE-m.....................................................................
G3HSX3_CRIGR/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIII......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
F6V5V5_HORSE/1-135                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LL..I................DAAR.E......IW.KYDVTEKV-.................................NLQH.N.PGAMEHFHMK.LF.R.A...QRN.L..HIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A9TBR7_PHYPA/1-126                     ..................................................MALQW.YLLGA.IAV.VEAAV.LLLL.S........A.P.L...PP.RL........S....KQVL.E.............F..V..-.....--..-......-..K....R..I.LQ..P..G........L..............A..V.VPFA......L..--.......--..F................QLLE.V......YW.KYENRINCS.................................KQEC.S.PFERDRFQRT.LF.K.S...HRN.A..LLA..ISAAF.F.YW........LLFRIA.KMQQDLLQAENRVK--la....................................................................
J8LQI5_SACAR/1-140                     ..................................................MSLYY.TLVFA.ILV.VEIFM.FSIL.A........I.P.I...PS.KY........R....RPLT.L.............L..L..L.....KP..F......K..S....P..T.VQ..V..A........I..............K..C.ILGF......I..LL.......LF..V................DCIN.R......VY.SIDRELQLSst............................pqpNGTV.I.AQDRIEVLSR.KF.F.A...QRN.M..YLT..GITLF.L.TF........VVVRTF.GLVIELLTMKDVYRA-s.....................................................................
A0A1E3NTU2_9ASCO/1-140                 ..................................................MAFQY.VLTFS.LLV.AEMVM.FSLI.S........F.P.L...PS.KI........R....RPLL.K.............A..L..S.....IP..F......H..S....Q..Q.FQ..V..V........T..............K..C.VFVF......I..GI.......MF..A................DSVN.R......TM.KVTNELYNGtl............................nsnDMLN.G.GVSRAEIQSR.RF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMVFDLLEVKEKVKK-l.....................................................................
A0A1D5QLW2_MACMU/1-137                 ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................rSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snksvl................................................................
A0A1B7TJN7_9ASCO/1-144                 ..................................................-----.-----.---.--MTL.FLVL.I........F.P.L...PN.KL........Hq.lkKHFI.K.............L.lN..F.....VA..Y......K..N....D..T.TK..I..V........S..............R..S.VFIF......I..LL.......MF..I................DSIK.K......LQ.NISYSSVSArmddtygqqn.............fggeysgnqmDPVR.A.NINKSEYYRE.KF.F.A...QRN.M..YLT..GFTLF.L.CF........MILRTI.QITNELLEG-------lskenkp...............................................................
B5X317_SALSA/1-135                     ..................................................MSLQW.TAVAT.FLY.AEVFF.VLLL.C........V.P.F...IS.PK........R...wSKIF.K.............S..R..L.....VQ..T......I..A....Y..Y.GN..T..S........F..............I..V.AIAI......L..VF.......LL..I................DAFR.E......VR.KYSVTEKVD.................................-LTN.N.PVAVDHIHMK.LF.R.A...QRN.E..YIA..GFALL.L.CV........LLRRLA.TLLSQQATLMASNEA-f.....................................................................
H2PX57_PONAB/68-203                    ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
E5A2R6_LEPMJ/1-143                     ..................................................MTLYY.SLVFL.LLV.TEMLI.FCAL.I........V.P.L...PF.TW........R....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQIELSGSdepg.........................argsNAAL.G.GIERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDTLRLEEELKA-y.....................................................................
M4AHB3_XIPMA/1-135                     ..................................................MSLQW.TAVAT.FLY.AEVFL.VLLL.C........I.P.F...VS.PK........R...wSRIF.K.............S..R..L.....VQ..T......V..A....L..Y.GN..T..W........F..............M..V.AIAI......L..VF.......LL..I................DAFR.E......AR.KYSLTDKVD.................................-VTN.N.PTAIEHIHMK.LF.R.A...QRN.E..YIA..GFALL.L.CL........LLRRLA.TLLSQQATLMASNEA-f.....................................................................
A0A0C2D7V5_9BILA/10-75                 ..................................................MTLQW.SIIAF.VLY.VEIAL.TFIL.L........L.P.W...IR.PS........L...wSKLF.K.............S..R..L.....IT..S......L..S....A..H.AQ..I..Y........S..............Y..A.GAFV......L..FI.......LF..A................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------gs....................................................................
A5X380_MESAU/1-136                     ..................................................MSVQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIII......L..VL.......LV..I................DAAR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
G8YPA9_PICSO/1-140                     ..................................................MSIQM.SLIFG.TLL.LQMTA.LLVS.L........L.P.L...PL.KA........R....KAIV.N.............I..A..E.....SL..K......S..S....K..N.FN..I..G........L..............W..F.SLIL......L..GL.......QF..A................DCFN.R......LQ.RFSHIGNPYll............................vssRDID.S.SSISYDQLAS.KF.Y.S...QRN.L..YLT..GAVLY.L.TL........AINTVL.GILKNLVTKASEYNK-i.....................................................................
A0A0V0X0M0_9BILA/59-174                ..................sksfftfysdvfivihllfcvnvastvfgsir-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............F..N.LHCL......L..TM.......TR..Y................DALR.D......VR.KYSDADLVK.................................QSAG.N.VQGEFNTHMR.LF.R.A...QRN.L..YIS..GAALF.L.WF........VIQRVA.SMISREAMLIASAEA-a.....................................................................
Q6Z756_ORYSJ/1-127                     ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.GL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........-..............M..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCDD--.................................EHHC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSIT.SLVVRLDQLQQRVDK-l.....................................................................
W2KG55_PHYPR/1-135                     ............................................masmws-----.SFTYV.LLP.PAVVL.LLLM.T........I.P.F...PG.LM........L...nRGIV.K.............FgdF..V.....FN..I......R..I....G..T.LS..V..F........S..............V..I.TFIS......F..VV.......LV..A................QTYD.L......QK.RYSLPSDPH.................................-LEV.H.YSADLQKKAS.RW.R.S...ERN.W..WIS..ALTFT.I.YW........MLLRFH.AMKKKLLKAQH-----ed....................................................................
A0A1U8CZL7_MESAU/1-136                 ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIII......L..VL.......LV..I................DAAR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
F7VT64_SORMK/1-142                     ..................................................MTLYY.SLVFM.LLV.AEMSI.FMLL.I........V.P.L...PF.AI........R....RKLF.T.............F..I..S.....EN..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAAAtda..........................skgnAAAI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEEKLKK-f.....................................................................
C5DGW7_LACTC/1-143                     ..................................................MSVYL.SVLFG.ALT.LEMAC.LFVL.V........L.P.L...HY.KI........R....KGLV.S.............T..Y..D.....RF..M......S..Y....T..Q.VK..T..V........I..............W..I.TAGL......V..GL.......LF..V................DSWK.R......AQ.VSVFLHHHQgvgg.........................psanPDGA.G.AITPVQALAS.RA.Y.N...QRN.T..YIS..GFILY.F.CF........CIPTVI.SVVRRLVKYETL----lrdk..................................................................
A0A091FWM8_9AVES/1-128                 ..................................................MTFQW.TAVAA.FLY.GEIGV.ILVL.C........L.P.F...IS.PL........R...wQKIF.T.............I..P..L.....WS..K......L..A....V..F.WN..K..M........F..............L..T.TIIL......L..IV.......LF..L................DAVR.E......VR.KYSAVHVRE................................lVGNV.M.LLAAAQVAVR.EY.-.-...---.-..-LS..RLSTY.-.-S........VLRRTV.TLLTQLAKQMASHA--al....................................................................
A0A1S9DMW5_ASPOZ/1-140                 ..................................................MTLYY.SLVFC.LLV.FEMVI.FMGL.I........V.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEVTNFsr............................enmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVK--il....................................................................
A0A1D8PGL1_CANAL/1-138                 ..................................................MALYY.NLVFG.LLV.FEMIF.FGVL.S........L.P.Y...PR.KI........R....RSIL.S.............T..V..S.....AP..F......K..N....E..Q.FQ..I..A........I..............K..C.ILGF......V..LV.......LF..I................DSVN.R......VY.AVTTELHSSt..............................asPGST.A.VVDRSEVQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.TL........ILTRTY.SLVAELIATKDKVDD-l.....................................................................
A0A0L0HNC6_SPIPN/1-145                 ..................................................MSLFN.QLVYY.MLL.TELTF.YLLT.L........I.P.LsfiPI.PT........R....KRIM.N.............S..I..S.....TL..A......R..K....D..P.IV..W..T........A..............R..V.IFLV......M..AL.......VF..W................DTVT.R......LY.RMETEVHPKeeg..........................hhshLDPM.G.MQADLQQKAR.RF.Y.T...QRN.L..YLS..LFAIF.M.IL........VDYRRVkDLYLQLV---------yqeeivdl..............................................................
A0A0G4EXN9_VITBC/1-138                 ...............................................mas---VW.SFIAW.ICA.PIAAT.LCIL.L........L.SgV...VM.LE........Rl..gQAMH.S.............A..R..L.....TS..P......S..D....SpgS.GR..V..V........T..............F..I.TLVT......L..VL.......FA..Y................ESV-.D......LQ.KMRSTQAAT.................................-SPY.Q.VQMEDRWKMN.LW.R.H...QRN.W..WIS..LSNIT.L.WI........VCWRVS.QLIAYYRKR-------ieqlkms...............................................................
A0A1U7RU93_ALLSI/1-136                 ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........V.P.F...IS.AT........R...wQKIF.R.............S..R..L.....VR..A......V..V....T..Y.GN..T..F........F..............I..V.LIVI......L..IL.......LL..I................DAVR.E......IR.KYDEVPEKV.................................SLQH.S.PGALEHVHMK.LF.R.A...QRN.L..YLA..GFALL.L.SF........LLRRLV.TLLSQQASLQASNEA-f.....................................................................
A0A1I7TQ18_9PELO/4-137                 ..................................................MTLQW.TIVAG.VLY.AEIAA.TFIL.L........L.P.W...IR.PT........L...wSKLF.K.............S..R..L.....FT..A......L..S....K..H.AQ..I..Y........S..............W..A.FGFV......L..FI.......LF..A................DGCR.E......TM.KYNGLEDKL.................................--QR.T.AESDATHHMR.LF.R.A...QRN.L..YIS..GFSLL.L.FM........VIQRIM.TLLSRAAQLEAAGEA-a.....................................................................
Q6CWL9_KLULA/66-203                    ..................................................MSLYH.SLVFA.ILV.VELIT.LTLL.G........L.P.L...PS.KF........K....KPVI.S.............A..L..S.....KP..F......F..S....P..T.VQ..I..T........I..............K..C.LLAF......I..LL.......LF..V................DSIN.K......VY.SVEGELDKLk..............................evGTGT.H.PQGRMEILSR.KF.F.W...QRN.M..YLT..GITLF.L.TF........VLSRTV.NLVWELFELKEDY---hli...................................................................
F4Q7U5_CAVFA/105-232                   ..............................................tgll-----.-----.ILK.DEMVI.CILA.V........L.P.I...SM.AS........K....KSVF.A.............K..V..S.....NL..W......A..G....H..T.SK..I..V........F..............R..V.VFVI......L..VG.......LF..A................DAIM.N......SL.NTDKQIHEM.................................R-KD.N.KIVDNSLYVR.LF.R.Y...QRN.I..YLT..GFTMF.L.YF........LIYRSQ.SIIVELTSMETKS---tva...................................................................
I2H6Y5_TETBL/1-137                     ..................................................-----.-----.---.--MGI.LFFL.V........L.P.L...PF.RI........R....QKIC.N.............V..Y..Y.....KI..F......A..N....S..T.VK..T..V........V..............A..M.SSAI......I..GM.......LF..V................DSFR.R......SQ.YTVVLHHHQkrhtggdl................yeeyenenfAHAP.P.EITPIEVLAS.RA.Y.H...QRN.T..YIS..GFILF.F.GV........CIATIM.TINKKLVKYQS-----linen.................................................................
A0A1E4SXV3_9ASCO/1-140                 ..................................................MALYY.GLVFT.LLM.LEMLA.FAVI.S........L.P.I...PT.KF........R....KPLL.K.............T..L..S.....IP..F......H..S....H..Q.FK..I..V........L..............K..C.IFGF......I..LV.......LF..I................DSLN.R......MN.KVNSELVEYte............................gkiPGLS.S.GESRSEIQSR.RF.Y.A...QRN.T..YLC..GFTLF.L.TA........VLNRTY.SLVFELLAVKEQIKA-s.....................................................................
Q5RIX5_DANRE/1-136                     ..................................................MTLQW.TAVAT.FLY.VEIAV.LIFF.C........L.P.F...IS.AK........R...wQKIF.K.............W..S..I.....WS..R......L..S....Q..F.WN..K..G........F..............L..A.MIII......L..IV.......LF..L................DALR.E......VR.KYSNSDQSK.................................DAKL.H.PNMFDHMHMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........VMRRVV.TLISQLATAADSC---vdl...................................................................
L8GUB8_ACACA/1-127                     ................................................mf---FW.WLVVG.VLV.ASIAL.LTLL.L........A.P.L...PT.--........-....--FL.A.............S..G..A.....V-..Q......L..I....N..A.IQ..R..P........L..............W..V.VLSL......V..SW.......VL..V................DAAL.E......VR.KHSGVSDSH.................................Y-AE.R.AGLPMMTHNI.KW.R.A...ERN.F..YLA..GFTWT.L.LL........IVLRCH.YLARSKLELIAEN---rrm...................................................................
A0A0C3H6U0_9PEZI/1-140                 ..................................................MTLYY.SLVFL.LLV.AEMAL.FMIL.I........I.P.L...PF.NI........R....RKMF.T.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAESkd............................mggRTAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TLILDVLRLEEKVKR-y.....................................................................
A0A1J1J0H0_9DIPT/1-132                 ..................................................MSLTW.SLIAG.FLY.TEVFI.VLLL.V........L.P.L...FS.AS........K...wNRFF.K.............S..R..F.....LA..A......F..A....R..Q.AQ..I..Y........F..............Y..L.VLGV......L..VI.......FL..L................EAIR.E......MR.KYSNVEEET.................................----.T.LNLGMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLI.ILISQQASLIANSEA-s.....................................................................
H3DF24_TETNG/1-139                     ..................................................MTLQW.TAVAF.FLY.AEIGL.NLIL.C........I.P.F...IS.AK........RycswHLVF.N.............W..K..I.....WK..W......L..S....P..Y.WN..K..C........F..............F..T.MIMV......L..IV.......LL..L................DAVR.E......VQ.KYSGPEPLH.................................DAKA.N.PNVYDHVHMK.LF.R.A...QRN.L..YIS..GFSLL.L.CL........IMHRIF.SLINQVAVTSEDSK--rl....................................................................
A0A0L0C499_LUCCU/1-134                 ..................................................MSFVW.TLIDA.FLF.TEIVI.VLLL.V........L.P.V...AS.AT........R...wNRFF.K.............S..K..F.....LA..M......L..A....Q..Q.AQ..I..Y........I..............F..I.LIGV......L..VL.......FL..L................EAIR.E......IT.KFSKQELGE.................................--EA.Q.LDMKMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIKRLI.SLISQQAQLLAQSEA-s.....................................................................
Q8LDS7_ARATH/1-126                     ..................................................MALQW.LILSY.VVA.VEVVI.TLVL.T........L.P.Y...PM.LL........K....KRVV.Q.............L..V..S.....LI..L......Q..-....-..P.AA..S..-........-..............-..-.IVAF......A..GF.......QL..L................DIYW.K......AE.HR---LSCS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AAGIL.L.YW........CIYRIC.KYNKDLERLEATE---krf...................................................................
A0A0L0HNZ2_SPIPN/1-130                 ..................................................MSLFY.QIVFV.ILA.AEMAL.FTLL.I........A.P.L...PL.SL........K....RQFL.I.............W..M..S.....KS..P......V..I....A..Q.AK..Q..W........L..............K..I.VFVY......V..FI.......MF..L................DSLN.R......TM.RKEDANPTD.................................----.-.HHHDPYHRAR.LF.Y.D...QRN.L..YLT..GAVLF.L.SL........LLNRFF.SMITELVTNESKAE--vl....................................................................
A0A1E4S2F3_CYBJA/1-128                 ..................................................-----.-----.---.--MAL.FTLL.S........L.P.L...PS.SI........R....RPLI.K.............S..I..S.....RP..F......Q..S....R..E.VT..I..A........T..............R..C.ILVF......V..LI.......LF..I................DSVN.R......VT.SINEELLAFadse.........................tgakLQST.F.VTDRSEIQAR.RF.Y.A...QRN.L..YLT..GFTLF.L.TL........IVSRTY.GLVAELLQLKEDVR--sk....................................................................
A0A2K5HQA6_COLAP/1-137                 ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................rTSTS.R.PDVYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
G0V8Q3_NAUCC/1-134                     ..................................................MGLYL.MALFT.ILT.GEMSF.LSLI.V........L.P.L...PL.VV........R....RVIY.N.............H..M..F.....LQ..L......V..N....S.mR.FR..T..I........A..............V..V.GGMI......V..SL.......LL..V................DSWK.R......AN.IKVNPYSYE.................................--QD.H.STTPIQILAT.RA.Y.N...QRN.V..YLS..GFILY.F.GI........CIATVM.IIIGKIIRFEDEVKE-k.....................................................................
A0A078HWR7_BRANA/1-126                 ..................................................MALQW.LILSY.VVA.AEVVI.AVVL.T........L.P.Y...PM.VV........K....KRVV.S.............L..V..S.....LV..L......Q..P....A..A.--..-..-........-..............-..S.IVAF......A..AF.......QL..C................DIYW.K......--.-NEHRLSCS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AAGIL.L.YW........CIYRIC.KYNKDLELLE------eaekrh................................................................
A0A067C1G9_SAPPC/1-128                 ..............................................miln-----.ELLFG.LLC.VEAVV.CLFL.C........L.P.F...FK.HM........T....QATV.A.............F..L..S.....TN..V......FppN....S..G.AA..M..V........G..............N..I.VLAV......V..GL.......LF..L................ANVQ.T......SL.KYRNSDEVL.................................----.-.---SDGLRIR.LL.V.A...QRD.M..YIS..GFCLF.L.FA........LLRLVY.SSMYEAMEKQAKNA--ss....................................................................
C9JTE9_HUMAN/1-137                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A0D0CQ96_9AGAR/1-139                 ..................................................MTIYY.SLTFL.LLA.SEMVT.FTLL.V........V.P.F...PY.AV........R....KRVF.G.............F..L..S.....DS..P......I..V....A..K.IA..Y..G........V..............K..I.SFIF......V..GI.......LF..F................DALQ.R......MF.RITAEADIAkq.............................gqQGMG.D.VRTETSFAAR.KF.Y.A...QRN.V..YLT..GFTLF.L.SL........VLTRTF.AITLELIHSQEEYAK-l.....................................................................
G1Q0C4_MYOLU/1-133                     ..........................msiqyseniskhsfdifipnvivl-----.-----.---.-----.----.-........-.-.-...--.LY........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..S.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSSTAVIE................................kSSSS.R.PGAHEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLANEMS-----nkgel.................................................................
A0A1S3GRE8_DIPOR/1-136                 ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A044T7H3_ONCVO/383-519               ..................................................MTLQW.FVVAL.ILY.LEIAV.VLLL.L........L.P.W...IR.PS........L...wSKFF.K.............S..R..M.....VK..T......F..E....K..H.AN..V..Y........F..............I..S.VLCI......L..LL.......LF..A................DAIR.E......VR.KYANEVAIE................................aSIRH.T.ADSENVVHMR.LF.R.A...QRN.L..YIS..GFALL.L.FL........VIKRLV.ALLSRGALLEAAAEA-a.....................................................................
A0A0B2QTY3_GLYSO/1-126                 ..................................................MALQW.LILTY.VVA.AEAAV.AILL.T........L.P.T...PK.LL........R....DRFA.S.............L..V..S.....L-..-......-..-....-..I.LQ..P..A........L..............-..F.IVPF......A..GF.......QL..L................DIYW.K......NE.HRLMCTS--.................................-EVC.T.AAERDRYEKS.IY.K.A...QRN.V..ILC..VTACL.L.YW........SISRIC.KYQKEIQSLEE-----gekri.................................................................
A0A1S8VN41_9FUNG/1-145                 ..................................................MSLFN.KLTYY.MLW.VEVAL.YLAS.L........L.P.LsflTA.KT........R....RDGM.N.............W..I..V.....KI..T......S..N....E..Y.AI..W..T........C..............R..I.ILMI......I..AG.......VF..A................DNVL.R......LL.RLDGENHDSnah..........................hhnhHSGA.E.FAYDLQSKYQ.RF.Y.S...QRN.V..YMS..AFTLF.M.IL........VLYRRF.LDMYR-----------itqleldvsat...........................................................
A0A163AAC1_DIDRA/1-142                 ..................................................MTLYY.SLVFL.LLV.TEMLI.FCAL.I........V.P.L...PF.TW........R....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQVELSSFggn..........................nqqgGQAL.G.GIERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEELKT-y.....................................................................
D0NSH4_PHYIT/1-126                     ..............................................mlln-----.KLMFW.LMI.TEAVV.CLLL.S........L.P.F...GQ.WI........A....HAVI.T.............F..L..A.....KT..L......K..D....T..P.AS..T..V........A..............T..V.VLSI......I..SL.......LF..I................SDVM.T......VY.KHHSSDEVL.................................----.-.---GDGLRIR.LL.T.A...QRD.M..YIT..GFCLF.L.FL........LLRLVY.ITLATNLRLEKNLAA-m.....................................................................
B8AJZ5_ORYSI/1-126                     ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..VSACL.L.YW........CIFRIC.KYNKDIKALEET----ekrl..................................................................
K5X172_AGABU/1-139                     ..................................................MTIYY.LLTFL.LLA.AEMVT.FCVL.V........S.P.L...PF.YV........R....KRVL.T.............L..L..T.....TS..T......F..V....S..R.IA..Y..G........L..............K..I.SFIF......V..GI.......LF..A................DALQ.R......MY.RITVEAESAks.............................tsSGAI.D.ARSESNLHAR.KF.Y.S...QRN.V..YLT..GFCLF.L.SL........VLIRTF.QIMRDLIQTQEECGQ-l.....................................................................
A0A1Y1ZBT5_9FUNG/1-134                 ..................................................MALYY.SLVFG.LLI.FEMSL.FVMM.V........F.P.F...PK.KW........R....RVVF.M.............K..I..D.....ES..G......I..I....R..K.NQ..W..I........I..............N..V.VGVF......V..FI.......LF..A................DSIN.R......MI.KASAEADQA.................................N-LA.D.PRTDTQLHVK.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILDRTF.SILMDLFLAEEKLEK-i.....................................................................
A0A0D3FA63_9ORYZ/1-127                 ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.GL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........-..............M..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCDD--.................................EHHC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.SLVVRLDQLQQRVDK-l.....................................................................
A0A284RQV1_9AGAR/1-139                 ..................................................MTIYY.SLTFL.LLA.AEMGT.FCLI.V........L.P.L...PH.TV........K....KRVF.S.............F..L..S.....TS..P......F..V....A..K.IA..Y..V........L..............K..I.SFIF......V..GI.......LF..F................DALQ.R......MF.RVTAEAELAks.............................gqQGVS.D.VRTETNLAAR.KF.Y.S...QRN.V..YLT..GFTLF.L.SL........VLTRTF.SIILDLIQVEEEV---lky...................................................................
A0A197JNB3_9FUNG/1-134                 ..................................................MSLPY.TMVFT.LLM.TEMIT.FIFL.I........L.P.L...PF.KW........R....RGML.N.............F..L..S.....KS..P......F..M....A..N.IQ..Y..V........M..............K..I.VFIF......V..FI.......LF..I................DSLN.R......VI.KVEEVNNEN.................................-THH.H.PHTETTVAAR.RF.Y.A...QRN.M..YLT..GFTLF.L.SL........ILNRTF.FMILDLLKSEEKME--iv....................................................................
A0A137NZJ0_CONC2/1-133                 ..................................................MALYY.SIVFA.ILC.TEIML.FLGL.L........V.P.L...PK.SL........R....KRAL.L.............W..I..-.....NN..N......I..I....K..Q.VD..Y..T........L..............K..V.VFVF......I..FI.......LF..I................DSVN.R......MM.KATEAADSV.................................-VGG.D.VRVDNAAHAK.KF.Y.S...QRN.M..YLT..GFTLL.L.SL........ILNYTF.SLLLALLTAEEKLE--vl....................................................................
A0A059J0R8_9EURO/1-139                 ..................................................MTLYF.TLVFV.LLV.TEMAI.FVGL.I........V.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......V..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELTGFda.............................anSGHA.I.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDILRLEDKVK--my....................................................................
A0A0D2HBQ7_9EURO/1-143                 ..................................................MTLYY.SLVFV.LLV.AEMLL.FMAL.I........V.P.L...PF.TV........K....RKMF.N.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMAALmkdt.........................tgagRAAA.I.GSERMEVQAR.RF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVK--my....................................................................
A1CNY2_ASPCL/1-127                     ..................................................-----.-----.---.--MVV.FMGL.I........V.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFsre..........................gnpmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDRVKH-l.....................................................................
A0A2I4BXV6_9TELE/1-135                 ..................................................MTLQW.TTVAV.FLY.SEIAV.NLIL.C........V.P.F...IS.AQ........R...wRLVF.N.............W..R..I.....WS..W......L..S....L..Y.WN..K..C........F..............F..A.IIMV......L..IV.......LF..L................DAIR.E......VQ.KYSDADMQD.................................-ANA.N.PNLYDHVHMK.LF.R.A...QRN.L..YIC..GFSLF.L.WL........VMRRVV.TLLSQVAATLEDS---agl...................................................................
A8PVX4_MALGO/1-70                      ...............................................mlk-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.-VSQESHVNe..............................raQGLH.D.FRSETNYHAK.KF.Y.A...QRN.V..YLT..GFTLF.L.SM........ILARTH.SLVLDLINAQEELAA-n.....................................................................
C5DWZ2_ZYGRC/1-140                     ..................................................MSLYL.STLFA.LLT.LEMAI.LFLV.V........L.P.L...PF.RV........R....RNFY.S.............L..Y..Y.....RW..T......S..N....R..K.VQ..T..T........I..............Y..I.FAGL......V..SI.......LF..V................DSWR.R......AQfKVHLHHY-Qrq............................gedVDDN.S.AVTPTQALAS.RA.Y.N...QRN.T..YIS..GFILY.F.LV........CIPAVF.TIIRRLIKYQNLI---nnl...................................................................
A0A139IN82_9PEZI/2-102                 ...........................................rarlstd-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..M........T..............Q..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAQAkyqg.........................gaagVAAV.A.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILDTLRLEEEVKN-l.....................................................................
G3TMW4_LOXAF/1-136                     ..................................................MSLQW.VAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAGR.E......IW.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
G8BPF6_TETPH/1-141                     ..................................................MSLYN.NLVFI.ILL.SEIVA.FTIL.S........L.P.L...PS.KV........R....RPLT.L.............T..I..I.....KP..F......Q..N....Q..K.VQ..T..I........I..............K..C.VIVF......I..LI.......LF..V................DSIN.K......VY.KVELELKAHsit...........................gsvVQTS.T.STDRVEIHSR.KF.L.A...QRN.M..YLT..GITLF.L.SF........AVVRAF.NLVTELLKLKEKYQK-s.....................................................................
I1RBH5_GIBZE/1-143                     ..................................................MTLYY.TLVFM.LLV.FEMGM.FVLL.I........F.P.M...PF.GV........R....RKIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQLELAAAseqa.........................khggGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIIEVMRLEDKVRS-y.....................................................................
A0A1I8Q9X0_STOCA/1-135                 ..................................................MSLIW.TLIDV.FLF.IELVI.VLLL.T........L.P.I...AS.AT........T...wNRFF.K.............S..Q..F.....LA..M......L..A....K..Q.AH..L..Y........F..............S..M.IIGL......L..VL.......SL..I................EALR.E......MR.KYSFEGGQE.................................-EEQ.H.LDVEMQQHMR.LF.R.A...QRN.F..YIS..GFAIF.L.VM........VIKRLI.NLISHQAFLLAESEA-s.....................................................................
A0A1Y2GW44_9FUNG/1-137                 ..................................................MSLPY.TMVFT.LLM.TEMIT.FIFL.I........L.P.L...PF.KW........R....RGML.N.............F..L..S.....KS..P......F..M....A..H.IQ..Y..V........M..............K..I.VFIF......V..FI.......LF..L................DSLN.R......VI.KVEEIVSDSd...............................hHHHH.H.AHTDTSVAAK.RF.Y.A...QRN.M..YLT..GFTLF.L.SL........ILNRTF.FTILDLIKSEEKME--vv....................................................................
A0A2H3EVZ6_9HELO/1-139                 ..................................................MTLYY.SLVFL.LLV.AEMTL.FMLL.I........V.P.L...PF.TI........R....RRMF.T.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELAEAnk.............................tsGQAV.M.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEEKVKK-y.....................................................................
A0A0V0Y8S9_TRIPS/156-291               ..................................................MSLQW.TLVAL.LLY.VEVFV.LSCM.L........L.P.W...IR.PS........S...wQRLF.R.............S..R..F.....LR..F......I..Q....T..Y.SS..Y..Y........I..............Y..C.FAIM......L..LL.......LF..L................DALR.E......VR.KYSDVDFVK.................................QSAG.N.VQGEFSTHMR.LF.R.A...QRN.L..YIS..GAALF.L.WF........AIQRVA.SMISREAMLIASAEA-a.....................................................................
A0A0B1SH77_OESDE/1-59                  .............................................mettv-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................--RH.T.ADADAVIHMR.LF.R.A...QRN.F..YIS..GFALL.L.FL........VIKRIM.SLISRGAQLEAASEA-a.....................................................................
A0A0U5GTA2_9EURO/1-142                 ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........V.P.L...PF.TV........R....RKLF.A.............F..V..S.....ES..P......I..I....A..K.LQ..Y..G........L..............R..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEVAAFgke..........................ggnmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRIK--ll....................................................................
A0A1E5S0U0_HANUV/1-142                 ..................................................-----.-----.---.--MVL.FLAL.I........L.P.L...PS.KV........Tp.lkKHFVrT.............L..N..F.....IA..Y......T..N....E..T.TK..I..V........S..............R..S.VFVF......I..FL.......MF..V................DSIK.K......LQ.NISLTSSTYrnnelfss.................ssfkneytGSQI.E.ALNKNEFYRE.KF.F.A...QRN.M..YLT..GFTLF.L.CF........LILRTI.HITNELLDSL------aikkqyea..............................................................
A0A0L0S791_ALLMA/1-145                 ..................................................MSIPN.RLALI.LLI.TEIIV.FLIL.V........L.P.M...PR.SV........R....KTIT.K.............F..I..T.....QS..W......I..V....T..K.LV..T..A........F..............R..W.TFIF......L..AL.......LF..I................DSFT.R......QY.KMTKERAEVieegh.......................yhhqhGNLG.I.ITGDLDPRAK.LY.Y.A...QRN.M..YMV..GFALF.M.MV........VLDRYR.AVLLELVQSEEQVAE-l.....................................................................
A0A0N4UC71_DRAME/313-449               ..................................................MTLQW.FAVAL.ILY.IEVGL.VFLL.L........L.P.W...IR.PS........L...wKKFF.K.............S..R..L.....VL..A......F..A....R..F.GN..V..Y........F..............I..S.ILCV......L..LL.......LF..A................DAVR.E......VR.KYAGEAALE................................aSIRH.T.ADAENAIHMR.LF.R.A...QRN.L..YVS..GFALL.L.FL........VIKRLS.ALLSRCAQLEVAAEA-a.....................................................................
A0A0D2AKG4_9EURO/1-143                 ..................................................MTLYY.SLVFA.ILV.SEMVL.FISL.V........V.P.M...PF.TV........K....RKMF.N.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMAALmndt.........................tgagRAAA.I.GTDRMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVK--my....................................................................
A0A137QUF2_9AGAR/1-130                 .................................................l-----.-----.TLL.RQMVT.FCVL.V........A.P.L...PF.GI........R....KRLF.L.............F..L..S.....TS..A......I..V....A..K.IA..Y..I........L..............K..I.SFIF......V..AI.......LF..A................DALQ.R......ML.RITAETELAks.............................gkAGIP.D.VRAETNIHAR.KF.Y.T...QRN.V..YLT..GFCLF.L.FL........VLTRTF.HMMFELIKTQEEYAK-l.....................................................................
A0A1A9Y7Y1_GLOFF/1-140                 ..................................................MGLLW.TLIIG.FLY.AEIAA.VICL.V........F.P.I...GS.PR........K...wDRFF.K.............S..K..F.....LS..R......L..S....K..K.AQ..A..Y........F..............I..I.VMSV......L..LL.......LL..V................DAFL.E......MR.KYSNEEYRN.................................-VDL.R.LNSKMHQNTR.LF.R.A...QPNaL..Y--..-----.-.--........------.----------------wtsggriltitllvvgytfqrdlrdlsilkkkvkqa..................................
A0A182V3X3_ANOME/1-135                 ..................................................MTLVW.GIIAS.FLY.VEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHTH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
A0A2G2X856_CAPBA/1-126                 ..................................................MALQW.MILTY.VVA.AEAAV.AILL.T........L.P.Y...PK.AL........K....NRFV.S.............L..V..S.....LT..L......Q..P....S..-.--..-..-........-..............L..F.IIPF......A..GF.......QL..L................DIYW.K......NE.HRL---MCT.................................GEIC.T.AAERDRYERS.IY.K.A...QRN.A..ILC..VAACL.L.YW........CIYRVC.KYYKEIQSTEEV----ekrl..................................................................
L8WVF5_THACA/1-34                      ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.M..YLT..GFTLF.L.SL........ILTRTY.YILLDLIHSQEQYAE-l.....................................................................
G7KQC5_MEDTR/1-126                     ..................................................MALQW.MILTY.VVA.IEAAV.AILL.T........L.P.S...PK.LL........R....NRLT.S.............L..I..S.....LI..L......-..-....Q..P.AL..-..-........-..............-..F.IVPF......A..GF.......QL..L................DIYW.K......AE.HRLMCTSD-.................................--VC.T.AAERDRYEKT.TY.K.A...QRN.V..ILC..ISACL.L.YW........AIYRIC.KFQKDIQSMEE-----vekri.................................................................
A0A0D3FG12_9ORYZ/1-104                 ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..V----.-.--........------.----------------sacllyw...............................................................
H3CLK1_TETNG/1-136                     .................................................f-SIHF.TSPAV.YFY.LTVGK.VLKV.C........A.P.M...VR.YS........K...wQSIF.H.............L..R..V.....WA..S......L..A....R..F.WN..R..F........F..............L..T.MIVI......L..IV.......LF..L................DAIN.E......VW.KYSVRDAAT.................................EAKL.R.TNMYDHLHMK.LF.R.A...QRN.L..YIS..GFAVF.L.WL........VMKRVV.TLINQLATASAGI---aaf...................................................................
A0A178ZXD9_9EURO/1-143                 ..................................................MTLYY.SLVFM.LLV.AEMVL.FLAL.I........I.P.M...PF.TF........K....RKMF.N.............F..I..S.....ES..P......L..V....A..K.VQ..Y..G........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMAALskdt.........................sgvgRAAA.I.GSERMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVK--my....................................................................
A0A1C7NNE1_9FUNG/1-133                 ..................................................MTLYY.SIVFG.ILA.AE---.----.-........L.P.V...PT.RW........Q....KPVF.R.............W..L..A.....TS..P......F..M....A..H.AQ..Y..V........M..............R..I.VFAF......I..FV.......LF..L................DAVN.T......LR.AFYDVVSEEegg...........................ippAGNA.D.FRAQVGQAAK.KF.Y.A...QRN.L..YLT..GFTIL.L.LL........ILGKIK.AMSMDYIRLEDQY---iel...................................................................
A0A1Q2YBF8_9ASCO/1-140                 ..................................................MAFQY.VLTFS.LLV.VEMVM.FSLI.S........F.P.L...PS.KI........R....RPLL.K.............G..L..S.....IP..F......H..S....Q..Q.FQ..V..V........T..............K..C.VFVF......I..GI.......MF..A................DSVN.R......TI.KVTNELYNGtl............................asnDMLN.G.GVSRAEIQSR.RF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMVFDLLEVKEKVKR-l.....................................................................
I1IFJ0_BRADI/1-127                     ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.AL........R....RGMI.S.............V..V..R.....--..-......-..-....G..A.LK..P..M........-..............M..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCGDEH.................................--AC.T.PSEHLRHQKS.II.K.S...QRN.A..LLI..GAALL.L.YW........ILFSVT.SLVVRLDQLQQRVDK-l.....................................................................
A0A165PBQ3_9APHY/1-139                 ..................................................MTIYY.SLTFM.LLA.AEMAT.FCIL.V........A.P.L...PY.GI........R....KRFF.R.............F..L..S.....ES..P......F..I....A..K.LA..Y..G........I..............K..I.SFIF......V..GV.......LF..V................DAFQ.R......MV.RVAAEADLAkt.............................sgSGVQ.D.VRSETNFAAR.RF.Y.A...QRN.T..YLT..GFTLF.L.SL........VLTRTF.YILLDLIHTQEEYAK-l.....................................................................
A0A2I3TRW4_PANTR/1-136                 ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......L..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
H2AWQ1_KAZAF/1-133                     ..................................................MSLYF.TLLFA.LLT.TQMAI.LFVL.V........L.P.L...PN.KM........R....KMCY.N.............M..W..E.....IA..S......M..K....Q..E.FK..V..I........I..............V..M.LNIL......V..GL.......LF..V................DSWK.R......AH.VPIRHKGVN.................................--DL.D.STLSMQGLAS.RA.Y.N...QRN.V..YIS..GFILY.F.MA........GIPTVL.SIVRRLIKYQDLI---nek...................................................................
A0A096NF84_PAPAN/1-137                 ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................rSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
W6U5T3_ECHGR/809-947                   ..................................................MSILW.TITAA.CLY.TEAAV.ITLL.L........M.P.F...IS.SR........I...wNAVF.K.............S..R..I.....VG..R......L..S....S..Y.AS..F..Y........F..............N..G.CLLI......L..GL.......MV..F................EAVR.Q......VR.YQNHVYQELk..............................sdPSIF.K.PETESVYLMK.LF.R.A...QRN.L..YIS..GFCLF.L.WF........VFKRLV.TLIADHARVTAAGE--as....................................................................
Q6FWF0_CANGA/1-146                     ..................................................MSLYY.ALVFG.ILV.LEIAV.FSVL.S........L.P.L...PT.RI........R....RPMM.L.............V..L..L.....KP..F......R..A....P..T.VQ..V..G........I..............K..C.ILGF......I..LI.......LF..I................DCIT.K......VY.NINRELNAGskgqs......................ntagatGGTV.F.AQDRIEVVSR.KF.L.A...QRN.M..YLT..GITLF.L.TF........VVVRTY.ALVSELFQLKDNYRA-a.....................................................................
M3Z3H0_MUSPF/1-137                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..T..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSSSPAIE................................kGLTT.R.PGAYEHAQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.ILITQLAKEL------snkgvl................................................................
A0A168RPB3_ABSGL/1-121                 ..................................................-----.-----.---.--MFM.FGIL.V........L.P.L...PS.RW........R....RAML.K.............F..V..S.....TS..P......L..V....A..K.AL..Y..V........L..............K..I.VFGF......I..FV.......LF..I................DTVN.R......LQ.RIESVNEEE................................qRVAH.D.YSYEANLKAK.KF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.TLVIQMLKREEELEN-a.....................................................................
A0A0C3NCX0_PHLGI/1-139                 ..................................................MTVYY.TLTFM.LLA.SEMAT.FCVL.V........A.P.L...PY.AV........R....KRLF.R.............F..L..S.....ES..P......V..V....A..K.FA..Y..G........L..............K..I.AFIF......V..AV.......LF..I................DALQ.R......MW.RVTAEADIAkn.............................ngGAIH.D.ARAETSFAAR.KF.Y.A...QRN.T..YLT..GFCLF.L.SL........VLTRTF.YILLDLIHSQEEYAK-l.....................................................................
A0A1Y2I3U0_9FUNG/1-119                 .................................................m-----.-----.---.-----.----.-........-.-.-...PL.VI........R....KHVV.K.............F..V..S.....TS..W......L..F....E..Q.LF..Y..Y........L..............R..W.SIIG......V..AV.......LF..A................DSLQ.R......SY.SIQADIRAHklav........................qdgdhHHHL.H.ADADAVLKSK.LF.Y.A...QRN.M..YIT..GFTML.L.AI........VLNRVF.NLQKEVMKYKERS---svv...................................................................
A0A1I8B998_MELHA/1-104                 ..................................................MTLQW.TIIAF.ILY.AEIFV.LLIL.M........L.P.W...IR.PT........M...wKKVF.N.............S..R..I.....VH..S......F..K....N..F.SN..V..Y........A..............Y..A.FIFV......L..LL.......LF..V................DATR.E......VR.KYSHIDLAK.................................EIPS.R.ADADAVIHMR.LF.S.-...---.-..---..-----.-.--........------.----------------virriv................................................................
A0A1E4SDZ8_9ASCO/1-127                 ..................................................MSIQM.LIIFG.LLI.LQMSL.LVVL.L........L.P.L...PH.IV........R....VRLI.K.............I..S..D.....SL..E......K..N....P..N.FT..V..V........L..............V..F.SIIL......L..GM.......QF..L................DCLN.K......LK.RFTDHGDVW.................................N---.-.----HDQMAS.KF.Y.A...QRN.L..YLT..GAVLY.L.YL........AIYTVV.RTVKKLVAKESEYRK-l.....................................................................
C9JQ75_HUMAN/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......L..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A162KNH6_CORDF/1-143                 ..................................................MTLYY.TLVFA.LLM.FEMLL.FMFL.I........V.P.L...PH.NI........R....RNIL.T.............F..V..S.....EN..K......T..I....A..Q.IQ..H..W........L..............K..I.TFIF......I..LV.......LF..V................DSVN.R......VY.RVQMELADSmeqa.........................akggGTVV.L.GHERTEVQAR.KF.Y.A...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIKDIIRLEERIR--vy....................................................................
Q8JFW7_DANRE/1-135                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........V.P.F...IS.PK........R...wSKFF.K.............S..R..L.....VT..A......I..T....S..Y.GN..T..A........F..............I..V.IICI......L..VF.......LL..I................DAFR.E......VR.KYSVAEKVD.................................-LSN.N.PVAIEHIHMK.LF.R.A...QRN.E..YIA..GFALL.L.CL........LLRRLA.TLLSQQATLMASHEA-f.....................................................................
A0A1V6RN74_9EURO/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMVV.FLAL.V........I.P.L...PH.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQQELSAFtkd..........................gpgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILESLRLEDRI---rll...................................................................
A0A091M4Z1_CARIC/1-134                 ..................................................MTFQW.TAVAT.FLY.GEIGV.ILLL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..I........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSAVHVIE................................kAVNV.N.TNAFDHIQXX.XX.-.-...-XX.X..YLS..GFSLF.L.WL........VLRRTV.TLLTQLAKEMASHAA-l.....................................................................
Q6AY58_RAT/1-136                       ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A0B2UMG6_9MICR/1-120                 ..................................................MGITT.NLVQA.VLL.VEMSV.FTFM.L........L.P.V...SK.GL........K....KSIL.K.............V..F..M.....AS..K......L..Y....R..G.IL..H..I........L..............Y..V.LLAM......I..LV.......MF..V................DSAY.K......IY.TGEDYAN--.................................----.-.-------PFV.LY.Q.A...ERN.L..YLT..GFTLF.L.AV........IFQMFI.KMMSLLFKEEES----all...................................................................
K0KYF7_WICCF/1-146                     ..................................................MALYY.NLVFG.LLV.IEMVL.FTTL.S........L.P.L...PS.KI........R....KPIL.K.............A..I..S.....AP..F......Q..K....T..E.VN..V..A........I..............K..C.VLVF......I..FV.......LF..V................DSVN.R......VN.TINEELTGLstsqn......................ldptihNTYN.P.MADRSEIQAR.RF.Y.A...QRN.M..YLT..GFTLF.L.TL........ILTRTY.RLVAELLSLKEEYR--sd....................................................................
H2MWD2_ORYLA/1-135                     ..................................................MSLQW.TAVAT.FLY.VEVFL.VLLL.C........I.P.F...IS.PK........R...wSKVF.K.............S..R..I.....LQ..T......I..A....L..Y.GN..T..W........F..............M..V.AIAI......L..VF.......LL..I................DAFR.E......VR.KYSVSDKVD.................................-VTN.N.PTAIEHIHMK.LF.R.A...QRN.E..YIA..GFALL.L.CL........LLRRLA.TLLSQQASLMASNEA-f.....................................................................
A0A1L0B8U7_9ASCO/1-139                 ..................................................MSIQM.TLVFG.ILV.TQMTA.LLLL.L........L.P.L...PH.VV........R....MRLL.D.............G..Y..A.....VL..K......R..N....T..N.VR..V..G........V..............V..F.TTIL......L..GL.......QF..L................DCVK.K......VR.RYATLDNPYya.............................qfNAGQ.P.MALLPDKLAS.KF.Y.A...QRN.L..YIT..GAVLY.L.EL........AIQTVI.TILDKLVRKENSYRE-l.....................................................................
J9D833_EDHAE/1-121                     ..................................................MGITT.ITVQI.LLI.SELTL.FTSL.I........L.P.L...PY.KR........S....LISY.F.............A..T..S.....KS..V......T..L....R..T.IK..H..I........L..............L..A.LYAM......V..TI.......MF..I................DSIH.K......VC.INKGTPNL-.................................----.-.--------PF.MY.H.A...ERN.M..YLT..GFTLY.I.AL........IFYAFC.RLLLKLH---------ldemnasvl.............................................................
A0A067DUF8_CITSI/1-126                 ..................................................MALQW.LILAY.AVA.AEAAI.AILL.T........I.P.S...PK.LL........K....NRLV.S.............L..V..S.....LI..-......-..-....-..-.LQ..P..A........L..............-..F.IVPF......A..GF.......QL..L................DIYW.K......SE.HRLMCTSE-.................................--IC.T.AAERDRYEKS.IY.K.A...QRN.V..ILC..AAACL.L.YW........SIFRIC.KYYKDVQRLEEV----ekry..................................................................
A0A1V6QUV4_9EURO/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMGV.FLAL.V........I.P.L...PH.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELSAFtkd..........................gpgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRV---rlf...................................................................
R0GRR5_9BRAS/40-165                    ..................................................MALQW.LILSY.VVA.VEVVI.ALML.T........L.P.Y...PM.LL........K....KRVV.Q.............L..V..S.....LI..L......-..-....Q..P.AA..S..-........-..............-..-.IVAF......S..GF.......QL..L................DIYW.K......AE.HRL---SCS.................................SEVC.T.ATERDRYEKS.TY.K.A...QRN.V..VLC..AAGIL.L.YW........CIYRIC.KYNKDLELLE------atekrf................................................................
A0A0K9NSA4_ZOSMR/1-126                 ..................................................MGLQW.MILTY.AVG.AEAAI.ALLL.T........I.P.S...PT.LV........K....KQIV.S.............L..I..S.....K-..-......L..L....Q..P.--..-..-........L..............T..G.IVPF......A..AF.......QL..L................DIYW.K......NE.HRMLCTSE-.................................--VC.T.SEERARFEKA.MF.K.S...QRN.V..ILC..VSAIM.L.YW........SMYQIV.KFYKSIEKLEEE----eklr..................................................................
A0A0K8LLU8_9EURO/31-171                .............................................dwslk-----.--VFC.LLV.FEMAV.FMGL.I........I.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFtkdg.........................ngmgRAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDRVKH-l.....................................................................
A0A0M8MPX8_9BASI/1-138                 ..................................................MTLYY.SIVFA.LLI.LEMAM.FMLL.I........V.P.L...PF.SA........R....RKLF.R.............F..L..A.....TS..E......I..V....G..Q.IN..Y..C........I..............R..I.TFIF......V..AV.......LF..I................DAFQ.R......MM.KVSQEFKVAe..............................grEGFQ.D.FRTETNYHAK.KF.Y.A...QRN.V..YLT..GFTLF.L.SL........ILARTH.SLVLDLINTQEEL---van...................................................................
A0A2B7ZRD5_9EURO/1-142                 ..................................................MTLYY.SLVFL.LLV.VEMAI.FVGL.I........I.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELSSSske..........................mggsGTAA.V.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDRLKQ-l.....................................................................
H0GZ86_SACCK/1-87                      ...............................................mvg-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.IMIF......V..GL.......LF..I................DSWK.R......SQiKVSTYHSQK................................pPYVI.N.TVTPVDALAS.RA.Y.N...QRN.V..YIS..GFIIY.F.CI........CILTVM.SILRRIVEWNDKIK--ag....................................................................
A0A0M3KFA7_ANISI/1-150                 ..................................................MSLQW.SAVAL.ILY.VEIAI.LLLF.L........L.P.W...IR.PS........F...wNKIF.K.............S..R..L.....VR..W......F..E....Q..H.AQ..V..Y........S..............I..A.GTAV......L..LL.......LF..M................DAIR.E......VR.KYSSEIAXX.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------xxxxxxxxxxxxxxxxxxxxxxxxrslemtrffklavelvvrsivkisvirrlmsllsrgaqleaaaeaa
R0M088_NOSB1/1-119                     ..................................................MGITT.QLVQS.ILY.AEMSL.FTLL.I........L.P.L...PN.YV........S....RMFI.S.............M..F..H.....ES..K......F..S....R..P.FA..H..I........L..............W..V.LYIM......I..FI.......LF..I................DSIY.R......QY.NTIED----.................................----.-.-------RIL.AY.Y.T...ERN.F..YLT..GFTLY.L.AL........IFKMFT.TMLIKLYKEEQSA---kil...................................................................
A0A088AVC9_APIME/1-134                 ..................................................MSLQW.TLVAA.FLY.IEIAV.VLLL.V........L.P.I...IS.AS........R...wQKFF.K.............S..K..F.....LK..R......L..S....N..Q.AS..I..Y........F..............L..I.LIGI......L..VL.......FL..L................DAIR.E......IR.KYSMIDEHK.................................E--H.H.LDAEMQGNMR.LF.R.A...ERN.F..YIS..GFALF.L.CL........VIQRLV.ILISTQATLLAQNEA-a.....................................................................
A0A158QFB3_HYMDI/1-139                 ..................................................MSSLW.VLVAG.GLY.AEVAV.ITIL.L........L.P.F...IP.SR........V...wNRIF.K.............S..N..F.....IA..W......L..S....S..Y.AS..F..Y........F..............N..S.CVVG......L..CL.......TV..F................EAWR.Q......VR.YKNEMYHEYk..............................sdPSNF.K.AGTEALYLMK.LF.R.A...QRN.L..YIS..GFALF.L.WF........VFNRLV.RLIADHARVTAAGE--as....................................................................
A0A087XET9_POEFO/1-136                 ..................................................MTLQW.TAVAL.FLY.AEIVV.ILIL.C........I.P.F...IP.AR........R...wQSIF.Q.............L..R..I.....WS..W......M..A....R..F.WN..K..V........F..............L..T.MIIV......L..IV.......LF..L................DAVR.E......VR.KYSSKEIGT.................................DAKV.Q.PNMFDHLHMK.LF.R.A...QRN.L..YIS..GFAVF.L.WL........VMKRVI.TLINQLAAVSGTT---aal...................................................................
A0A1U8J8H1_GOSHI/1-126                 ..................................................MALQW.MILTY.MVA.AEAAL.ALLL.T........L.P.S...PK.LL........K....NRLV.S.............L..I..S.....L-..-......-..-....-..I.LQ..P..A........L..............-..F.IVPF......A..GF.......QL..L................DIYW.K......NE.HRLMCTSE-.................................--IC.T.AAERDRYEKS.FY.K.S...QRN.V..ILC..VTACL.L.YW........CIQRIC.KYNKEIQSLEE-----iekry.................................................................
C9JM14_HUMAN/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......L..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
G0N6G5_CAEBE/1-134                     ..................................................MTLQW.TIVAG.VLY.AEIAA.TFIL.L........L.P.W...IR.PT........L...wSKLF.K.............S..R..L.....FT..A......L..S....K..H.AQ..I..Y........S..............M..A.FGFV......L..FI.......LF..A................DGVR.E......TM.KYNGLEDKM.................................Q--R.T.AESDATHHMR.LF.R.A...QRN.L..YIS..GFSLL.L.FM........VIQRIM.TLLSRAAQLEAAGEA-a.....................................................................
A0A094E4L4_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMGL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.IQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAse............................qsqTGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
A0A095C348_CRYGR/30-109                ..............................................nsrs-----.-----.---.-----.----.-........-.-.-...--.-S........A....QSMF.H.............F..L..S.....EN..P......V..V....A..K.IQ..Y..G........L..............K..I.TFIF......V..AV.......LF..V................DALQ.R......MI.RIAQEGATAkmk..........................qdmaD---.-.--AR------.--.-.-...---.-..---..-----.-.--........------.----------------tetnyytalqaktaka......................................................
A0A0L0USV7_9BASI/1-140                 ..................................................MALYN.WMVFS.LLI.IEIVT.FIVL.V........M.P.L...PF.TW........R....RVLF.R.............F..L..A.....TS..K......L..V....A..K.LQ..Y..A........L..............K..I.LFIF......V..TV.......LF..V................DSVQ.R......MT.KIHHEGEAAke............................qgaGVGR.D.LRSETDWRSR.KF.L.S...ERD.M..YMR..GFTLF.L.SL........ILARTF.SLILDLIKAQEDLA--tl....................................................................
A0A091U0X5_PHORB/1-137                 ..................................................MTFQW.TAVAA.FLY.GEIGV.ILVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSAVHVNE................................rAANI.N.SNAFDHIQMK.LF.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTV.TLLTQLAKGMASHA--al....................................................................
A0A158PQ26_BRUPA/322-458               ..................................................MTLQW.FVVAL.ILY.LEIAV.VLLL.L........L.P.W...IR.PT........L...wSKFF.K.............S..R..I.....VN..T......F..E....K..H.AT..V..Y........F..............I..S.ALCI......L..LL.......LF..A................DAIR.E......VR.KYANEVAIE................................gSIRH.T.ADSENVVHMR.LF.R.A...QRN.L..YIS..GFALL.L.FL........IIKRLV.ALLSRGALLEAAAEA-a.....................................................................
H3FBZ0_PRIPA/256-366                   ...............................................wtk-----.-----.---.-----.----.-........-.-.-...--.--........K...wSKLF.K.............S..R..V.....VA..T......I..S....S..F.GQ..V..Y........S..............I..A.AALI......L..FI.......LF..A................DAVR.E......VG.KYSHVDSALd...............................gTARH.A.ADADAVIHMR.LF.R.A...QRN.F..YIS..GFALL.L.FL........VIKRIT.GLLSRAAQMEAASEA-a.....................................................................
A0A1Y2D6B2_9PEZI/1-141                 ..................................................MTLYY.TLVFL.LLV.AEMAL.FMLL.V........L.P.L...PF.TI........R....RKMF.N.............F..I..S.....EN..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQVELAAAteg...........................skgNASI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.SMILEVLRLEDKVKQ-y.....................................................................
E7KL18_YEASL/1-140                     ..................................................MSLYY.TLVFA.ILV.VEIFM.FSIL.A........L.P.I...PS.RY........R....RPLT.L.............L..L..L.....KP..F......K..S....S..T.VQ..V..A........I..............K..C.ILGF......I..LL.......LF..I................DCIN.R......VY.SIDKELQLSsa............................sqnNGAI.I.AQDRIEVLSR.KF.F.A...QRN.M..YLT..GITLF.L.TF........VVVRTF.GLVIELLTMKDIYR--as....................................................................
A0A0B2WTJ8_9HYPO/60-175                ........................................ylltdrdrdg-----.-----.---.-----.----.-........-.-.-...--.--........-....----.S.............F..I..S.....EN..P......V..I....S..Q.VM..Y..W........F..............K..I.TFVF......I..LV.......LF..I................DSVN.R......VY.RVQLEVVAAsdq...........................tskGAAI.L.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIIDNIKLEDKVRA-f.....................................................................
G1RSQ8_NOMLE/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..F................DAVR.E......IR.KYDDVTERV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
G0P4L3_CAEBE/1-130                     ..................................................MVLPW.TVSPV.VLY.AEIAI.TFFL.L........L.S.W...FR.PI........L...wNKLA.S.............S..R..L.....IT..S......V..S....K..Y.FE..I..C........S..............I..A.FLFV......L..TI.......LF..A................DAER.E......VT.KLIELEDRI.................................----.-.-EINATYHMH.LL.R.A...KKN.V..YVS..GLSII.F.LL........VIRHIM.KSLRSDTQTE------vaksva................................................................
A0A2K5HQC0_COLAP/1-137                 ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................rTSTS.R.PDVYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A0E0CR48_9ORYZ/1-127                 ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.GL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........-..............M..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCDD--.................................EHHC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.SLVVRLDQLQQRVDK-l.....................................................................
A0A1I7W0X2_LOALO/1-137                 ..................................................MTLQW.FVVAL.ILY.LEIAV.VLLL.L........L.P.W...IR.PT........L...wSKFF.K.............S..R..L.....VK..T......F..E....K..H.AN..V..Y........F..............I..S.TLCI......L..LL.......LF..A................DAIR.E......VR.KYAGEVAIE................................aSIRH.T.ADSENVVHMR.LF.R.A...QRN.L..YIS..GFALL.L.FL........VIKRIV.ALLSRGALLEAAAEA-a.....................................................................
Q7PPR9_ANOGA/1-135                     ..................................................MTLVW.GIIAS.FLY.VEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHTH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
A0A0A0AXY1_CHAVO/1-137                 ..................................................MTFQW.TAVAT.FLY.GEIGV.ILVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAIR.E......VR.KYSAVHVTE................................kAANV.N.TNAFDHIQMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRTV.TLLTQLAKGMTSHA--al....................................................................
A0A0A1P6G2_9FUNG/1-139                 ..................................................MTLYY.TIVFA.ILI.AEIFT.FFLL.M........L.P.I...ST.RL........K....KPVF.R.............W..L..A.....TS..P......T..V....A..H.AS..Y..I........L..............K..I.VFGF......I..FV.......LF..I................DSVN.T......LR.AFYEVVHEEen.............................vtPGTS.D.FRAQVNQAAK.KF.Y.A...QRN.L..YLT..GFTML.L.LL........ILNNIK.TMNLEYIRLEDEC---lel...................................................................
M3B0P5_PSEFD/1-143                     ..................................................MTLYY.SLVFA.LLV.FEMTV.FMSL.I........I.P.L...PF.TI........K....RKLF.T.............F..I..S.....EN..P......L..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAQAkyqg.........................gaagIAAV.A.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDTLRLEEEVKN-l.....................................................................
A0A0D8XS56_DICVI/1-139                 ..................................................MTLQW.SIVAT.VLY.VEIAI.TFIL.L........L.P.W...IR.PS........I...wSKLF.K.............S..R..L.....VA..S......L..A....S..Y.GQ..I..Y........S..............Y..A.GAFV......L..FV.......LF..A................DSVR.E......VK.KYSHVELAMe..............................ssVIHH.A.ADADAVIHMR.LF.R.A...QRN.F..YIS..GFALL.L.FL........VIKRII.MLISRGAQLEAASEA-a.....................................................................
A0A1E3Q5D9_LIPST/1-139                 ..................................................MTLYY.TLVFV.LLM.VEMVS.FFFL.V........T.P.L...PF.NL........R....RRLF.H.............F..I..S.....TS..D......I..I....A..R.TQ..Y..T........L..............K..I.VFVF......I..LI.......LF..I................DSVN.R......VY.RVQQDVIASna.............................sgTVIT.T.GTDRTEIQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VLVVDLLAVEDKLAA-m.....................................................................
M9LU23_PSEA3/1-138                     ..................................................MTLYY.SIVFA.LLC.FEMSM.FMVL.I........V.P.L...PF.TW........R....RKLF.H.............F..L..A.....TN..P......V..V....A..K.IQ..Y..G........L..............K..I.TFIF......V..AI.......LF..V................DAVQ.R......MV.KVMSEGETAr..............................dnRGVQ.D.VRTETNYAAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILSRTY.SLILDLINTQEELV--al....................................................................
A0A1A9Y685_GLOFF/1-134                 ..................................................MDLVW.TLLTG.FLY.AEICV.VLLL.V........L.P.V...AS.PH........K...wNRFF.K.............S..T..F.....LA..T......I..T....R..R.FY..L..Y........F..............F..L.IMGV......L..VL.......FL..F................EAIR.E......MR.IYSNWEHSS.................................D--V.P.LSTKMQHSMR.FF.R.A...QRN.I..YIS..GFLIL.L.VL........VIRRLV.RLISVQAQSEASLKQ-a.....................................................................
A0A0D1X545_9EURO/1-143                 ..................................................MTLYY.SLVFV.LLV.SEMVL.FVGL.I........V.P.M...PF.TV........K....RKMF.N.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMASLmnds.........................sgagRAAA.I.GTDRMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVK--my....................................................................
A0A0G0ACM7_TRIHA/1-143                 ..................................................MTLYY.TLVFG.LLM.AEMGL.FMLL.L........I.P.L...PF.NI........K....RRIF.T.............F..I..S.....ES..P......L..I....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..V................DSLN.R......VY.RVQLEVMAAheqg.........................ikgnAAAV.M.GSERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKLKT-y.....................................................................
A0A0C9ZGQ9_9HOMO/1-138                 ..................................................MTIYY.SLTFL.LLA.AEMVT.FCLL.V........F.P.L...PY.TI........R....KNIF.R.............F..L..S.....ES..L......I..V....A..K.VA..Y..A........L..............K..I.SFIF......V..GI.......LF..M................DALQ.R......MF.RVTAEADMLk..............................tsQGMQ.D.VRTESSVAAR.KF.Y.A...QRN.M..YLT..GFCLF.L.SL........VLTRTF.YIILDLIHTQEEYAK-l.....................................................................
A0A2C5ZZG9_9HYPO/1-142                 ..................................................MTLYY.SLVFV.LLM.FEMGL.FMLL.I........V.P.F...PF.TV........K....RKIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..V................DSVN.R......VY.RVQLELLAAteq..........................tskgAATV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDRVRS-y.....................................................................
F2PVT5_TRIEC/1-139                     ..................................................MTLYF.TLVFV.LLV.TEMAI.FVGL.I........V.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......V..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELTGFda.............................anSGHA.I.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDILRLEDKVK--my....................................................................
A0A194V456_9PEZI/1-142                 ..................................................MTLYY.TLVFM.LLM.AEMAL.FMFL.I........L.P.M...PF.SI........K....RRMF.T.............F..I..S.....EN..P......L..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELSAVtdg..........................gnnaRQAI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEEKLKQ-y.....................................................................
A0A182M536_9DIPT/1-135                 ..................................................MTLVW.GIIAS.FLY.VEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHSH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
G3B3D9_CANTC/1-136                     ..................................................----M.TLVFT.SLC.VQMAI.LFVM.V........L.P.L...PH.VF........R....RRIV.S.............L..I..D.....VL..R......S..S....S..N.FK..I..G........V..............G..F.YSLI......L..AM.......QF..A................DCLQ.R......LQ.KLDYMKTPYft............................msnIPGG.P.VGLTNEQLAS.KF.Y.S...QRN.L..YIS..GAVLY.L.EL........AIYTVG.TILKKLVLKEDRLRA-t.....................................................................
A0A1Q5U192_9EURO/1-127                 ..................................................-----.-----.---.--MAV.FLAL.I........I.P.L...PF.TI........K....RKLF.A.............F..V..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELAAFakd..........................gsavSAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEDRVK--ll....................................................................
Q6BS63_DEBHA/1-142                     ..................................................MALYY.NLVFG.LLI.VEMTF.FTFL.S........L.P.F...PR.RI........R....RSVL.S.............T..V..S.....AP..F......R..N....E..Q.FQ..I..A........I..............K..C.VLGF......V..LV.......LF..I................DSVN.R......VY.AVTTELHASsps..........................nqagPSGG.V.LNDRSEVQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.TL........ILTRTY.SLVSELVLTKDKLD--sm....................................................................
A0A2G9G7C4_9LAMI/1-126                 ..................................................MALQW.VILAY.VVA.AEAAV.AIFL.T........L.P.T...PK.AV........K....SRIV.S.............L..I..S.....LV..L......Q..P....S..-.--..-..-........-..............L..F.IIPF......S..AF.......QL..L................DIYW.K......NE.H---RLMCT.................................GEIC.T.AAERDRYEKS.IY.K.S...QRN.A..VLC..IAACL.L.YW........CIYRVC.KYYREIHSMEEV----ekry..................................................................
V7C6Y1_PHAVU/1-126                     ..................................................MALQW.LILTY.VVA.AEAAV.AILL.T........L.P.T...PK.LL........R....NRFA.S.............L..V..S.....LI..-......-..-....-..-.LQ..P..A........L..............-..F.IVPF......A..GF.......HL..L................DIYW.K......NE.HRLMCT---.................................SDVC.T.AAERDRYEKS.IY.K.A...QRN.V..ILC..ITSIL.L.YW........SISRIC.KYQKDVESMEE-----vekry.................................................................
A6QYC7_AJECN/1-144                     ..................................................MTLYY.SLVFL.LLV.VEMVI.FVGL.I........I.P.L...PF.TV........K....KKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELSAYskel........................ggagrRSAA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVKQ-l.....................................................................
A0A0L7QNW2_9HYME/1-135                 ..................................................MSLQW.TLIAG.FLY.VEIVI.VLLL.V........L.P.I...IS.PT........R...wQKIF.K.............S..R..F.....LQ..S......L..G....N..Q.AS..F..Y........F..............L..A.LLAI......L..VL.......LL..L................DAIR.E......TR.KYSTLGDPS.................................-EHT.H.LDAEMQGNMR.LF.R.A...QRN.C..YIS..GFALF.L.SL........VIRRLV.ILISAQATLLAQSEA-a.....................................................................
A0A2K5J3R5_COLAP/1-136                 ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
Q5XIU4_RAT/1-137                       ..................................................MTIQW.AAVAS.FLY.AEIGL.ILIF.C........L.P.F...IS.PQ........R...wHKIF.S.............F..S..V.....WT..K......I..A....S..F.WN..K..A........F..............L..T.IIIL......L..VV.......LF..L................DAVR.E......VK.KYSSINVVE................................kNSAS.R.PAAYEQAQMR.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKE-------itnkgvl...............................................................
H0WUS4_OTOGA/69-204                    ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
E7KGG8_YEASA/1-83                      ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.-MIF......V..GL.......LF..I................DSWK.R......SQiRVSTYRNQK................................nPYII.N.SVTPVDALAS.RA.Y.N...QRN.V..YIS..GFIIY.F.YI........CILTVM.SILRRIVEWNDKMKA-g.....................................................................
K3WFK4_PYTUL/3-137                     ............................................stvwsy-----.-ATFV.LLP.PAVVL.LLLL.T........I.P.F...PS.LL........L...nRGIV.K.............FsdV..V.....LN..L......T..I....G..T.LN..I..F........S..............I..I.TTLA......F..LV.......LC..A................QTYD.L......QK.RYSGVDIHY.................................-VEA.N.YSADLQKKAT.RW.R.S...ERN.W..WIS..ALTFT.I.YW........MLFRFH.AIKKQLLKAQRH----nd....................................................................
A0A1E3PHS3_9ASCO/1-150                 ..................................................MTLYY.TLVFL.ILI.FEMLF.FLIL.V........T.P.L...PY.RI........R....RNLM.L.............C..L..S.....QI..N......Q..F....D..K.LI..L..G........L..............K..F.TFVF......I..LI.......LF..I................DSVN.R......VY.SVQQDFYTAgeaggav..................gvgnaataGAGF.I.NADRSEIQAR.KF.Y.A...QRN.M..YLC..GFTLF.L.TL........ILNRTY.VMVFELLELKEQHKA-l.....................................................................
A0A1D2MYG5_ORCCI/1-134                 ..................................................MSLQW.SIVAG.FLY.SEIVV.LIIL.L........L.P.I...IS.PQ........R...wNRIF.R.............S..K..I.....LH..S......L..G....T..Q.TA..L..Y........F..............Y..G.LFGL......L..AL.......LF..L................DAIR.E......MR.KYSSEEYDL.................................N--T.N.PKAEMQAHMK.LF.R.A...QRN.F..YIS..GFALL.L.SA........IIRRLT.TLLSAQAQLMAENEA-a.....................................................................
J9FGI8_WUCBA/1-137                     ..................................................MTLQW.FVVAL.ILY.LEIAV.VLLL.L........L.P.W...IR.PT........L...wSKFF.K.............S..R..I.....VK..T......F..E....K..H.AT..V..Y........F..............I..S.ALCI......L..LL.......LF..A................DAIR.E......VR.KYANEMAIE................................gSIRH.T.ADSENVVHMR.LF.R.A...QRN.L..YIS..GFALL.L.FL........IIKRLV.ALLSRGALLEAAAEA-a.....................................................................
G3XRH4_ASPNA/1-142                     ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........I.P.L...PF.TV........K....RKLF.A.............F..I..S.....QS..P......I..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFgke..........................ggtmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEDRVR--ll....................................................................
A0A0L0HPN2_SPIPN/1-142                 ..................................................MSLFN.QLVYY.MLL.TELTF.YLLT.L........I.P.LsfiPI.PT........R....KRIM.N.............S..I..S.....TL..A......R..K....D..P.IV..W..T........A..............R..V.IFLV......M..AL.......VF..W................DTVT.R......LY.RMETEVHPKee.............................ghHSHL.D.PMADLQQKAR.RF.Y.T...QRN.L..YLS..LFAIF.M.IL........VDYRRVkDLYLQLV---------yqeeivdl..............................................................
M4BV69_HYAAE/123-249                   ..............................................mlln-----.NVLFY.MMV.TEAGI.CLVL.S........L.P.F...GQ.WL........S....HAAV.S.............F..L..V.....RH.lG......H..K....E..A.VN..T..I........A..............T..V.VLAL......V..TV.......LF..I................SDVS.T......VY.KHHASDEVL.................................----.-.---GDGMRIR.LL.T.A...QRD.M..YIT..GFCLF.L.FL........LLRLVY.IALATNLHLEKCLEA-m.....................................................................
A0A017SQ45_9EURO/1-142                 ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........V.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......V..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELSSFske..........................ggamGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILELLRLEDRVKH-l.....................................................................
A0A084GF94_9PEZI/1-142                 ..................................................MTLYY.TLVFV.LLM.GEMAM.FMLL.I........L.P.L...PY.TI........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELGLTsen..........................aknnPAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMELEDRLRA-f.....................................................................
I3KB97_ORENI/1-135                     ..................................................MSLQW.TAVAT.FLY.AEVFL.VLLL.C........I.P.F...IS.PK........R...wNSIF.K.............S..R..I.....VK..A......I..T....L..Y.GN..T..A........F..............M..V.AIAI......L..VF.......LL..I................DAFR.E......VR.KYSVTEKVD.................................-LAN.H.PTAIEHIHMK.LF.R.A...QRN.E..YIA..GFALL.L.CL........LLRRLA.TLLSQQASLMASNEA-f.....................................................................
A0A2I4DTS6_9ROSI/1-117                 ................................................mi-----.HLIFT.LVL.AEMAL.ILTL.L........F.R.-...--.TP........L....RKLV.M.............M..G..L.....DR..L......K..Q....G..R.GR..L..V........A..............N..T.VAAT......M..TL.......LF..S................SIIY.H......AT.IIHKRSAEA.................................S-MV.N.PTEE--VLM-.--.-.A...QRQ.LeaCLI..GFSLF.L.AL........IIDRLY.YLIKKK----------sci...................................................................
A0A2K5MXG7_CERAT/1-137                 ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................rSSTS.R.PDAYEHTQMK.LF.R.K...KKK.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
J8PL63_SACAR/1-140                     ..................................................MSLYF.TTLFL.LLT.IEMVM.LFIF.V........L.P.L...PF.RI........R....RGIF.S.............T..Y..N.....QL..T......A..K....Q..Q.VK..T..I........I..............F..I.IGCL......V..GL.......LF..I................DSWK.R......SQiRVSLYHHDNs...............................gTMGS.S.AVTPIQALAS.RA.Y.N...QRN.M..YIS..GFILY.F.SI........CIPTVM.SIVKRLVKYQG-----lineqkk...............................................................
A0A1L7WQT2_9HELO/1-139                 ..................................................MTLYY.SLVFL.LLV.SEMAL.FMLL.I........V.P.L...PF.TI........R....RKMF.T.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELAESnk.............................qqSAAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEEKVKA-y.....................................................................
A0A1S4B8M0_TOBAC/1-126                 ..................................................MALQW.MILTY.VVA.AEAAV.AILL.T........L.P.S...PK.AI........K....SRIV.S.............L..I..S.....LT..L......Q..P....S..-.--..-..-........-..............L..F.IVPF......A..GF.......QL..L................DIYW.K......NE.HR---LMCT.................................GEIC.T.AAERDRYEKS.IY.K.A...QRN.A..ILC..LAACL.L.YW........CIYRVC.KYYKEIQSIEE-----vekrl.................................................................
A0A2D0QZX5_ICTPU/1-135                 ..................................................MSLQW.TAVAT.FLY.AEVFF.ILLL.C........V.P.F...IS.PK........R...wHRIF.K.............S..R..L.....AI..A......I..T....T..Y.GN..T..A........F..............I..V.IICI......L..VF.......LL..I................DAFR.E......VR.KYSVTDKVD.................................-LSN.N.PVAIEHIHMK.LF.R.A...QRN.E..YIA..GFALL.L.CL........LLRRLA.SLLSQQATLMASNQA-f.....................................................................
A0A0D3CJ68_BRAOL/1-126                 ..................................................MALQW.LILSY.VVA.AEVAI.AVIL.T........L.P.Y...PM.LV........K....KRVV.S.............L..V..S.....LI..L......Q..-....-..P.AA..S..I........-..............-..-.-VAF......A..GF.......QL..L................DLYW.K......N-.--EHRLMCS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AAGIL.L.YW........CIFRIC.KYNKDLEHLEE-----lekrc.................................................................
A0A178EEK0_9PLEO/1-143                 ..................................................MTLYY.SLVFL.LLV.AEMVI.FMAL.I........V.P.L...PF.TW........R....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSSSddhg.........................rsgrNAAL.G.GIERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEELK--ti....................................................................
H3F0D5_PRIPA/1-108                     ..................................................MTIEW.SVVAG.LLY.TEIAV.TILL.L........V.P.W...IK.PK........I...wRTIF.K.............S..R..I.....GQ..V......I..G....Q..Y.AK..R..S........A..............L..I.MGAL......L..FM.......LF..V................DALR.L......TR.KYSLINDQM.................................Q---.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------grsdvncsrivkiihrmsdcessaesa...........................................
A0A2A2JHE7_9BILA/1-138                 ..................................................MTLQW.SIVAG.ILY.FEIAI.TFIL.L........L.P.W...IR.PS........L...wSKFF.K.............S..R..A.....AN..A......I..G....S..H.GR..V..F........F..............F..S.FAIV......L..FV.......LF..A................DAIR.E......VN.KYSHVDLSLe...............................sSVRH.T.ADADAMIHMR.LF.R.A...QRN.F..YIA..GFALL.L.LL........VIKRIM.SLISRSAQLEAASEA-a.....................................................................
A0A2I3HR51_NOMLE/1-157                 ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKELS-----nkdvlktqaentnkaakkfmeenek.............................................
A0A0D2GVM5_9EURO/1-143                 ..................................................MTLYY.SLVFV.LLV.TEMVL.FIAL.I........I.P.M...PF.TV........K....RKMF.N.............F..I..S.....ES..P......I..V....A..K.IQ..Y..G........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMAALskdt.........................tgagRAAA.I.GSERMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVK--my....................................................................
A0BHF9_PARTE/1-144                     ..................................................MTFQF.DLMYK.TMY.VGVGL.AFIV.F........F.P.L...PR.II........R....KPLV.R.............G..L..E.....KI..F......N..N....S..I.FS..K..V........L..............Y..S.ILSW......T..LF.......LF..V................SAVS.E......NL.DLGKELVGQkaqrd......................syasgtSQYE.L.EKTVNQTRMK.MF.Y.S...QRN.I..YLT..---LF.N.LI........IFGAIF.TYLKSLVKYDEQLD--ked...................................................................
A0A1V8SAQ6_9PEZI/1-141                 ..................................................MNLIY.SPVFG.LLV.FEMAL.FVAL.I........V.P.M...PF.RI........K....RGLF.T.............F..I..S.....EN..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQIELHNAkqa...........................ggvAVGV.A.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEEEVKR-l.....................................................................
A0A0V0SEW1_9BILA/156-291               ..................................................MSLQW.TLVAL.LLY.VEVFV.LSCM.L........L.P.W...IR.PS........S...wQRLF.R.............S..R..F.....LR..F......I..Q....T..Y.SS..F..Y........I..............Y..C.FALM......L..LL.......LF..L................DALR.E......VR.KYSDADLVK.................................QSVG.N.VQGEFNTHMR.LF.R.A...QRN.L..YIS..GAALF.L.WF........AIQRVA.SMISREAMLIASAEA-a.....................................................................
A0A022QA78_ERYGU/1-126                 ..................................................MALQW.MILAY.VVA.AEAAV.AIIL.T........L.P.S...PK.AI........K....SRIT.S.............L..V..S.....LV..L......Q..P....S..-.--..-..-........-..............L..F.IIPF......S..AF.......QL..L................DIYW.-......--.KNEHRLMCS.................................GETC.T.AAERDRYEKS.TY.K.A...QRN.A..VLC..VSACL.L.YW........CIYRIC.KYHRDIQSMEE-----veksy.................................................................
E3K438_PUCGT/1-140                     ..................................................MALYN.WMVFS.LLI.IEIVT.FIVL.V........M.P.L...PF.TW........R....RVLF.R.............F..L..A.....TS..P......L..V....A..K.LQ..Y..A........L..............K..I.LFIF......V..TV.......LF..V................DSVQ.R......MM.KIHHEGEAAke............................qgaGVGR.D.LRSETDWRSR.KF.L.S...ERD.M..YMR..GFTLF.L.SL........ILSRTF.ALILDLIKAQEDLA--tl....................................................................
A0A1S3JN86_LINUN/1-96                  ................................................mi-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......I..T....S..Y.AN..Y..Y........F..............T..V.FIVI......L..MV.......VF..G................DSIR.E......VY.KYNISKESL................................dIKTS.Q.AATLEHVHMR.LF.R.A...QRN.F..YIA..GMSLF.L.LV........VLKRLV.VLISAAATLTAQR---dva...................................................................
A0A067TEL6_GALM3/1-139                 ..................................................MTIYY.SLTFL.LLA.AEMVT.FCVL.V........A.P.L...PY.AL........K....KRLF.S.............F..L..S.....ES..K......I..V....A..K.VA..Y..G........L..............K..I.SFIF......V..AI.......LF..A................DALQ.R......MF.RVTAEAEMAks.............................nkGMTP.D.IRTDTGIAAR.KF.Y.A...QRN.T..YLT..GFCLF.L.SL........VLTRTF.YIILDLIHTQEEYAK-l.....................................................................
A0A1Z5SSE3_HORWE/1-141                 ..................................................MSLVY.APVFG.LLM.FEMSV.FMAL.I........V.P.L...PF.DW........K....RKLF.E.............F..I..S.....HS..P......I..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQMELSMSknq...........................ggaAAAV.A.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TLILDTLRLESEVKS-l.....................................................................
A0A1A9Y5I2_GLOFF/1-134                 ..................................................MGLVW.TLIAG.FLY.AEICV.VLLL.V........L.P.V...AS.PY........K...wSRFF.K.............S..K..F.....LA..M......I..A....Q..Q.AH..L..Y........F..............C..L.IMGV......L..VL.......FL..L................EAIR.E......MR.KYSTQEHSS.................................D--V.H.LNTEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRRLV.TLISVQANLLAQSEA-s.....................................................................
A0A0W8CAH8_PHYNI/1-115                 ............................................masmws-----.SFTYV.LLP.PAVVL.LLLM.T........I.P.F...PG.LM........L...nRGIV.K.............FgdF..V.....FN..I......R..I....G..T.LS..V..F........S..............V..I.TFIS......F..VV.......LV..A................QTYD.L......QK.RYSLPSDPH.................................-LEV.H.YSADLQKKAS.RW.R.S...ERN.W..WIS..ALT--.-.--........------.----------------ftiy..................................................................
A0A162Q5C5_9PEZI/1-141                 ..................................................MTLYY.TLVFV.LLM.AEMGL.FMLL.I........V.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......V..V....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELALAtek...........................qnsGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRS-y.....................................................................
A0A0G4EWW9_VITBC/1-135                 ...............................................mas---VW.SFIAW.ICA.PIAAT.LCIL.L........LsG.V...VM.LE........R...lGHAL.C.............A..A..H.....IS..I......G..L....A..R.IR..V..V........T..............F..I.TLVT......L..VL.......FA..Y................ESVD.-......LQ.KMRSTQAAA.................................-SPY.Q.VQMEDRWKMN.LW.R.H...QRN.W..WIS..LFNIT.L.WI........VCWRVS.QLIAYYRKR-------ieqlkms...............................................................
G0RMS0_HYPJQ/1-143                     ..................................................MTLYY.TLVFG.LLM.AEMAL.FMLL.L........V.P.L...PF.SA........K....RKIF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..W........M..............K..I.TFFF......I..LI.......LF..V................DSLN.R......VY.RVQLEVMAAheha.........................vkgnAAAV.M.GSERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKLRA-y.....................................................................
E7KAH8_YEASA/1-123                     .................................................m-----.-----.---.-----.FSIL.A........L.P.I...PS.RY........R....RPLT.L.............L..L..L.....KP..F......K..S....S..T.VQ..V..A........I..............K..C.ILGF......I..LL.......LF..I................DCIN.R......VY.SIDKELQLSsa............................sqnNGAI.I.AQDRIEVLSR.KF.F.A...QRN.M..YLT..GITLF.L.TF........VVVRTF.GLVIELLTMKDIYR--as....................................................................
A0A1V8UTJ0_9PEZI/1-126                 ..................................................-----.-----.---.--MAL.FVAL.I........V.P.M...PF.RI........K....RGLF.T.............F..I..S.....EN..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQIELHAAkqa...........................ggaAVGV.A.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEEEVKR-l.....................................................................
A0A0C2X9C0_AMAMU/1-98                  ..................................................MTVHY.NLTFQ.LLA.AEMIM.FCLL.V........A.P.F...PN.VI........R....RKAF.A.............F..I..S.....RS..R......I..V....A..K.IA..Y..A........I..............K..I.AFIF......V..GI.......LF..V................DAVQ.R......ML.GATSDAKQAr..............................iiR-PA.D.AGAHSALAAK.R-.-.-...---.-..---..-----.-.--........------.----------------f.....................................................................
A0A0H1BHX6_9EURO/1-129                 ..................................................-----.-----.---.--MVI.FVGL.I........I.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......A..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQSELSTHskem........................ggagrRTAA.L.GAERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVKQ-l.....................................................................
A0A066VVX3_9HOMO/1-138                 ..................................................MTIYY.TLTFL.LLA.AEMTT.FCLL.V........M.P.L...PF.TA........R....QKLF.R.............F..L..S.....SS..V......I..V....A..K.IA..Y..A........L..............K..I.SFIF......I..AV.......LF..V................DAVQ.R......ML.RVSAEGQQAk..............................qaAGAT.D.VRTETNYAAK.KF.Y.T...QRN.M..YLT..GFTLF.L.SL........ILTRTY.YILLDLIHVQEQYAE-l.....................................................................
A0A1A0HEH5_9ASCO/1-140                 ..................................................MALYY.NLVFG.LLV.IEMAF.FTVL.S........L.P.F...PR.AM........R....KSVL.R.............T..V..S.....MP..F......R..S....E..Q.FQ..I..A........F..............K..C.VFGF......V..LV.......LF..I................DSVN.R......VY.TVTLELHALsp............................stnSPTS.M.MNDRSEVQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.TL........ILTRTY.SLVAELIDTKDKLDA-n.....................................................................
A0A2K5HQ89_COLAP/1-137                 ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................rTSTS.R.PDVYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A1A9ZF11_GLOPL/1-134                 ..................................................MGLVW.TLIAG.FLY.AEICV.VLLL.V........L.P.V...AS.PY........K...wNRFF.K.............S..K..F.....LA..M......I..A....R..Q.AH..L..Y........F..............F..L.IMGV......L..VL.......FL..L................EAIR.E......MR.KYSNQEHSS.................................D--V.H.LNTEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRRLV.TLISAQANLLDQNEA-t.....................................................................
A0A1V6TB40_9EURO/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMAV.FLAL.V........I.P.L...PH.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELSSFtkd..........................gpgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRV---rlf...................................................................
A0A2H3SVM7_FUSOX/1-143                 ..................................................MTLYY.TLVFM.LLV.FEMAL.FMLL.I........V.P.M...PF.NV........K....RKIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAseqs.........................kqggGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRA-y.....................................................................
A0A1J8QDI0_9HOMO/1-140                 ..................................................MTIYY.SLTFL.LLA.AEMIT.FCLL.V........S.P.L...PY.TI........R....KKLF.R.............F..L..S.....ES..P......I..I....A..K.VA..Y..V........L..............K..I.SFIF......V..GI.......LF..V................DALQ.R......MF.RVTAESEMAkt............................gsgQGMH.D.VRTETNFAAR.KF.Y.A...QRN.T..YLT..GFCLF.L.SL........VLTRTF.SIMLDLIHTQEEYAK-l.....................................................................
A0A060S347_PYCCI/1-71                  ..........................................mwrvtaev-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.------DLAks.............................agSGAQ.D.VRAETNMAAR.KF.Y.A...QRN.T..YLT..GFCLF.L.SL........VLTRVF.YILLDLIHAQEEYAK-l.....................................................................
K1VBV4_TRIAC/1-64                      ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........-....--MF.H.............F..L..A.....EN..P......A..V....A..K.VQ..Y..A........L..............K..I.TFIF......V..AV.......LF..I................DALQ.R......MV.RIAQEGAVAk...............................rN---.-.PEVA------.--.-.-...---.-..---..-----.-.--........------.----------------advrtettyvt...........................................................
L7N3N7_XENTR/1-107                     ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........R...wKKIF.R.............F..Q..L.....WS..K......V..S....P..Y.WN..K..A........F..............L..S.IIVV......L..IV.......LF..L................DAAR.E......VK.KYSANHLTD................................kNAKL.Y.PSSYDHIHMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRVV.SLIMQLASEIES----ngam..................................................................
U3K6M1_FICAL/1-137                     ..................................................MTFQW.TAVAA.FLY.GEIGV.ILVL.C........L.P.F...IS.PL........R...wQKIF.M.............F..P..L.....WS..K......V..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSSVHVNE................................kAANV.N.SSTFDHIQMK.LF.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTV.TLLTQLAKEMTSHA--al....................................................................
A0A0V1CQR4_TRIBR/3-92                  .....................................ryglsllftrlne-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..MM.......IL..L................DALR.E......VR.KYSDADLVK.................................QSVG.N.VQGEFNTHMR.LF.R.A...QRN.L..YIS..GAALF.L.WF........AIQRVA.SMISREAMLIASAEA-a.....................................................................
S8DRL3_9LAMI/1-126                     ..................................................MALQW.VILAY.VVA.AETAL.AVLL.T........L.P.S...PK.AV........R....SRIV.S.............L..V..S.....LI..L......Q..P....A..-.--..-..-........-..............L..F.VVPF......S..GF.......QL..L................DIYW.-......--.KNEHRLICS.................................GDTC.T.ASERDRYEKS.IY.K.A...QRN.A..ILC..AASCL.V.YW........FIYRIC.KYNREIERM-------eelekrf...............................................................
A0A072PLD9_9EURO/1-128                 ..................................................-----.-----.---.--MAL.FVAL.I........I.P.L...PY.AA........K....RKLF.N.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQVEMALLakds.........................sgagRAAA.V.GSERMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVKQ-y.....................................................................
BAP31_PONAB/1-136                      ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
H2YK40_CIOSA/1-137                     ..................................................MSIQW.TFVAG.FLY.VEIAL.CILL.C........L.P.F...IS.CK........R...wQSFL.R.............S..R..L.....FA..L......F..I....S..Y.GN..L..Y........F..............L..V.LISI......L..CL.......LF..A................DAVR.E......VR.KYSLPDAQS................................vNLSN.N.PNAQDHVLMM.LF.R.A...QRN.L..YIS..GFALF.L.WL........VLRRLV.LLVSNNATLEAQSEA-f.....................................................................
W5NBE2_LEPOC/1-135                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........V.P.F...IS.PT........R...wNKIF.K.............S..R..L.....VK..A......I..T....T..Y.GN..T..Y........F..............V..V.LILI......L..VF.......LL..I................DAGR.E......VR.KYSVTEKVD.................................-LTN.N.PVAVEHIHMK.LF.R.A...QRN.L..YIA..GFALL.L.WF........LLRRLV.VLLSQQATMTASNEA-f.....................................................................
S7NTH9_MYOBR/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.SN..T..F........F..............V..V.LIAI......L..VL.......LV..I................DAVR.E......IS.KYDDVTEKV.................................NLQN.N.PGAVEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
K9GAP2_PEND2/1-142                     ..................................................MTLYY.SLVFL.ILV.LEMVV.FLAL.V........I.P.L...PH.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELSGFakd..........................spgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRV---rlf...................................................................
A0A087U9N2_9ARAC/1-131                 ..................................................MTIQW.TVIAT.FLY.LELLF.IFLL.L........L.P.F...IS.PK........I...wQYIF.Q.............S..R..I.....FR..V......I..A....A..K.AN..M..Y........F..............T..I.FVIV......L..IL.......FF..L................DSVR.E......MM.KYSHKSTKD.................................----.-.YEAELQLNMK.LF.R.S...QRN.Y..YIS..GFTVF.L.WL........VIRRLI.VLILEEAELLDENE--ta....................................................................
Q6BPT4_DEBHA/1-140                     ..................................................MSIQM.SLVFG.ALI.LEMVT.LLSM.V........L.P.L...PH.PV........R....VKIM.D.............I..A..T.....VL..R......N..S....K..N.FK..I..G........F..............W..F.TVIL......L..SM.......QF..A................DCIQ.R......LQ.RFGTLGNPYfa............................lnsQNKQ.F.GTMSYDQLAS.KF.Y.S...QRN.L..YIT..GAVLY.L.ML........AIYTVS.TILKKLVSKEAEFRQ-l.....................................................................
C4V808_NOSCE/1-74                      ..................................................MGITT.RLVQS.VLY.SEMVL.FTLL.I........I.P.L...PK.KC........K....KAVI.N.............T..L..F.....TS..R......V..F....R..P.LI..H..L........L..............Y..V.VYAM......I..LI.......MF..I................DAVL.K......L-.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------nmnip.................................................................
C9J0M4_HUMAN/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......L..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A182FUJ5_ANOAL/1-135                 ..................................................MTLVW.GIIAS.FLY.VEIFI.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHTH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
A0A094GYI6_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMGL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAte............................qsqTGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
L5KG07_PTEAL/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFL.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..F......V..V....T..H.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DALR.E......IR.KYDDVTEKV.................................NLQN.N.PGALEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
G7Q1Z6_MACFA/68-203                    ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
G1NBM5_MELGA/1-137                     ..................................................MTVQW.TAVAA.FLY.GEVGV.LLVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..II.......LF..L................DAVR.E......VR.KYSAIQVNE................................kIANV.N.ANAIDHIQMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRTI.TLLTQLAKGMASHA--al....................................................................
A0A1A9X3F8_9MUSC/1-135                 ..................................................MSLLW.TLIVS.FLY.AEIVC.VVCL.V........Y.P.V...GN.PR........K...wDRFF.K.............S..K..F.....LS..T......I..S....K..K.AQ..A..Y........F..............L..I.VISA......L..FL.......LL..V................DSFL.E......MR.KYSNEEYRN.................................IVDV.H.VGSKIFQNTR.LF.R.A...QRN.F..YVS..GFAIF.L.ML........VIRRLV.TLISIQAH--------ypgyyvk...............................................................
V2XW09_MONRO/1-141                     ..................................................MTIYY.TLTFL.LLA.AEMTT.FCVL.V........A.P.L...PY.KV........R....RGLF.R.............F..L..S.....ES..K......L..V....G..K.VA..Y..A........L..............K..I.SFIF......V..AI.......LF..F................DALQ.R......MF.RITAESEMArsg...........................ggaGGVG.D.VRTETNLAAR.KF.Y.A...QRN.T..YLT..GFTLF.L.SL........VLTRTF.YITLDLIHVQEEYAK-i.....................................................................
A0A0B2SF52_GLYSO/1-126                 ..................................................MGLQW.LILTY.VVA.AEAAV.AILL.T........L.P.T...PK.LL........R....NRFA.S.............L..V..S.....L-..-......I..L....Q..P.AL..F..I........V..............P..F.AGFH......L..LD.......LY..W................KNEH.R......LM.CTSEV----.................................---C.T.AAERDRYEKS.IY.K.A...QRN.V..ILC..VTACL.L.YW........SISRIC.KYQKEIQSLEE-----vekri.................................................................
A0A151NJP8_ALLMI/1-114                 ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........V.P.F...IS.AT........R...wQKIF.R.............S..R..L.....VR..A......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..IL.......LL..I................DAVR.E......IR.KYDEVPEKV.................................SLQH.S.PGALEHVHMK.LF.R.A...QRN.L..YLA..GFALL.L.SL........------.----------------......................................................................
C9JGJ9_HUMAN/1-133                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKE-------lsn...................................................................
M2QX16_CERS8/1-139                     ..................................................MTVYY.TLTFM.LLA.SEMAT.FCAL.V........A.P.L...PH.AL........R....KRLF.R.............F..L..S.....ES..P......L..V....A..K.LA..Y..G........V..............K..I.AFIF......V..AI.......LF..V................DAVQ.R......MW.RVTAEADLAkt.............................saPGAQ.D.VRAETNFAAR.KF.Y.S...QRN.T..YLT..GFTLF.L.SL........VLTRTF.YILLDLIHTQEEYAK-l.....................................................................
A5E3X4_LODEL/1-138                     ..................................................MSLQM.SLVFS.TMV.AQLVL.LLLL.V........L.P.L...PY.IV........R....SNII.L.............F..L..D.....RI..Q......H..S....Q..H.FK..V..V........L..............I..F.SLVL......M..SL.......QF..W................DCLA.R......LQ.KYQKIQEQIn..............................gnPQYG.G.GFINYDKLAS.KF.Y.S...ERN.L..YLS..GAILY.L.QL........CIGTVV.TIVKKLVLKQK-----ilrdh.................................................................
A0A0E0CXS2_9ORYZ/1-126                 ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.SV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..VSACL.L.YW........CIFRIC.KYNKDIKALEET----ekrl..................................................................
A0A1X7QZ42_9SACH/1-133                 ..................................................MSLYY.SLIFG.ILV.LEIAL.FTLL.A........L.P.I...PT.KF........R....KPLT.L.............V..L..L.....KP..F......K..N....S..N.VQ..V..A........I..............K..C.ILGF......I..LL.......LF..I................DSIN.K......VY.NINKELAID.................................V--A.Q.GHQRIELLSR.KF.F.Q...QRN.L..YLT..GITLF.L.TF........IVTKTF.ALVNELLNLKAKYRK-e.....................................................................
G3SMP8_LOXAF/1-137                     ..................................................MTLQW.TAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wRKIF.S.............F..H..V.....WG..K......I..A....T..F.WN..K..V........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......IR.KYSYAHAIE................................kSSIS.R.PSAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------stkgal................................................................
A0A2K5NV01_CERAT/1-136                 ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
Q17GB2_AEDAE/1-134                     ..................................................MSLVW.SLIAS.FLY.VEIFI.VLML.V........L.P.V...AS.PQ........R...wQRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLFV......L..VL.......FL..L................EAIR.E......MR.KYSHVDPAA.................................E--Q.H.LNVGMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLI.SLITSQAQLLAQSEA-s.....................................................................
M7U6U3_BOTF1/1-140                     ..................................................MTLYY.SLVFV.LLV.AEMAL.FMLL.I........V.P.L...PF.TI........R....RKMF.T.............F..I..S.....ES..R......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELAEAnk............................sqaGNPV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEEKVN--ry....................................................................
S7MGB5_MYOBR/1-137                     ..................................................MTLQW.TAVAT.FLY.AEIGL.ILLF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..S.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSSTAVIE................................kGSPS.R.PGAHEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLANEMS-----nkgel.................................................................
R0MCE4_NOSB1/1-68                      ..................................................MGITT.QLVQS.ILY.AEMSL.FTLL.I........L.P.L...PN.YV........S....RMFI.S.............M..F..H.....ES..Q......F..S....R..P.FA..H..I........L..............W..V.LYIM......I..FI.......LF..I................DSIY.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------r.....................................................................
YF14_SCHPO/1-137                       ..................................................MTIYY.MIVFM.LLM.VEIVS.FVIL.S........L.P.L...PL.KV........R....RAIL.N.............A..I..S.....NS..P......F..A....G..R.VK..H..V........L..............K..I.TIIC......I..LI.......LF..A................DSVR.R......VV.RVTKEYDLAi...............................aAPST.T.ESARSGYKAS.QF.Y.A...QRN.L..YLC..GSALF.L.SL........VVNRYY.LALEAMIAAQDKMQA-l.....................................................................
A8NIF1_COPC7/1-138                     ..................................................MTVHY.TLTFL.LLA.AEMVT.FCFL.V........A.P.L...PY.TV........R....KKLF.K.............F..L..S.....ES..P......I..I....A..K.IA..Y..A........L..............K..I.SFIF......V..GI.......LF..V................DALQ.R......MF.RVTADAESMk..............................agPQGA.V.QDVRTDIAAR.KF.Y.S...QRN.T..YLT..GFTLF.L.SL........VLTRTF.YIMLDLIHTQEEFAK-l.....................................................................
A0A1Y2ATT7_9TREE/1-138                 ..................................................MTLYY.TLCFG.LLM.SEIAL.FTTI.I........A.P.M...PF.SL........R....KKMF.H.............F..L..S.....EN..P......V..V....A..K.VQ..Y..A........L..............K..I.TFIF......V..AV.......LF..V................DALQ.R......MV.RIAQEGAAAk..............................akQDMA.D.VRTETNYAAR.RF.Y.A...QRN.L..YLT..GSTLF.L.SL........ILSRVF.YIILDFIQVQESYSA-l.....................................................................
A0A1Y1ZVF2_9PLEO/5-146                 ................................................ll--LFF.IQVFI.LLV.TEMVF.FCGL.I........V.P.L...PF.TW........R....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQVELSAFaks..........................eggrGAAL.G.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEEVKT-l.....................................................................
S9WJ21_CAMFR/1-131                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IW.KYDGVTERV.................................NLQN.N.PGAVEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SL........C-----.----------------qlvcvgvsclcqmeav......................................................
B0D7E8_LACBS/1-140                     ..................................................MTIYY.SLTFL.LLA.AEMIT.FCIL.V........A.P.L...PY.AV........R....KRLF.K.............F..L..S.....ES..F......I..I....A..K.IA..Y..G........L..............K..I.SFIF......V..AI.......LF..A................DALQ.R......ML.RVTAESDLArs............................gkgPVAT.G.TSAETNLAAR.KF.Y.S...QRN.T..YLT..GFCLF.L.SL........VLTRTF.YIMLNLIHTQEEYAK-l.....................................................................
D5GJC7_TUBMM/1-139                     ..................................................MTLYY.SLVFV.LLM.VEMAV.YLLM.V........L.P.V...PY.SP........R....MRFF.T.............W..I..S.....TS..A......V..V....G..K.IQ..Y..C........L..............K..I.TFVF......I..LI.......LF..V................DSVN.R......VY.RVQSELSESkh.............................mgGQSV.M.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SF........ILDRTY.ASTLENLQLHTTVKQ-l.....................................................................
G3GTA2_CRIGR/1-136                     ..................................................MSLQW.TAVAA.FLY.AEVFA.GLLL.C........I.P.F...IP.PK........R...wQKIF.K.............S..R..L.....AE..L......V..V....T..Y.GI..T..F........F..............V..V.LIII......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLHN.N.LGAMEHFHMK.LF.R.A...QRN.L..HIA..GFFLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A067MMJ2_9HOMO/1-138                 ..................................................MVLYY.TLTFC.LLA.AEMVT.FCLL.V........M.P.L...PF.AV........R....KKLF.S.............F..L..S.....ES..P......V..V....G..K.IA..Y..A........L..............K..I.SFIF......V..GI.......LF..I................DALQ.R......MF.RVTAEGDLAr..............................skDGVQ.D.VRTETNYAAR.KF.Y.A...QRN.M..YLT..GFTLF.L.SL........ILTRTY.YIMLDLNHTQDEYAK-l.....................................................................
A0A091DFP2_FUKDA/1-136                 ..................................................MTIQW.VAVAT.FLY.AEIGL.ILLF.C........V.P.F...IP.PQ........R...wQKIL.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSYAHSLE................................kISTA.K.TSAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKELA-----nrgv..................................................................
A0A091HU67_BUCRH/1-128                 ..................................................MTFQW.TAVAT.ILY.GEIGV.ILVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..V................DAVR.E......VR.KYSAVHVTE.................................K-TA.N.ASAFDHI---.--.-.-...QIN.L..YLS..GFSLF.L.WL........VLRRIV.TLLTQLAKGMASHA--al....................................................................
I1P9B9_ORYGL/1-126                     ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..VSACL.L.YW........CIFRIC.KYNKDIKALEET----ekrl..................................................................
A0A0L6WJ53_9AGAR/1-140                 ..................................................MTIYY.SLTFL.LLA.AEMVT.FCLL.V........A.P.L...PY.TV........R....KKVF.R.............F..L..S.....ES..P......I..I....A..K.VA..Y..A........L..............K..I.SFIF......V..GI.......LF..A................DALQ.R......MF.KITAESELAks............................gqqGSYS.D.VRTETNIAAR.KF.Y.A...QRN.T..YLT..GFTLF.L.SL........VLTRTF.YIILDLIYTQEQYAK-l.....................................................................
A0A1E4RTC0_9ASCO/1-145                 ..................................................MALYY.NLVFG.LLV.IEMSF.FTIL.S........L.P.F...PR.TV........R....RKVL.S.............T..A..S.....AP..F......K..N....E..K.VL..I..A........I..............R..C.IFGF......V..LV.......LF..I................DSIN.R......VY.SVTSELHASspanq.......................qghmpPVSG.I.MNDRSEVQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.HM........ILTRTY.SLVAELLVTKDKLDN-l.....................................................................
A0A0C3NYJ6_PISTI/1-138                 ..................................................MTIYY.SLTFL.LLA.AEMVT.FCIL.V........F.P.L...PY.TI........R....KKVF.R.............F..L..S.....ES..P......I..V....A..K.IA..Y..A........L..............K..I.SFIF......V..GI.......LF..M................DALQ.R......MF.RVTEEAEMFk..............................kgQAMQ.D.VRAESSVAAR.KF.Y.A...QRN.M..YLT..GFCLF.L.SL........VLTRTF.YIILDLIHAQEEYAK-l.....................................................................
G1LQ55_AILME/17-153                    ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV.iA................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAVEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
H0GSE0_SACCK/3-56                      ............................................lsslri-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.---ELRYSQE.NF.L.A...QRN.M..YLT..GITLF.L.TF........VVVRTF.GLVIELLTMKDIYRA-s.....................................................................
E1ZVU8_CAMFO/1-135                     ..................................................MSIQW.TLIAG.FLY.AEIAV.VLLL.V........L.P.I...AS.PT........R...wQKLF.K.............S..R..F.....LQ..S......L..S....N..Q.AS..I..Y........F..............V..I.LLGT......L..VL.......FL..M................DALR.E......MR.KYSKTDHTD.................................-VHP.S.LNLELQENMR.MF.R.A...QRN.F..YIS..GFALF.L.SL........VIRRLV.ILISTQATLLAQNEA-a.....................................................................
A0A0C9Y6H5_9AGAR/1-140                 ..................................................MTIYY.SLTFL.LLA.AEMIT.FCIL.V........A.P.L...PY.TV........R....KRLF.R.............F..L..S.....ES..F......I..I....A..K.IA..Y..G........L..............K..I.SFIF......V..AI.......LF..A................DAVQ.R......MF.RVTAESDLAra............................gkgPVTT.G.TSAETNLAAR.KF.Y.S...QRN.T..YLT..GFCLF.L.SL........VLTRTF.YIMLDLIHTQEEYAK-l.....................................................................
F7A5H3_MONDO/1-140                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILAL.C........L.P.F...IP.PQ........R...wQKIF.M.............F..P..L.....WG..K......I..A....T..Y.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VK.KYSISHGLE................................kSSSN.N.PSAYEHVQMK.LF.R.A...QRN.L..YIS..GFSLF.L.WLlqflcflcVLRRLV.TLITQLS---------kelg..................................................................
A0A0K0FUT3_9BILA/1-138                 ..................................................MSIQW.TIVAG.ILY.TEVAF.VILL.V........L.P.W...IR.PT........V...wKKFF.N.............S..R..I.....IT..A......V..S....H..K.ST..I..A........S..............Y..S.TIFV......L..TL.......LF..L................DAAR.E......CA.KYSNSSIVEn...............................tLLKG.A.ADVDTAIHMR.LF.R.S...QRN.L..YIS..GFALL.L.FL........VINRIV.GLLVRSAQLQASSEA-a.....................................................................
B4L0C7_DROMO/1-134                     ..................................................MSLVW.TLIAG.FLY.TEIAV.VLLL.V........L.P.G...IS.PY........K...wNRFF.K.............S..K..F.....LA..M......L..A....Q..Q.AH..L..Y........F..............F..L.IMGV......L..VL.......FL..L................EAIR.E......MR.KYSNTDNSG.................................--EV.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRKLV.QLISTQANLLAQSEA-s.....................................................................
A0A0C2TEV5_AMAMU/9-70                  ...............................lrenssksfvlnhkhclmv-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.---------Y.GF.RsA...QRN.M..YLT..GFCLF.L.SL........VLTRTL.HLLFELINTQAEHSK-l.....................................................................
R1CWY0_EMIHU/1-137                     ..............................................mdpg----W.FVLCL.ALL.LECAL.VGLL.I........L.P.I...RG.LL........N....EWVV.S.............L..L..S.....N-..Q......G..V....K..Y.AG..F..A........I..............L..L.LDAY......Y..FA.......GT..M................DALS.N.....pLV.HVGIVASPI.................................---D.D.VILSCEVGLE.KF.R.N...ERN.A..YIT..GFSLF.M.FL........VLRRLT.S---------------srglvdiqsqlfharetnkq..................................................
H3FU89_PRIPA/1-43                      ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.--------MR.LF.R.A...QRN.I..YIS..GFSLL.L.FL........VINRIT.SLLARSAQMEAASEA-a.....................................................................
A0A1V8SCF3_9PEZI/1-141                 ..................................................MNLIY.SPVFG.LLV.FEMAL.FVAL.I........V.P.M...PF.RI........K....RGLF.T.............F..I..S.....EN..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQIELHAAkqa...........................ggaAVGV.A.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEEEVKR-l.....................................................................
A0A0C7NDX6_9SACH/1-141                 ..................................................MSVYL.SVLFG.VLT.FEMAC.LFTL.V........L.P.L...HY.KL........R....KALV.T.............S..Y..F.....RF..V......S..Y....T..Q.VK..T..V........I..............F..I.VQGL......V..GL.......LF..V................DSWK.R......SQ.ISVFLHHHQats...........................gadPNAV.G.NVTPVQALAS.RA.Y.N...QRN.I..YIS..GFILY.F.WF........CIPVVI.SVVRRLVKYETLI---res...................................................................
A0A231MPH2_9EURO/1-143                 ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........I.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFtkeg.........................nsmgRAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDLVK--hl....................................................................
A0A0D9VKP8_9ORYZ/1-127                 ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.GL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........-..............M..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCDD--.................................EHHC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.SLVVRLDQLQQRVDK-l.....................................................................
A0A0A1T2K8_9HYPO/1-50                  ..................................................MTLYY.TIVFM.LLV.FEMGV.FMML.I........I.P.F...PN.TI........R....RKIF.T.............C..V..V.....SP..P......R..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------paaanpe...............................................................
Q0CZL4_ASPTN/1-141                     ..................................................MTLYY.SLVFC.LLV.LEMAV.FMGL.I........V.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEVAAFhke...........................gggMGAT.I.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEEKVK--ll....................................................................
A0A084RA55_STACH/1-143                 ..................................................MTLYY.TLVFV.LLM.LEMAL.FMLL.I........V.P.L...PF.TL........K....RRIF.T.............F..I..S.....EN..P......I..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQMELIAAteqa.........................knggGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIIEVMRLEDRVRS-y.....................................................................
K1Q5J2_CRAGI/1-136                     ..................................................MALQW.TFVAS.FMY.IEIAV.VIIL.L........L.P.F...VS.PG........R...wQKIF.R.............S..R..L.....VS..G......V..S....A..Y.SN..I..Y........F..............N..V.FIAI......L..LL.......LF..V................DSIR.E......VH.KYTAPTEEV.................................DLKH.N.PDAANLAMMK.LF.R.A...QRN.F..YIS..GFALF.L.WF........IIRRLL.TLINEEAKLAAQCQA-y.....................................................................
A0A2C5ZL38_9HYPO/1-141                 ..................................................MTLYY.TLVFI.LLM.FEMGL.FMLL.L........V.P.L...PF.NV........K....RRIF.T.............F..I..S.....EN..P......L..V....A..K.ME..Y..W........M..............K..I.TFFF......I..LI.......LF..V................DSVN.R......VY.RVQQELMAAsdq...........................skgTTTI.I.GSERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIIQVMRLEDRLK--ty....................................................................
B4FAP8_MAIZE/1-126                     ..................................................MALQW.MILAC.VVA.VEAAV.AALV.T........L.P.V...PR.AV........R....GQIV.A.............L..T..S.....L-..-......F..L....Q..P.LS..S..V........I..............P..F.AAFQ......I..LD.......LY..W................KKEH.R......LM.CTSE-----.................................--IC.T.AEERIRFEKS.MF.K.A...QRN.V..ILC..VSACL.L.YW........CIYRIV.KLNKDIKALEETE---krl...................................................................
A0A0N5CV64_THECL/304-440               ..................................................MTLQW.FAVAL.VLY.LEIAV.VLLL.L........L.P.W...IR.PT........L...wSKIF.R.............S..R..I.....VT..T......L..G....K..H.GN..V..Y........F..............I..S.TLCI......L..LL.......LF..A................DAIR.E......VR.KYSGEAALE................................aSIRH.T.ADSENVIHLR.LF.R.A...QRN.L..YVS..GFALL.L.FL........VIKRIA.ALLSRGAQLEAAAEA-a.....................................................................
A0A1I8M2V6_MUSDO/1-134                 ..................................................MSLVW.TLIAG.FLY.AEIAV.VLLL.V........L.P.V...AS.PY........K...wNRFF.K.............S..K..F.....LA..M......L..A....R..Q.AH..L..Y........F..............F..L.IMGV......L..VL.......FL..L................DAIR.E......MR.KYSHHDHSS.................................D--V.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRRLV.TLISTQANLLAQSEA-s.....................................................................
A0A135LNR1_PENPA/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMAV.FLAL.V........I.P.L...PH.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQQELSAFtkd..........................gpgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRVR--ll....................................................................
F7ESN9_MACMU/67-202                    ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A1R3RLS7_ASPC5/1-142                 ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........I.P.L...PF.TV........K....RKLF.A.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFgke..........................ggsmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEDRVR--ll....................................................................
A0A0B2UST1_TOXCA/1-136                 ..................................................MSLQW.SVVAL.ILY.VEIVI.LLLL.L........L.P.W...LR.PS........F...wNRIF.K.............S..R..M.....IR..W......F..E....K..N.AY..V..Y........S..............I..A.GTAV......L..LL.......LF..M................DAIR.E......VR.KYAAEVAAD.................................TPMH.T.AGADNAIHMR.LF.R.A...QRN.L..YVS..GFALL.L.FL........VIKRLM.GLLSRGAQLEAAAEA-a.....................................................................
C4M417_ENTHI/2-133                     .................................................v-TLLW.SGVYF.FLV.IEIIV.LVIL.L........F.P.L...PS.FI........A....KKVP.-.............-..-..F.....FL..R......H..V....L..K.NK..T..L........F..............I..V.VLSI......L..TL.......CF..C................ESIR.S......QI.KCSHELDEL.................................GVDN.P.LLNKVTISSN.KF.R.S...ERN.M..YLS..GFSLF.F.IF........VIWRVG.VLYEQIDQKAEKE---rss...................................................................
M4DXM7_BRARP/1-126                     ..................................................MALQW.LILSY.VVA.AEVAI.AVIL.T........L.P.Y...PM.LL........K....KRIV.S.............L..V..S.....LV..L......Q..P....A..A.--..-..-........-..............-..S.IVAF......A..GF.......QL..L................DIYW.-......--.KNEHRLECS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AAGIL.L.YW........CIYRIC.KYNKDLEHLEE-----lekry.................................................................
A0A0A1T2K8_9HYPO/48-158                .............................................npers-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............F..L..S.....EN..P......V..V....A..S.IM..Y..A........M..............K..I.TFIF......I..LV.......LF..I................DSVQ.R......VY.RVQLELAIAtek..........................iakgGASV.L.GHERFEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VLITENIRLQDRLTA-f.....................................................................
E7NK01_YEASO/1-126                     ..................................................-----.-----.---.--MVM.LFIF.V........L.P.L...PF.RI........R....RGIF.S.............T..Y..N.....QL..T......A..K....Q..Q.IK..T..I........I..............F..I.TGCL......V..GL.......LF..I................DSWK.R......SQiRVSLYHNDNs...............................gSIGS.S.AVTPIQALAS.RA.Y.N...QRN.M..YIS..GFILY.F.SI........CIPTVM.SIVKRLVKYQG-----lineqkkq..............................................................
A0A0D9VRQ9_9ORYZ/1-126                 ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..VSACL.L.YW........CIFRIC.KYNKDIKALEE-----aekri.................................................................
J6EDB6_SACK1/1-138                     ..................................................MSLYF.TTLFL.LLT.IEMVM.LFIF.V........L.P.L...PF.RI........R....RGIF.S.............T..Y..N.....QL..T......A..K....Q..Q.IK..T..I........I..............F..I.TGCL......V..GL.......LF..I................DSWK.R......SQ.IHVSLYHHDn..............................sgAMGS.S.AVTPIQALAS.RA.Y.N...QRN.M..YIS..GFILY.F.SI........CIPTVM.SIVKRLVKYH------glineq................................................................
I3LW63_ICTTR/1-137                     ..................................................MTIQW.VAVAT.FLY.AEIGL.ILLF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYASIHTID................................kSSTS.K.LGAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A1V6TBU6_9EURO/8-74                  .............................lsflytetlavitprsvptph-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................-TVN.R......VY.RVQQELSSFtkd..........................gpgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.I..---..-----.-.--........------.----------------s.....................................................................
G3ALC9_SPAPN/1-142                     ..................................................MALYY.SIVFG.LLV.TEMVF.FGIL.S........L.P.Y...PR.AI........R....RKVL.T.............T..V..S.....LP..F......R..N....E..Q.FQ..I..A........L..............K..C.VLGF......V..AV.......LF..I................DSVN.R......VY.AVTMELQHAggh..........................hgqhGGAA.V.VNDRGEVQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.HL........ILIRTY.SLVAELIATKDKLDD-l.....................................................................
B9I4T6_POPTR/61-186                    ..................................................MALQW.MILTY.LVA.AEAVI.AVLL.T........L.P.S...P-.--........-....-KLL.K.............Y..R..L.....VS..L......I..S....L..V.LQ..P..A........L..............F..-.VVPF......A..GF.......QL..L................DIYW.K......ME.HRLMCTGET.................................---C.T.AAERDRYEKS.IY.K.A...QRN.V..ILC..ISACL.L.YW........CVYRVC.KFYKEIQSLEEV----ekry..................................................................
A0A179GZ64_9HYPO/1-141                 ..................................................MTLYY.TLVFV.LLM.VEMAV.FMLL.I........M.P.M...PF.KL........K....RKIF.T.............F..I..S.....EN..P......I..V....A..K.IE..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLELLAAteq...........................tskGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIIEVMRLEDRVRA-y.....................................................................
B4HAG5_DROPE/1-134                     ..................................................MSLVW.TLIAG.FLY.AEIAL.VLLL.V........L.P.V...AS.PY........R...wNRFF.K.............S..K..F.....LA..L......L..A....Q..Q.AH..I..Y........F..............F..L.IMGV......L..VL.......FL..L................EAIR.E......MR.KYSNYEQSG.................................--EV.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRRLV.TLVSAQANLLAQSEA-s.....................................................................
W2G3J5_PHYPR/1-126                     ..............................................mlln-----.QLMFW.LMI.SEAII.CLLL.S........L.P.F...GQ.WI........A....HAVI.T.............F..L..A.....KT..L......K..D....T..P.AN..T..V........A..............T..V.VLSI......I..SL.......LF..I................SDVM.T......VY.KHSSSDEVL.................................----.-.---GDGMRIR.LL.T.A...QRD.M..YIT..GFCLF.L.FL........LLRLVY.ITLATNLRLEKSL---gam...................................................................
A0A2G8KAX6_STIJA/1-135                 ..................................................MSLQW.KFVAS.FMY.MEVVA.IALL.M........L.P.F...IK.PR........T...wQKLF.H.............S..R..A.....IR..A......M..S....A..Y.GN..I..Y........F..............N..V.FMAI......L..IV.......LF..L................DAVR.D......VR.KYSEAAEDV.................................D-LT.V.PNAEAVMNMK.LF.R.S...QRN.L..YIA..GFAVF.L.WM........VLSRIC.TLISTTATLMASNEA-s.....................................................................
A0A2C9JUQ8_BIOGL/1-139                 ..................................................MTLQW.TFVAT.VLY.AEIIA.IAVL.L........I.P.I...IS.PK........T...wQKVS.R.............S..G..I.....NS..A......F..V....V..H.PS..C..R........L..............L..HgFLLF......LhnVH.......FL..T................ESIR.E......AW.KYSSPMEAE.................................QMRK.F.PEAENVLHMK.LF.R.A...QRN.M..YIA..GFALF.L.WV........VLRRLV.TLIATEANLMAESEA-s.....................................................................
G2REV9_THITE/1-127                     ..................................................-----.-----.---.--MTL.FMLL.I........L.P.L...PF.AM........R....RKVF.T.............F..I..S.....EN..P......I..V....A..K.VQ..Y..W........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELAAAten..........................tgtaASAI.H.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.ILILEVLRLEEKLKQ-y.....................................................................
A0A0B2UMF6_TOXCA/1-136                 ..................................................MSLQW.SVVAL.ILY.VEIVI.LLLL.L........L.P.W...LR.PS........F...wNRIF.K.............S..R..M.....IR..W......F..E....K..N.AY..V..Y........S..............I..A.GTAV......L..LL.......LF..M................DAIR.E......VR.KYAAEVAAD.................................TPMH.T.AGADNAIHMR.LF.R.A...QRN.L..YVS..GFALL.L.FL........VIKRLM.GLLSRGAQLEAAAEA-a.....................................................................
A0A0D1Z6S1_9PEZI/1-140                 ..................................................MTLYY.SLVFL.LLV.FEMVV.FGAL.I........I.P.L...PY.TV........K....RKLF.T.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........I..............K..I.TFIF......I..LI.......LF..I................DSCN.R......VY.RVQLESAAAhk............................drsAEAL.G.GSARMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDQLRLEEEIKR-l.....................................................................
A0A1Y3N9I5_PIRSE/1-137                 ..................................................MTPYI.LAIVY.ILG.IQCLL.IIYL.A........V.P.W...RV.PF........R....RTIV.Ek...........fT..T..S.....NN..G......I..L....N..K.IR..F..C........Y..............G..I.LQVF......I..AL.......LF..A................DNIR.Q......LK.YLGEQVDRV................................yKFPT.S.QEVIAETTKR.LH.K.T...QRD.F..YIL..IFTLF.T.GI........VLYLLH.LVVL------------rcgryrkerng...........................................................
R4FPZ2_RHOPR/1-134                     ..................................................MSLQW.TLVAG.FLY.LEIFV.VFIL.V........L.P.F...LS.PK........K...wQSFF.K.............S..R..F.....LQ..V......L..S....N..Q.TQ..W..Y........F..............G..F.IVLI......L..TL.......FL..L................DAIR.E......MR.KYTNKEHSE.................................--HS.H.LESELQQSMR.LF.R.A...QRN.F..YIS..GFSLF.L.SL........VIRRLI.SLISAQATLMSDNEA-i.....................................................................
A0A161HKY6_9ASCO/1-126                 ..................................................-----.-----.---.--MGA.FLFL.V........T.P.L...PR.AY........R....KKVL.T.............A..L..S.....GL..P......F..A....H..H.LA..I..T........L..............R..F.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVEVAEAhss...........................iraAGNM.I.SVERSEIQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTH.ALVLDLMEAQDKISA-l.....................................................................
S6EW33_ZYGB2/1-136                     ..................................................MSIYY.KLVFG.VLV.TEIVM.FSIL.A........L.P.L...PT.KI........R....KPLT.L.............M..L..I.....RP..F......L..N....D..V.IQ..V..A........I..............K..C.MLAF......V..AL.......LF..V................DSVN.R......LY.TVQQELEAV................................nPASS.F.SGNRMEVLSR.KF.F.A...QRN.M..YLT..GITLF.L.TF........VVVRTF.NLVRELLQLKDRYQ--ma....................................................................
B9N383_POPTR/1-126                     ..................................................MALQW.MILTY.VVA.AEAAI.AALL.T........L.P.S...PK.LL........K....DRLV.S.............L..I..S.....L-..-......-..-....-..L.LQ..P..A........L..............-..F.IVPF......A..GF.......QL..L................DIYW.-......--.KNEHRLMCA.................................GENC.T.ASERDRYEKS.IY.K.A...QRN.V..ILC..VSACL.L.YW........CVYRIC.KYYKEIQSLEEV----ekry..................................................................
G8ZUQ6_TORDC/1-141                     ..................................................MSLYY.SLVFG.VLV.FEVVI.FSIL.A........L.P.I...PT.RL........R....KPLT.L.............V..L..L.....RP..F......Q..N....D..I.IQ..I..T........I..............K..C.VLGF......I..LL.......LF..L................DTIN.K......VY.NIDRELQAAssa...........................ntkGGGV.Y.SQDRIEVLSR.KF.F.A...QRN.M..YLT..GMTLF.L.TF........TVARTF.GLVQELLQLKDKYRK-e.....................................................................
A0A168NC43_MUCCL/1-143                 ..................................................MALYY.GIVFG.ILT.FEIIL.FFLF.L........L.P.I...PT.RW........Q....KPVF.R.............W..L..A.....TS..P......A..I....A..H.AQ..Y..I........M..............K..I.VFVF......I..FI.......LF..L................DSVN.T......LR.AFYEVVNTEdeng.........................gipaAGNS.D.FRAQVGQAAK.KF.Y.A...QRN.L..YLT..GFTIL.L.LL........ILNKIK.TMAMDYIRLEDQF---iel...................................................................
A0A182X1W0_ANOQN/1-135                 ..................................................MTLVW.GIIAS.FLY.VEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHTH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
S9W1N2_SCHCR/1-137                     ..................................................MTIYY.MIVFI.LLM.LEIVS.FVIL.S........L.P.L...PM.RV........R....KAIL.N.............T..I..S.....NS..P......I..A....G..K.IE..H..T........L..............K..I.MIIC......I..LV.......LF..S................DSVR.R......VV.RISTEFDMSg...............................aGSTT.A.ENARTGFKAG.QF.Y.A...QRN.L..YLC..GSALF.L.SL........VVNRYY.LSLKTLIASEEKVEA-l.....................................................................
A0A094BE68_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMGL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAte............................qsqSGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
F6RHD6_CALJA/1-137                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..L.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
C9JP06_HUMAN/1-64                      ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------......................................................................
A0A150V4F6_9PEZI/1-140                 ..................................................MTLYY.SIVFA.LLF.FEITL.FCLL.I........V.D.L...PF.GW........K....AKLF.T.............F..L..A.....EN..P......L..V....S..K.VQ..Y..G........M..............K..I.TFIF......V..AI.......LW..I................DSIN.R......VY.RVHMELQQAkq............................qggAAAV.A.GSERLEVQAR.RF.Y.S...ERN.M..YLC..GFTLF.L.SL........VLNRTY.TMILETLRLQAEVKE-l.....................................................................
J3KAY9_COCIM/1-144                     ..................................................MTLYY.TLVFL.ILM.VEMAI.FMGL.I........V.P.L...PF.TW........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSAYskda........................vgagiRAGA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEILRLEDRVKQ-f.....................................................................
L5LN01_MYODS/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.SN..T..F........F..............V..V.LIAI......L..VL.......LV..I................DAVR.E......IS.KYDDVTEKV.................................NLQN.N.PGAVEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A067JAC6_JATCU/1-112                 ................................................mt-----.-----.---.-----.---L.I........M.V.L...IF.KT........P...lRKLV.L.............M..V..L.....DR..V......K..R....G..R.GP..I..V........V..............K..T.VAGT......V..LV.......VL..I................SSVY.S......MM.KIQKRWIDE.................................G---.A.VNPTDQVLMS.GH.L.L...QA-.-..TLM..GFCLF.L.AL........MIDRLH.HYIRELRMRRKSMEA-i.....................................................................
A0A1X7QWJ4_9SACH/1-147                 ..................................................MSLYF.TLLFA.ILT.LEMAT.LFVL.V........L.P.L...PN.KM........R....KLFY.N.............T..Y..Q.....KL..Y......Q..N....Q..Q.VK..T..V........A..............I..I.LSII......V..GL.......LF..I................DSWK.R......AQ.INVTLYRHQklyned.....................dgvnsnQYDS.H.AVTPTQALAS.RA.Y.N...QRN.V..YIS..GFILY.F.MV........GIPTVM.SIIRRLIKYQDL----innq..................................................................
A0A2G8JX38_STIJA/1-135                 ..................................................MSLQW.KFVAS.FMY.MEVVA.IALL.M........L.P.F...IK.PR........T...wQKLF.H.............S..R..A.....IR..A......M..S....A..Y.GN..I..Y........F..............N..V.FMAI......L..IV.......LF..L................DAIR.D......VR.KYSEAAEDV.................................D-LT.V.PNAEAVMNMK.LF.R.S...QRN.L..YIA..GFAVF.L.WM........VLSRMC.TLISTTATLMASNEA-s.....................................................................
A0A1V1SZV0_9FUNG/1-141                 ..................................................MTLYY.TLVFL.LLV.AEMAL.FMLL.V........V.P.M...PF.TV........K....RKIF.T.............F..L..S.....EN..P......I..V....A..K.IQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELAAAtdt...........................skgSAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILDMLRLEEKLKQ-y.....................................................................
E6R4K1_CRYGW/1-138                     ..................................................MTLYY.SICFG.LLM.AELSL.FCTI.V........C.P.M...PF.AI........R....KKMF.H.............F..L..S.....EN..P......V..V....A..K.IQ..Y..G........L..............K..I.TFIF......V..AV.......LF..V................DALQ.R......MI.RIAQEGATAk..............................mkQDMA.D.ARTETNYAAR.RF.Y.A...QRN.L..YLT..GATLF.L.SL........LLARVF.YIILDFIQVQESYTA-l.....................................................................
A0A1Y1XVZ9_9FUNG/1-134                 ..................................................MALYH.SIVFG.FMI.TQMSL.FLLM.V........G.P.F...PH.RF........K....QSIL.M.............K..I..D.....SS..K......W..M....H..R.LY..F..Y........I..............N..I.GLVF......V..FI.......LF..V................DSII.R......MV.NANKEASAA.................................-HQA.D.PRTDSQLQLR.KF.Y.S...QRN.F..YLT..GFTLF.L.SL........ILNRTF.YILMDLFHAEVQVEK-l.....................................................................
A0A1V2L7I1_CYBFA/1-122                 ..................................................-----.-----.---.--MVL.MTIL.V........L.P.L...PL.RL........R....KSSF.N.............V..Y..S.....KL..Y......D..N....K..E.FR..T..V........Y..............S..V.AGVV......V..TL.......LF..I................DALK.S......TW.KLKTNDTYNl...............................tQYRA.T.YQHSSDVMAR.IF.Y.A...QRN.V..YIS..GAVVF.F.GF........AIPTVF.TIVRRLIKYEELAR--am....................................................................
A0A1Y2F1T9_9FUNG/9-141                 ...............................................gpi-----.---SY.LLV.GHCVT.ITFL.S........L.P.S...F-.PL........R....RLIV.E.............K..I..Sr...gQN..K......I..L....N..H.IR..F..C........Y..............I..M.LHVF......I..LL.......LF..I................DDIR.R......MN.YLKEQVGRAy...............................kNERA.D.STTLQDFSKR.LH.K.A...QRD.F..YIL..IFTLF.C.AV........ITYLLH.LLVLKMENY-------rvkylel...............................................................
U7PVN2_SPOS1/1-141                     ..................................................MTLYY.TMVFM.LLM.LEMSL.FVVL.I........V.P.L...PF.TL........K....RRIF.T.............F..L..S.....EN..P......L..V....A..K.VQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELGLSsen...........................aanGAAI.I.GRERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEEKLKK-y.....................................................................
M4DCC5_BRARP/1-104                     ..................................................MALQW.LILSY.VVA.AEVVI.AVVL.T........L.P.Y...PM.VV........K....KRVV.S.............L..V..S.....LV..L......Q..P....A..A.--..-..-........-..............-..S.IVAF......A..AF.......QL..C................DIYW.K......--.-NEHRLSCS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AAGIL.L.--........------.----------------yw....................................................................
C5M1R3_CANTT/1-131                     ..................................................MSLQM.SLAFC.TLI.GPMAI.LLTL.V........L.P.L...PY.VV........R....QKIV.D.............I..T..F.....AL..Q......K..N....Q..N.FR..V..G........V..............V..F.SIVL......M..GM.......QL..L................DCVQ.R......LR.KYADIENPN.................................----.F.PGIDYDRLAS.KF.Y.S...QRN.L..YLS..GAILY.L.QV........AIGTVV.TIVRKMVLKEKLF---rqs...................................................................
B6HAR5_PENRW/1-142                     ..................................................MTLYY.SLVFL.LLV.FEMAV.FLAL.V........I.P.L...PH.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELSAFtkd..........................gpgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRV---rlf...................................................................
A0A182E9G2_ONCOC/1-137                 ..................................................MTLQW.FVVAL.ILY.LEIAV.VLLL.L........L.P.W...IR.PS........L...wSKFF.K.............S..R..M.....VK..T......F..E....K..H.AN..V..Y........F..............I..S.VLCI......L..LL.......LF..A................DAIR.E......VR.KYANEVAIE................................aSIRH.T.ADSENVVHMR.LF.R.A...QRN.L..YIS..GFALL.L.FL........VIKRLV.ALLSRGALLEAAAEA-a.....................................................................
A0A093FXM3_DRYPU/1-136                 ..................................................MTFQW.TAVAL.FLY.GEIAV.ILVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......M..A....I..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAIR.E......VR.KYSAVHVTE................................rAINV.N.ANAVDHI-QN.LY.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTV.TLLTQLAKGMASHA--al....................................................................
G4ZD24_PHYSP/1-136                     ............................................masmws-----.SFTYV.LLP.PAVVL.LLLM.T........I.P.F...PG.VM........L...nRGIV.N.............FgdV..V.....FN..I......R..V....G..T.LS..V..F........S..............V..I.TAVS......F..VV.......LV..A................QTID.L......QK.RYSLPHDQH.................................-IEA.H.YSADLQKKAS.RW.R.S...ERN.W..WIS..ALTFT.I.YW........MLLRFH.AMKKKLLKAQR-----hed...................................................................
W5LDN2_ASTMX/1-139                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...VS.PK........S...sSSVS.P.............S..N..K.....LQ..L......V..W....L..C.KN..S..F........F..............L..I.LLKL......M..LI.......FR..I...............nEEWE.D......QL.KYQNRIYIIe...............................kKNIC.N.YLNLMRHSAV.KM.F.N...IRS.F..YFV..-ISFF.LkSK........LLRRLA.SLLSQQATLMASNEA-f.....................................................................
E7Q1W1_YEASB/1-140                     ..................................................MSLYY.TLVFA.ILV.VEIFM.FSIL.A........L.P.I...PS.RY........R....RPLT.L.............L..L..L.....KP..F......K..S....S..T.VQ..V..A........I..............K..C.ILGF......I..LL.......LF..I................DCIN.R......VY.SIDKELQLSsa............................sqnNGAI.I.AQDRIEVLSR.KF.F.A...QRN.M..YLT..GITLF.L.TF........VVVRTF.GLVIELLTMKDIYR--as....................................................................
L8G5T8_PSED2/1-140                     ..................................................MTLYY.SLVFM.LLV.AEMGL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..H..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAte............................qsqTGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
A0A0W0FCT3_9AGAR/1-141                 ..................................................MTIYY.TLTFL.LLA.AEMTT.FCVL.V........A.P.L...PY.KV........R....RGLF.R.............F..L..S.....ES..K......L..V....G..K.VA..Y..A........L..............K..I.SFIF......V..AI.......LF..F................DALQ.R......MF.RITAESEMArsg...........................ggaGGVG.D.VRTETNLAAR.KF.Y.A...QRN.T..YLT..GFTLF.L.SL........VLTRTF.YITLDLIHVQEEYAK-i.....................................................................
G0VJE2_NAUCC/1-139                     ..................................................MSLYF.TSLFL.LLT.IQMAV.LFIS.I........L.P.L...PN.KV........R....KGIF.N.............S..Y..Y.....RL..T......S..S....Q..Q.SL..T..V........I..............I..I.LGVL......V..GL.......LF..A................DSWK.R......AQ.IPVTLYRHKhy............................engIEDP.N.PVTSIQVLAT.RA.Y.N...QRN.C..YIS..GFILY.F.LV........CIPTVM.SILRRLVKYKD-----liiq..................................................................
A0A1E3QKM8_9ASCO/1-136                 ..................................................MSIQM.NLVFL.ILI.GELAI.LAVL.V........A.P.L...PQ.VV........R....SKIV.D.............L..A..T.....FA..M......R..Q....V..H.CQ..V..I........S..............V..F.SSAL......I..GL.......MF..L................DSVH.K......LA.RAAPPALNH................................pLGTV.A.PPPTSEQLVR.VF.Y.A...QRN.M..YLT..GAVLF.F.GM........AIGTVV.TILKQLVRAQKRLAA-v.....................................................................
W0TBT5_KLUMD/31-168                    ..................................................MSLYH.GLVYA.ILV.VELIT.LTLL.G........L.P.L...PL.VL........K....KPVI.K.............A..L..S.....KP..L......L..S....S..T.VQ..I..T........I..............K..C.VLGF......I..LL.......LF..V................DSMN.R......VY.GIESELDRMk..............................esGVGT.Y.PHGKTEILSR.KF.F.W...QRN.M..YLT..GITLF.L.TF........LLTRVA.TLVWELFDMKDAYE--tt....................................................................
E7QCJ5_YEASZ/1-140                     ..................................................MSLYY.TLVFA.ILV.VEIFM.FSIL.A........L.P.I...PS.RY........R....RPLT.L.............L..L..L.....KP..F......K..S....S..T.VQ..V..A........I..............K..C.ILGF......I..LL.......LF..I................DCIN.R......VY.SIDKELQLSsa............................sqnNGAI.I.AQDRIEVLSR.KF.F.A...QRN.M..YLT..GITLF.L.TF........VVVRTF.GLVIELLTMKDIYR--as....................................................................
H2AYB1_KAZAF/1-133                     ..................................................MSLYY.SLIFA.ILV.FEVVL.FAIL.A........L.P.I...PT.KY........R....KPIT.L.............V..L..I.....KP..F......Q..N....S..T.IQ..I..S........I..............K..C.ILGF......I..AL.......LF..V................DAIN.K......VY.NINLELNSE.................................L--N.P.NSEKIEILSR.KF.L.Q...QRN.L..YLT..GITLF.L.TF........VVMRTF.GLVHELLRLKEIY---rsd...................................................................
A0A0C9LPD7_9FUNG/1-136                 ..................................................MAIYY.ALTFG.ILV.TEMIV.FGLL.V........L.P.L...PS.RW........R....HAML.K.............F..A..S.....TS..P......M..M....A..K.AM..Y..A........L..............K..I.IFGF......I..FV.......LF..I................DTIN.R......LN.RIESEVEGE................................kSHHH.D.YGYETSIKAK.RF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.ALVLELLQREEELKK-a.....................................................................
Q6DKC8_XENLA/1-135                     ..................................................MSLQW.TAVAT.FLY.VEVFL.VLLL.C........I.P.F...IS.PT........R...wQKIF.K.............S..R..L.....VQ..L......L..V....S..Y.GN..T..F........F..............L..V.LIVI......L..VL.......LL..L................DAFR.E......IQ.KYGVGELVD.................................-LKN.N.PVAVEHIHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.MLISKQATLLASNEA-f.....................................................................
A0A1V6NDB5_9EURO/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMCV.FLAL.V........I.P.L...PH.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELSSFtkd..........................gpgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRV---rlf...................................................................
A7TT08_VANPO/1-141                     ..................................................MSIYF.TLLFV.ALT.LEMGT.LFFL.V........L.P.L...PF.RL........R....KSMC.T.............V..Y..D.....RL..Y......Y..N....Q..Q.FR..T..V........G..............A..I.LGVL......V..GM.......LF..A................DSWK.R......AN.VHVSTYHDQnsn...........................emtNDAG.S.LITPVQVLTS.RA.Y.N...QRN.V..YIS..GFILY.F.VL........CIITVM.SIVRRLVKYQSL----ines..................................................................
R0KR50_SETT2/1-141                     ..................................................MTLYY.SLVFL.LLV.TEMLI.FCAL.I........V.P.L...PF.TW........R....RRLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSGSddq...........................grsGVAA.G.GIERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEEVKN-l.....................................................................
C5XZA1_SORBI/1-127                     ..................................................MALEW.VVLGY.AAG.AEAIM.LLLL.T........L.P.G...LD.GL........R....RGMI.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........-..............M..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCDDE-.................................-HAC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.QLVVRLEQMQQRVDK-l.....................................................................
A0A074W6R5_9PEZI/1-143                 ..................................................MTLYY.SLVFA.LLV.FEMVV.FMSL.I........V.P.M...PF.TW........K....RKLL.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..W........I..............K..I.TFVF......I..LI.......LF..V................DSVN.R......VY.RVQLELAQAnnsn.........................ngagAAAV.G.GIERMEIQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.GMILDVLRLELENRQ-l.....................................................................
A0A0B7NT63_9FUNG/1-141                 ..................................................MAIYY.ALTFG.ILV.TEMII.FGLL.V........L.P.L...PS.RW........R....HAML.T.............F..A..S.....TS..P......M..M....A..K.AM..Y..A........L..............K..I.IFGFpiqytlI..DM.......GK..I................DTIS.R......LQ.RIESEGEGE.................................NHHH.D.YSYETSMKAK.RF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.ALVLELLQREQELKK-a.....................................................................
A0A0B4IGP9_9HYPO/1-141                 ..................................................MTLYY.SLVFF.LLV.LEMVI.FMLL.L........I.P.L...PH.TA........K....RKVF.T.............F..I..S.....EN..P......I..I....S..K.VM..Y..W........L..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLEVVAAgeq...........................askGAAI.L.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMMIDNIKLEDKVKA-f.....................................................................
A0A091R5C2_MERNU/1-128                 ..................................................MTFQW.TAVAT.FLY.GEIAV.ILVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......L..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSAVHVNE................................rAANV.N.TNAFDHIQMK.LL.R.-...---.-..---..-FSLF.L.WL........VLRRTV.TLLTQLAKGMTSHA--al....................................................................
H2R510_PANTR/1-137                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A183SFM2_SCHSO/15-100                .......................................glldsvmtlgp-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................ESIR.K......IW.THSAALSELk..............................rhPEDF.N.TETETIFLKR.MF.K.A...QRN.L..YIS..ALSLF.L.CF........VIHRLT.KLIADQASMLADQQA-a.....................................................................
A0A1C1CMV4_9EURO/1-95                  ...............................................mtp-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMTALtkdn.........................sgagRAAA.I.GSERMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVK--my....................................................................
A0A1A6HJK8_NEOLE/9-135                 ..............................................akav-----.-----.AFA.EEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIII......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SL........---RLV.TLISQQATLLASNEA-f.....................................................................
A0A1B0FH63_GLOMM/1-134                 ..................................................MDLVL.TLMAG.FSY.AEICV.VLLL.V........L.P.V...AS.PH........K...wNRFF.K.............S..K..F.....LA..M......V..A....R..R.AY..L..C........F..............F..F.VIVV......L..VL.......FL..L................EAIR.E......MR.KYSNQEHYA.................................D--V.R.LNTEMQRSMR.LF.K.A...QRN.F..CIS..GFPIF.L.AL........VIRRLV.TLISVQANLLDQNEA-t.....................................................................
A0A094EHM6_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMGL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAte............................qsqTGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
A0A166W0X1_9HOMO/1-130                 ..................................................-----.----M.LLA.AEMGT.FCIL.V........A.P.L...PY.AV........R....KRLF.R.............F..L..S.....ES..P......I..V....A..K.IA..Y..G........L..............K..I.SFIF......V..GI.......LF..V................DALQ.R......MF.RVTAESDLGks.............................hgQPMQ.D.VRTETNFAAR.KF.Y.A...QRN.V..YLT..GFTLF.L.SL........VLTRCF.YIILDLIHVQEEYAK-l.....................................................................
A7EKL9_SCLS1/1-140                     ..................................................MTLYY.SLVFV.LLV.AEMAL.FMLL.I........V.P.L...PF.TI........R....RKMF.T.............F..I..S.....ES..R......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAEAnk............................sqaGNPV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEEKVN--ry....................................................................
D3B6G0_POLPP/1-135                     ..................................................MDFIM.ISIFI.LLM.VEMLI.CTVA.M........L.P.I...SM.AT........R....KSLF.T.............G..L..N.....KV..F......G..G....K..T.PV..I..V........F..............R..V.IFVI......L..LG.......IF..G................DAII.N......SS.KYDRKIHDP.................................EGAT.T.QSEKNNLYLM.LF.R.Y...QRN.I..YLT..GFTLY.L.FF........LIYRAQ.SIVLELTSVETKSNA-v.....................................................................
A0A091J1F6_EGRGA/1-137                 ..................................................MTFQW.TAVAA.FLY.GEMGV.VILL.C........L.P.F...IS.PL........R...wQKIF.M.............F..P..L.....WS..K......L..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..F................DAIR.E......VR.KYSSIHVNE................................kAVNV.N.TNAFDHIQLK.LF.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTV.TLITQLAKGMTSHA--al....................................................................
A0A078I9Q8_BRANA/1-126                 ..................................................MALQW.LILSY.VVA.AEVAI.AVIL.T........L.P.Y...PM.LL........K....KRIV.S.............L..V..S.....LV..L......Q..P....A..A.--..-..-........-..............-..S.IVAF......A..GF.......QL..L................DIYW.-......--.KNEHRLECS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AAGIL.L.YW........CIYRIC.KYNKDLEHLEE-----lekry.................................................................
A0A1V6PSB7_9EURO/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMAV.FLAL.V........I.P.L...PH.TI........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELSAFtkd..........................gpavGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDRVR--ll....................................................................
A0A1B0GK83_LUTLO/1-134                 ..................................................MSLVW.TLIAS.FLY.AEIAV.VLLL.V........L.P.V...AS.PS........R...wQRFF.R.............S..R..F.....LA..M......L..G....R..Q.AQ..M..Y........F..............Y..L.LLAV......L..VV.......FL..I................EAVR.E......MR.KYSHIDPAQ.................................E--A.H.LNVGMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRRLV.TLISAQATLQAHSEA-s.....................................................................
A0A0G2J611_9EURO/1-129                 ..................................................-----.-----.---.--MAI.FVGL.I........I.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELSSSskem........................ggsgrRTAA.V.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDRVKQ-l.....................................................................
W9X7E2_9EURO/1-143                     ..................................................MTLYY.SLVFV.LLV.AEMVM.FLAL.I........V.P.M...PF.TV........K....RKMF.N.............F..I..S.....ES..P......I..V....A..K.IQ..Y..G........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMAAFskdt.........................sgagRAAA.M.GSERMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVK--my....................................................................
A0A0P7UF87_9TELE/1-135                 ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........V.P.F...IS.PQ........R...wHKIF.K.............S..R..L.....VK..A......I..T....T..Y.GN..T..Y........F..............M..V.VIGI......L..VF.......LL..I................DAFR.E......VR.KYSVTDKVD.................................-LSN.N.PVAIEHIHMK.LF.R.A...QRN.E..YIA..GFALL.L.CL........LLRRLA.TLLSQQATMMASNEA-f.....................................................................
W6MSB2_9ASCO/1-131                     ..................................................-----.-----.---.--MVL.FAAL.S........F.P.L...PG.RA........K....KQVL.K.............T..L..R.....TP..F......R..S....Q..Q.VQ..I..A........I..............K..C.ILGF......I..LV.......LF..L................DALN.R......VY.RVGNELDMLsvsgd......................satagvAAAM.G.MGDRSEIQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.TL........ILTRTY.ALVFELISVKEELKA-t.....................................................................
H2MWD1_ORYLA/1-135                     ..................................................MSLQW.TAVAT.FLY.VEVFL.VLLL.C........I.P.F...IS.PK........R...wSKVF.K.............S..R..I.....LQ..T......I..A....L..Y.GN..T..W........F..............M..V.AIAI......L..VF.......LL..I................DAFR.E......VR.KYSVSDKVD.................................-VTN.N.PTAIEHIHMK.LF.R.A...QRN.E..YIA..GFALL.L.CL........LLRRLA.TLLSQQASLMASNEA-f.....................................................................
C8VQF6_EMENI/1-143                     ..................................................MTLYY.SLVFC.LLV.LEMGV.FMGL.I........V.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........L..............R..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEVSAFskeg.........................gnvgRGAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRVK--ll....................................................................
A0A194W175_9PEZI/411-551               ..................................................MTLYY.TLVFM.LLM.AEMAL.FMFL.I........L.P.M...PF.SI........K....RRMF.T.............F..I..S.....EN..P......L..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELSAVtdg...........................gnnAQAI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEEKLKQ-y.....................................................................
A0A182VTA9_9DIPT/1-135                 ..................................................MTLVW.GIIAS.FLY.VEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHTH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
A0A1E7FYE0_9STRA/3-144                 .................................................r-SLLW.TSVFV.LLM.FELVV.TLIL.V........L.P.I...PR.KW........R....NWIC.L.............K..V..S.....RL..E......L..K....K..R.LR..V..P........L..............I..G.IFFA......L..LF.......AL..L................DTTT.Y......LQ.HIYLKENNEqqq..........................rqqrLFDS.S.VLDRHLIKEK.EY.K.T...GRN.M..YLV..GFAFT.L.LF........VIGRLT.ELMQEHAELEQQVER-l.....................................................................
A0A024GI39_9STRA/24-160                .................................................m-ATFWsTMTYF.LLP.PAVVL.LLLL.T........I.P.F...PF.LK........L...nRAIV.R.............F..AdfV.....FS..L......E..I....G..T.IK..I..F........H..............L..I.TVVS......F..VV.......LA..A................QTFE.L......QK.RYPTKYDHH.................................-LEA.H.YAADLQERAK.RW.R.F...ERN.W..WIS..ALTFT.I.YW........MLLRFH.ALKKELVF--------qkngtkp...............................................................
A0A059EXP2_9MICR/66-117                .......................................ykgssledvll-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.KY.Y.H...RSN.S..YLT..GFTLF.N.AL........ILYRFI.QVYNEFMEEEEKT---nil...................................................................
F6RP01_ORNAN/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..F.....VQ..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDNVTETV.................................NLQT.T.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........HNQKMV.VLASQKRSMGA-----sspsf.................................................................
A0A1I8M2V5_MUSDO/1-134                 ..................................................MGLIW.TLIDI.FLF.VELAV.VLLL.T........L.P.V...FN.AT........T...wNRFF.K.............S..Q..F.....LA..M......L..A....K..Q.AQ..I..Y........F..............A..M.LIGL......L..IL.......CL..L................EALR.E......MQ.KFSSESKSD.................................S--E.H.LDVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VF........VIKRLV.TLISEQAFLLAQSEA-s.....................................................................
A0A251RVQ5_HELAN/1-129                 ..................................................MALEW.VVLGY.AAA.AEAVM.VLLL.T........I.P.G...LG.PL........R....KGLV.A.............V..I..-.....--..-......-..-....R..N.LL..K..P........F..............L..S.IVPF......C..LF.......LF..M................DIYW.K......YE.TRPTCDTA-.................................-ESC.T.PTEHLRHQKS.IM.K.S...QRN.M..LLI..VTALV.F.YW........LLFSVT.QLVVKIDQLNSRVE--klkn..................................................................
H0GXH6_SACCK/1-126                     ..................................................-----.-----.---.--MVM.LFIF.V........L.P.L...PF.RI........R....RGIF.S.............T..Y..N.....QL..T......A..K....Q..Q.IK..T..I........I..............F..I.TGCL......V..GL.......LF..I................DSWK.R......SQ.IHVSLYHHDn..............................sgAMGS.S.AVTPIQALAS.RA.Y.N...QRN.M..YIS..GFILY.F.SI........CIPTVM.SIVKRLVKYH------glineqkkq.............................................................
A0A0M3QW51_DROBS/1-134                 ..................................................MSLVW.TLIAT.FLY.AEIAV.VLLL.V........L.P.L...GS.PY........K...yNRFF.K.............S..K..F.....LA..M......L..A....K..Q.AH..L..Y........F..............F..L.IMGV......L..VL.......FL..L................EAIR.E......MR.KYSNHETTG.................................--EV.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFSIF.L.VL........VIRRLV.TLISAQANLLAQSEA-s.....................................................................
A0A0D2RKY0_GOSRA/1-126                 ..................................................MALQW.MILTY.VVA.AEAAL.ALLL.T........F.P.S...PK.LL........K....NRFV.S.............-..-..-.....--..L......I..S....L..I.LQ..P..T........L..............-..F.IVPF......A..GF.......QL..L................DIYW.K......NE.HRLMCTS--.................................-DIC.T.AAERDRYEKS.VF.K.A...QRN.V..ILC..TTACL.L.YW........CIYRIC.KYHKEIQSLEE-----vekry.................................................................
A0A0M8MSF7_9HYPO/967-1109              ..................................................MTLYY.TIVFT.ILM.AEMAL.FMLL.V........V.P.L...PF.TL........K....RKIF.A.............F..I..S.....EN..P......I..I....A..K.VQ..Y..W........M..............K..I.TFVF......I..LV.......FF..I................DSVN.R......VY.RVQLEVMAAhera.........................aqgaPNAV.M.GSERNEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VLILELMRLEDKVRA-y.....................................................................
I1KQ72_SOYBN/1-126                     ..................................................MALEW.VVLGY.VAA.AEAIM.VILL.T........I.P.G...LE.AL........R....KGLI.A.............V..T..-.....--..-......-..-....R..N.LL..K..P........F..............L..S.VVPF......C..LF.......LF..M................DIY-.-......-W.KYETRPSCE.................................GDSC.T.PSEHLRHQKS.IM.K.S...QRN.A..LLI..AAALL.F.YW........LLYSVT.NLVVRIDHLNQRLE--rl....................................................................
G2Y238_BOTF4/1-140                     ..................................................MTLYY.SLVFV.LLV.AEMAL.FMLL.I........V.P.L...PF.TI........R....RKMF.T.............F..I..S.....ES..R......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELAEAnk............................sqaGNPV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEEKVN--ry....................................................................
A0A2K5NUQ1_CERAT/68-203                ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A1E4T9N5_9ASCO/1-132                 ..................................................MTIYY.TLVFG.ILI.FEMVG.FLLL.V........I.P.I...PG.KA........R....RGIV.K.............Q..V..N.....NV..V......D..S....A..H.IN..Y..T........A..............R..A.VFGF......I..VI.......LF..L................DSIN.R......TV.RVTAEEERR.................................I--N.I.TSDRTDYLAR.RF.Y.A...QRN.F..YLT..GFTLF.L.AI........VLNRTF.ANVVRQLELEEK----llv...................................................................
E2R5S2_CANLF/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAVEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A9PCI7_POPTR/1-126                     ..................................................MALEW.VVLGY.AAG.AEAIM.VLLL.T........I.P.G...LD.GL........R....KGL-.-.............-..-..-.....-S..A......V..T....R..N.LL..K..P........F..............M..S.VVPF......C..LF.......LL..M................DIY-.-......-W.KYETRPSCE.................................GESC.T.PTEHLRHQKS.IM.K.S...QRN.A..LLI..GVALV.F.YW........LLYSVT.HLVVKIEQLNQRVE--rl....................................................................
A0A1I7XJM2_HETBA/22-141                .............................................ywvcf-----.-----.---.-----.----.-........-.-.-...--.--........R...wSKLF.K.............S..R..L.....VS..A......L..G....Q..H.AH..I..Y........S..............Y..T.GAFV......L..FI.......LF..AgkltihsyysvdpsisHAVR.E......VN.KYSHVDAALe...............................sSIRH.T.ADADAVIHMR.LF.R.A...QRN.F..YIS..GFALL.L.FL........SV----.----------------pckgvmiyiyi...........................................................
B6T975_MAIZE/1-127                     ..................................................MALEW.VVLGY.AAG.AEAVM.LLLL.T........L.P.G...LD.GL........R....RGMV.S.............V..V..-.....--..-......-..R....S..A.LK..P..M........M..............-..S.VVPF......C..LF.......LL..M................DIYW.K......YE.TRPTCDDE-.................................-HAC.T.PSEHLRHHKS.VM.K.S...QRN.A..LLI..AAALL.L.YW........ILFSVT.QLVVRLDQMQQRVDK-l.....................................................................
A0A0C9LZ76_9FUNG/1-142                 ..................................................MTLYY.SLVFL.LLV.FEMFV.FMAL.I........V.P.M...PF.TW........K....RKLF.T.............F..I..S.....ES..P......L..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELRQAtkg..........................nnlaGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEENK--rm....................................................................
A0A0D2B0J2_9EURO/1-143                 ..................................................MTLYY.SLVFM.LLV.AEMVL.FLAL.I........V.P.M...PF.TV........K....RKMF.N.............F..I..S.....ES..P......L..V....A..K.IQ..Y..G........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMAALskdt.........................tgagRAAA.I.GSERMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVK--my....................................................................
M7XJU9_RHOT1/1-142                     ..................................................MAIQN.LIAFG.IVG.IEILT.FFVL.I........V.P.L...PF.TW........R....RALF.K.............T..I..A.....ES..H......I..I....A..K.IQ..Y..G........L..............K..I.TFIF......I..AL.......MF..V................DAVN.Q......MV.KIHREREAGrsa..........................nvagGLAP.D.ARSQADYRSR.KF.L.S...ERN.F..YLH..GSCLF.L.SL........ILSRTY.SLVLDLIRAQEEL---aiv...................................................................
H0GJ68_SACCK/1-126                     ..................................................-----.-----.---.--MVM.LFIF.V........L.P.L...PF.RI........R....RGIF.S.............T..Y..N.....QL..T......A..K....Q..Q.IK..T..I........I..............F..I.TGCL......V..GL.......LF..I................DSWK.R......SQiRVSLYHNDNs...............................gSIGS.S.AVTPIQALAS.RA.Y.N...QRN.M..YIX..GFILY.F.SI........CIPTVM.SIVKRLVKYQG-----lineqekq..............................................................
H3G6Y1_PHYRM/1-107                     ............................................masmws-----.SFTYV.LLP.PAVVL.LLLM.T........I.P.F...PG.LV........L...nRGIV.K.............FgdL..V.....FS..I......R..I....G..T.LS..V..F........S..............V..I.TFVS......F..VV.......LA..A................QTYD.L......QK.RYALHADP-.................................HIEA.H.YSADLQKKAS.RW.R.S...ERN.W..WI-..-----.-.--........------.----------------......................................................................
A0A0D2GZ53_9EURO/1-143                 ..................................................MTLYY.SLVFV.LLV.AEMVL.FLAL.I........V.P.M...PF.TV........K....RKMF.N.............F..I..S.....ES..P......I..V....A..K.IQ..Y..G........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVEMAALskdt.........................tgagRAAA.I.GSDRMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.GMILDVLRLEEKVK--my....................................................................
A0A1B9I837_9TREE/1-117                 ..................................................-----.-----.---.-----.---M.V........C.P.M...PF.AL........R....KKLF.H.............F..L..S.....EN..P......I..I....A..R.VQ..Y..G........L..............K..I.TFIF......V..AV.......LF..V................DAVQ.R......MV.RIAQEGAAAk..............................vkPDMI.D.ARTETNYAAR.RF.Y.A...QRN.L..YLT..GATLF.L.SL........LLARVF.YIVLDFIQVQESYT--tl....................................................................
A0A179V3H6_BLAGS/1-142                 ..................................................MTLYY.SLVFL.LLV.VEMVI.FVGL.I........I.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQTELSTHske..........................mggaGTAA.L.GAERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVKQ-l.....................................................................
A0A0D0E308_9HOMO/1-139                 ..................................................MTIYY.SLTFM.LLA.AEMVT.FCLL.V........F.P.L...PY.TV........R....KKLF.R.............F..L..S.....ES..P......V..V....A..K.VA..Y..G........L..............K..I.SFIF......V..GI.......LF..A................DALQ.R......VF.RVTAEYEATka.............................ehGVHH.D.ARNDSSFAAR.KF.Y.A...QRN.M..YLT..GFCLF.L.SL........VLTRTF.YIIGDLIETQEEYSK-l.....................................................................
M2UGK2_COCH5/1-141                     ..................................................MTLYY.SLVFL.LLV.TEMLI.FCAL.I........V.P.L...PF.TW........R....RRLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSGSddq...........................grsGVAA.G.GIERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEEVKS-l.....................................................................
A0A177D7D0_ALTAL/1-142                 ..................................................MTLYY.SLVFM.LLV.TEMLI.FCAL.I........V.P.L...PF.TW........R....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSGSddn..........................grggNVAA.G.GIERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEEVKT-l.....................................................................
H0X8E2_OTOGA/1-154                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..S..F.....WS..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSAGHILE................................kSSSP.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.VLITQLAKEL------snkgvlktqaentnkaakkfmee...............................................
A0A0T6BFG7_9SCAR/1-47                  .................................................m-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.-----QGSMR.LF.R.A...QRN.F..YIS..GFALF.L.SL........VIRRLV.ILISSQASLLAQSEA-a.....................................................................
W5KA27_ASTMX/1-136                     ..................................................MTLQW.TAVAS.FLY.AEIGI.LVFL.C........L.P.F...IS.AK........R...wQSIF.K.............L..N..M.....WS..S......I..A....R..F.WN..K..G........F..............L..A.MIII......L..IV.......LF..L................DAVR.E......VR.KYSGAEPSK.................................EAKM.T.PNMVDHLHMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........VLRRVI.MLINQLAEVTDTSKA-l.....................................................................
B8N3Y9_ASPFN/1-140                     ..................................................MTLYY.SLVFC.LLV.FEMVI.FMGL.I........V.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEVTNFsr............................enmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVK--il....................................................................
W2PNZ9_PHYPN/1-113                     .................................................m-----.-----.---.-----.----.T........I.P.F...PG.LM........L...nRGIV.K.............FgdF..V.....FN..I......R..I....G..T.LS..V..F........S..............V..I.TFIS......F..VV.......LV..A................QTYD.L......QK.RYSLPSDPH.................................-LEV.H.YSADLQKKAS.RW.R.S...ERN.W..WIS..ALTFT.I.YW........MLLRFH.AMKKKLLKAQH-----ed....................................................................
A0A226PB28_COLVI/1-92                  ..................................................MSLQW.TVVAM.FLY.AEVFL.VLLL.C........L.P.F...VS.PT........R...wQKIF.K.............S..C..L.....VG..L......V..L....A..Y.GN..T..A........F..............V..V.LIVI......L..VL.......LL..L................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------gegeglmweydqlleqharlqvfqvaac..........................................
A0A059DDW6_EUCGR/1-124                 ...............................................miq-----.-----.LLY.TVIAA.EMAL.I........L.T.L...LF.KT........P...lRKLV.I.............M..A..L.....DR..V......K..R....G..R.GP..V..M........V..............K..T.VGVT......L..LV.......VL..A................SSLY.S......MV.KIQRRTVEA.................................G---.L.LNPTDQVLMS.KH.M.L...E--.A..SLM..GFVLF.L.SL........MLDRLH.HYIRELRLLRKTMEA-a.....................................................................
I1LRP3_SOYBN/1-124                     ................................................ml-----.----Q.LLY.TAIFS.EMLL.I........L.T.L...VF.KT........P...lRKLV.I.............V..S..L.....DS..V......K..R....G..R.GP..V..V........V..............S..T.VGAT......L..MV.......VL..A................SSLY.S......MA.KIQQRTLEA.................................G---.I.VNPTDQVLMS.KH.M.L...E--.A..SLM..GFLLF.L.SL........MIDRLH.HYIRELRSLRKTMEA-i.....................................................................
A0A074X1L3_9PEZI/1-143                 ..................................................MTLYY.SLVFA.LLV.FEMVV.FMSL.I........V.P.M...PF.SW........K....RKLL.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..W........I..............K..I.TFVF......I..LI.......LF..V................DSVN.R......VY.RVQLELATAnknn.........................tgggTAAV.G.GIERMEIQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.GMILEVLRLELENRQ-m.....................................................................
A0A1B8E718_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMGL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......I..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAte............................qsqTGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMIMETLRLETKLKQ-y.....................................................................
A0A023EKI9_AEDAL/1-134                 ..................................................MSLVW.SLIAS.FLY.VEIFI.VLML.V........L.P.V...AS.PQ........R...wQRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLFV......L..VL.......FL..L................EAIR.E......MR.KYSHVDPAA.................................E--Q.H.LNVGMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLI.SLITSQAQLLAQSEA-s.....................................................................
C4JY58_UNCRE/1-142                     ..................................................MTLYY.TLVFL.LLV.LEMAI.FVGL.I........V.P.L...PF.TW........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSAYskd..........................atgaGASA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEILRLEDRVKQ-y.....................................................................
Q6DFC1_XENLA/1-137                     ..................................................MTFQW.TAVAS.FLY.GEVAV.LLIF.C........I.P.F...IS.PL........R...wRKIF.R.............F..K..L.....WS..K......V..S....P..Y.WN..K..A........F..............L..S.IIVV......L..IV.......LF..L................DAAR.E......VR.KYSASQLTD................................kNAKL.Y.PSSYDHIHMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.SLIMQLASE-------iegntai...............................................................
E7LYC0_YEASV/1-83                      ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.-MIF......V..GL.......LF..I................DSWK.R......SQiRVSTYRNQK................................nPYII.N.SVTPVDALAS.RA.Y.N...QRN.V..YIS..GFIIY.F.YI........CILTVM.SILRRIVEWNDKMKA-g.....................................................................
Q0U9D7_PHANO/40-178                    ...............................................llq-----.-RVFL.LLV.TEMLI.FLAL.I........V.P.L...PF.TW........R....RKLF.T.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQVELSGMgnq..........................qgggNASL.G.GIERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEEVKT-f.....................................................................
A0A1Y1IM41_KLENI/4-130                 ..............................................lpsi-----.----V.LLS.LQVVV.SILL.V........I.P.V...PA.VR........R....LGLA.V.............V..G..F.....--..F......H..I....P..R.AA..A..V........V..............R..T.IFGA......L..VV.......FL..L................SSIA.S......IQ.GLLVKAAKA.................................E-AL.N.TGDSLRTESA.LY.S.E...YLQ.A..FIT..GASLL.L.VL........LDHAVY.AAVTEGDKLRV-----shdal.................................................................
G1P2D2_MYOLU/30-165                    ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...yAKIF.F.............K..T..V.....FT..C......I..L....S..Y.GY..T..V........R..............E..L.NPVS......S..LC.......FT..T................DAVR.E......IS.KYDDVTEKV.................................NLQN.N.PGAVEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
T5A6X6_OPHSC/1-142                     ..................................................MTLYY.SLVFL.LLV.FEMGL.FMLL.L........V.P.L...PF.AI........K....RKIF.T.............F..V..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..M................DSVN.R......VY.RVQLELSAAteq..........................tskgSATV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDHLR--tl....................................................................
S7Q8M6_GLOTA/1-138                     ..................................................MTIYY.NLTFL.LLA.AEMGT.FCVL.V........A.P.L...PY.AL........R....RRLF.H.............F..L..S.....ES..P......V..V....A..K.LA..Y..A........L..............K..I.SFIF......V..GI.......LF..V................DALQ.R......MF.RVTAESDVAr..............................qtGQAH.D.VRTETNFAAR.KF.Y.S...QRN.V..YLT..GFTLF.L.SL........VLTRTF.YILLDLIHTQEEYAK-l.....................................................................
H3E114_PRIPA/64-118                    .............................................varta-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.-AADAVVHAH.LF.H.S...ERN.E..YIT..GFSLL.L.FL........VISRIV.KMIHRMSDFERSAE--na....................................................................
H2YK39_CIOSA/1-137                     ..................................................MSIQW.TFVAG.FLY.VEIAL.CILL.C........L.P.F...IS.CK........R...wQSFL.R.............S..R..L.....FA..L......F..I....S..Y.GN..L..Y........F..............L..V.LISI......L..CL.......LF..A................DAVR.E......VR.KYSLPDAQS................................vNLSN.N.PNAQDHVLMM.LF.R.A...QRN.L..YIS..GFALF.L.WL........VLRRLV.LLVSNNATLEAQSEA-f.....................................................................
M5WB52_PRUPE/1-126                     ..................................................MALQW.MILTY.VVA.AEAAL.AFLL.T........L.P.A...PK.LL........K....NQFV.S.............L..V..S.....L-..-......-..-....-..I.LQ..P..A........L..............-..F.IVPF......A..GF.......QL..L................DIYW.K......NE.HRLSCTS--.................................-EIC.T.AAERDRYEKS.IY.K.A...QRN.V..ILC..ASACL.L.YW........CLVRIC.KYYKDIQNLEE-----vekrc.................................................................
A0A1I8HFA2_9PLAT/1-134                 ..................................................MSLQW.TVISW.FVY.AEAAL.VLIM.C........L.P.V...IS.VQ........R...wRRIL.R.............S..R..L.....LR..K......F..D....S..S.AY..V..Y........F..............N..V.FFGL......L..IL.......LL..I................DAYR.K......MR.QHALEELSI.................................DERV.N.PHGFALSRMR.KF.R.S...QIN.F..TLS..AGALL.L.WL........VLKWMV.SSLIGRA---------fleqdls...............................................................
G4T5B1_SERID/1-139                     ..................................................MAIYY.SLTFF.LLA.AEMVG.FVFV.L........L.P.M...PL.AA........R....KRLF.K.............F..L..T.....ES..Y......I..V....G..K.IA..Y..A........L..............K..I.SFIF......V..AI.......LF..V................DAVQ.R......MI.RITAEAEAAkt.............................anAGVN.H.ASAEVNIAAR.KF.Y.A...QRN.T..YLT..GFCLF.L.SL........CMTRTI.QILVHLIRTEEEL---gtl...................................................................
B2AA16_PODAN/1-145                     ..................................................MTLYY.TLVFM.LLV.AEMAL.FMLL.V........V.P.L...PF.TM........R....RRLF.T.............F..I..S.....EN..P......I..V....A..K.VQ..Y..W........L..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELAAAtegnn.......................gqsasRTAI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILETLRLEEKVK--ly....................................................................
F7FI52_CALJA/65-177                    ..................................................MSLQW.TAVAT.FLY.AEVFV.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.S-........------.----------------......................................................................
A0A0R3S0G0_9BILA/357-493               ..................................................MTLQW.FVVAL.ILY.LEIAV.VLLL.L........L.P.W...IR.PT........L...wNKFF.K.............S..R..M.....VK..T......F..E....K..H.AN..V..Y........F..............I..S.ALCV......F..LL.......LF..A................DAIR.E......VR.KYAGEVAIE................................aSIRH.T.ADSENVVHMR.LF.R.A...QRN.L..YIS..GFALL.L.FL........VIKRIV.ALLSRGALLEAAAEA-a.....................................................................
A0A0D0A182_9HOMO/1-139                 ..................................................MTIYY.SLTFL.LLA.AEMVT.FCLL.V........A.P.L...PF.TV........R....KKLF.R.............F..L..S.....ES..P......I..I....A..K.VA..Y..G........L..............K..I.SFIF......V..GI.......LF..L................DALQ.R......MF.RVTAETEMAkt.............................ggQGMH.D.VRTESNFAAR.KF.Y.A...QRN.T..YLT..GFCLF.L.SL........VLTRTF.SIILDLIHTQEEYAK-l.....................................................................
A0A0D9N5P7_ASPFA/1-140                 ..................................................MTLYY.SLVFC.LLV.FEMVI.FMGL.I........V.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEVTNFsr............................enmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVK--il....................................................................
A0A182MYC8_9DIPT/1-135                 ..................................................MTLVW.GIIAS.FLY.VEIFV.VLLL.V........L.P.L...RS.PQ........Q...wHRFF.K.............S..R..F.....LA..M......L..S....R..Q.AQ..T..Y........F..............Y..L.LLAV......L..VL.......FL..L................EAIR.E......MR.KYSSNDHTH.................................-TET.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.SL........VIRRLV.SLISGQAVLLAQAEA-s.....................................................................
M4BK73_HYAAE/1-133                     ..............................................mwss-----.-FTYV.LLP.PAVVL.LLLM.T........I.P.L...PS.LL........L...nRGVV.K.............FgdF..V.....FN..I......R..I....G..T.LS..V..F........S..............V..I.TAIS......F..VV.......LL..A................QTYD.L......QK.RYSMHSDPH.................................-LEV.H.YSADLQKKAS.RW.R.S...ERN.W..WIS..ALTFA.I.YW........MLLRFH.ALKKQLVKVQR-----hed...................................................................
A0A0A2WFT9_BEABA/1-154                 .................................mtlyytlvrlllrwldp-----.-AVFA.LLM.FEMAL.FMFL.I........V.P.L...PH.NA........R....RAIL.T.............F..V..S.....EN..K......T..I....R..Q.IQ..Y..W........L..............K..I.TFVF......I..LV.......LF..V................DSVN.R......VY.RVQMELAESmeqa.........................arggGTVV.L.GHERTEVQAR.KF.Y.A...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIKDIIRLEERVRA-y.....................................................................
A0A093Y564_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMAL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAte............................qsqTGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
S8E699_FOMPI/1-139                     ..................................................MTIYY.SLTFM.LLA.AEMAT.FCIL.V........A.P.L...PY.GI........R....KRLF.R.............F..L..S.....ES..P......I..V....A..K.LA..Y..G........I..............K..I.SFIF......V..GV.......LF..I................DAFQ.R......MV.RVAAESELAkt.............................sgSGVQ.D.VRSETNFAAR.KF.Y.A...QRN.T..YLT..GFTLF.L.SL........VLTRTF.YILLDLINTQEEYAK-l.....................................................................
A0A225UT38_9STRA/1-119                 ............................................masmws-----.SFTYV.LLP.PAVVL.LLLM.T........I.P.F...PG.LM........L...nRGIV.Q.............FgdI..V.....FN..I......R..I....G..T.LS..V..F........S..............V..I.TFVS......F..VV.......LV..A................QTYD.L......QK.RYSLPTDPH.................................-IEA.H.YSADLQKKAT.RW.R.S...ERN.W..WIS..ALT--.-.--........------.----------------ftiywyvg..............................................................
A0A194XVM0_9HELO/1-139                 ..................................................MTLYY.SLVFL.LLV.AEMTL.FMLL.I........I.P.L...PF.TI........R....RKMF.T.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELAESnk.............................qqGAAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEEKVKK-y.....................................................................
A0A183DQX1_9BILA/8-144                 ..................................................MTLQW.FVVAL.ILY.VEIAV.ILLL.L........L.P.W...IR.PT........L...wSKLF.K.............S..R..L.....VK..A......F..E....R..Y.AN..V..Y........F..............I..S.ALCI......L..LL.......LF..A................DAIR.E......VR.KYAAEVAME................................aSIRH.T.ADSENVIHMR.LF.R.A...QRN.L..YIS..GFALL.L.FL........VIKRIV.ALLSRGAQLEAAAEA-a.....................................................................
G1M4K4_AILME/1-139                     ..................................................MTLQW.VAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIVL......L..IV.......LFlvI................DAVR.E......VR.KYSSAPAIE................................kGLTS.R.PGAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.ILITQLAKE-------lsnkgvl...............................................................
A0A010QT85_9PEZI/68-208                ..................................................MTLYY.TLVFM.LLM.AEMGL.FMLL.L........V.P.L...PF.AV........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELAIAten...........................qnsGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVR--gy....................................................................
A0A0C9WEV8_9HOMO/1-138                 ..................................................MTIYY.SLTFL.LLA.AEMAT.FCIL.V........F.P.L...PY.TI........R....KKLF.R.............F..L..A.....ES..P......I..V....A..K.VA..Y..G........L..............K..I.SFIF......V..GI.......LF..L................DALQ.R......MF.RVTAESEMAk..............................tgQGMP.D.VRAESNIAAR.KF.Y.A...QRN.M..YLT..GFCLF.L.SL........VLTRTF.YIILDLIQTQEEYAK-l.....................................................................
G3I7S8_CRIGR/1-157                     ..................................................MTIQW.AAVAS.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..S..V.....WS..K......I..A....S..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSTQVTE................................kSSAG.R.PSAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.SLITQLAKE-------isnkavlkiqaentnkaakkfmeenek...........................................
A0A0A1U4H6_ENTIV/2-125                 .................................................i-SIMY.TLTYG.ISL.VLITT.LTLL.I........I.P.I...PK.VV........K....KQIL.K.............L..T..-.....--..K......A..V....V..K.TK..I..I........S..............I..T.VLVL......V..TL.......LY..A................ESFY.R......MK.RYEAIKDEM.................................PVDT.Q.INTRIANYTE.LF.R.S...QRN.A..YIN..FFNLL.L.VI........ILWRVG.SLVNKLI---------n.....................................................................
A0A164Q5N4_9HOMO/1-124                 ..................................................-----.-----.---.--MVT.FCLV.V........A.P.L...PY.KI........R....KRLF.H.............F..L..S.....ES..P......I..V....G..K.VA..Y..A........L..............K..I.SFIF......V..AI.......LF..I................DALQ.R......MF.RITAEAEMSks.............................ggQAVQ.N.VQTETNIAAR.KF.Y.A...QRN.T..YLT..GFCLF.L.SL........ILTRTF.YIILDLIHTQEEYAK-l.....................................................................
A0A197JWH8_9FUNG/1-135                 ..................................................MSLPY.TMVFT.LLM.TEMLV.FIAL.I........L.P.L...PH.NW........R....RGTL.K.............F..L..S.....QS..P......L..M....G..Q.VQ..H..I........M..............K..I.VFVG......V..FI.......LF..V................DSVN.R......VA.KVEEVSEHS.................................HHHH.D.HMAQSNVAAR.RF.Y.A...QRN.M..YLT..GFTLF.L.SL........ILNRTF.FMILDLLQSEEKMET-i.....................................................................
A0A0E0GBG7_ORYNI/1-126                 ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..VSACL.L.YW........CIFRIC.KYNKDIKALEET----ekrl..................................................................
A0A024U3L0_9STRA/1-133                 ..................................................MTMWA.TWAYV.LLP.PAVVL.LLLL.T........I.P.F...PK.FI........A....KGIV.R.............M..N..E.....FL..F......S..L....E..L.GG..I..P........I..............I..-.-SII......T..FF.......AF..I................ALAG.Q......TY.DLQKRYTKTi...............................pGIEK.H.YEADLQQKAS.RW.R.S...ERN.W..WIS..ALTFT.I.YW........MLMAFQ.SMKKQLL---------avnrrad...............................................................
A0A0Q3T2C8_AMAAE/1-137                 ..................................................MTFQW.TAVAT.ILY.GEIGV.ILVL.C........L.P.F...IS.PL........R...wQKIF.M.............I..P..L.....WS..K......V..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSAVHVNE................................kAANV.N.SSAFDHIQMK.LF.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTI.TLLNQLAKEMASHAA-l.....................................................................
A0A1J9P598_9EURO/1-142                 ..................................................MTLYY.SLVFL.LLV.VEMVI.FVAL.I........I.P.L...PF.TL........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELSSYskd..........................mggpGAAA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDRVKQ-l.....................................................................
G8BDU9_CANPC/1-139                     ..................................................MALYY.NLVFA.LLV.IEMAF.FAVL.S........M.P.Y...PR.PV........R....RTIL.V.............T..V..S.....AP..F......K..N....E..Q.FQ..I..A........L..............K..C.VLGF......V..FV.......LF..I................DSVN.R......VY.AVTSELTSAtq.............................shPGTS.V.MNDRSEIQAR.RF.Y.A...QRN.M..YLC..GFTLF.L.TL........ILTRTY.NLVVELISTKDKVDS-l.....................................................................
G8JQ35_ERECY/1-135                     ..................................................MSVYL.SLLFG.FLV.MEMVV.LFIL.V........M.P.L...PH.LL........R....RVIV.V.............N..S..E.....KL..L......R..T....S..E.LK..T..A........V..............W..I.SYAL......I..GL.......LF..L................DSWK.R......VS.QAEKHYEDG.................................FGDR.M.MESSMQNFVT.KT.Y.N...QRN.L..YIT..GFILY.F.SI........CIPTVL.KVIESLSKHEQLL---keg...................................................................
A0A226MZA7_CALSU/8-98                  .........................................ltgfcvrcv-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.-TEN......N..LF.......LF..T................DAVR.E......VR.KYSAIQVNE................................kVANV.N.ANAIDHIQMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRTV.TLLTQLAKTMASHAA-l.....................................................................
A0A2A2JH74_9BILA/12-149                ..................................................MTLQW.SIVAG.ILY.SEIAI.TFIL.L........L.P.W...IR.PS........L...wSKFF.K.............S..R..A.....VN..A......I..E....S..H.GR..V..F........F..............F..S.FAIV......L..FV.......LF..A................DAIR.E......VN.KYSHVDLSLe...............................gSVRH.T.ADADAMIHMR.LF.R.A...QRN.F..YIA..GFALL.L.LL........VIKRII.SLISRSAQLEAASEA-a.....................................................................
H2UXB9_TAKRU/1-136                     ..................................................MTLQW.TAVAT.FLY.LEIGV.LVIL.C........L.P.F...IS.AR........R...wRSIF.H.............L..R..I.....WG..S......L..A....Q..F.WN..K..V........F..............L..T.MIII......L..IV.......LF..L................DAIR.E......VR.KYSVRDAGT.................................AAKM.Q.PNMYDHLHMK.LF.R.A...QRN.L..YIS..GFAVF.L.WL........VMKRVV.TLINQLAAASASTAA-f.....................................................................
E7Q650_YEASB/1-126                     ..................................................-----.-----.---.--MVM.LFIF.V........L.P.L...PF.RI........R....RGIF.S.............T..Y..N.....QL..T......A..K....Q..Q.IK..T..I........I..............F..I.TGCL......V..GL.......LF..I................DSWK.R......SQiRVSLYHNDNs...............................gSIGS.S.AVTPIQALAS.RA.Y.N...QRN.M..YIS..GFILY.F.SI........CIPTVM.SIVKRLVKYQG-----lineqekq..............................................................
Q2UL88_ASPOR/1-140                     ..................................................MTLYY.SLVFC.LLV.FEMVI.FMGL.I........V.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEVTNFsr............................enmGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVK--il....................................................................
I1CBN1_RHIO9/23-116                    .................................................v-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..M....A..N.VM..Y..T........F..............K..I.VFGF......I..FI.......LF..V................DTIN.R......LQ.RIESEARVE................................qEHHH.D.HEYEISLKTK.KF.Y.S...QRN.L..YLT..GFTLF.L.SV........ILERTS.ALVLELVKREEELKH-a.....................................................................
M3YAP8_MUSPF/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....T..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IQ.KYDDVTEKV.................................NLQN.N.PGAVEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
W3X555_PESFW/6-144                     ................................................ni----Y.NQVFL.LLV.TEMAL.FMLL.V........L.P.M...PF.SV........R....RKIF.T.............F..I..S.....EN..P......I..I....A..K.LQ..H..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAQAtns...........................ekgSAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEEKLKQ-y.....................................................................
A0A091HVD3_CALAN/81-119                ...............................................kta-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...-KN.L..YLS..GFSLF.L.WL........VLRRTV.TLLTQLAKGMTSHA--al....................................................................
R0M124_NOSB1/1-119                     ..................................................MGITT.QLVQS.ILY.AEMSL.FTLL.I........L.P.L...PN.YV........S....RMFI.S.............M..F..H.....ES..Q......F..S....R..P.FA..H..I........L..............W..V.LYIM......I..FI.......LF..I................DSIY.R......QY.NTIED----.................................----.-.-------RIL.AY.Y.T...ERN.F..YLT..GFTLY.L.AL........IFKMFT.TMLIKLYKEEQSA---kil...................................................................
F7HK98_MACMU/1-110                     ................................................ia-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................rSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snksvlktqaentnkaakkfme................................................
S2J4N8_MUCC1/1-143                     ..................................................MALYY.GIVFG.ILT.FEIIL.FFLF.L........L.P.I...PT.RW........Q....KPVF.R.............W..L..A.....TS..P......T..I....A..H.AQ..Y..I........M..............K..I.VFVF......I..FV.......LF..L................DSVN.T......LR.AFYEVVNTEdeng.........................gipaAGNS.D.FRAQVGQAAK.KF.Y.A...QRN.L..YLT..GFTIL.L.LL........ILNKIK.NMAMDYIRLEDQF---iel...................................................................
Q6CIG6_KLULA/1-136                     ..................................................MSIYF.SVLFI.LLV.AQMAF.MFMI.V........M.P.L...HY.QI........R....KRLV.V.............F..S..D.....NF..L......S..G....P..Q.FR..T..V........V..............A..I.LSCL......V..ML.......LF..I................DSWK.R......AQ.LPVFSHAEK.................................P--Q.D.VASSLKTLTT.RA.Y.N...QRN.V..YIS..GFILY.F.TI........CIPVLL.NLLTRLVKYETLIR--elnsv.................................................................
A0A094AAR1_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMAL.FGLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAte............................qsqSGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
A0A0V0UXM9_9BILA/209-327               ..............................laasvsksfftfysdvfivi-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..H.....LL..F......C..V....N..V.AS..T..V........F..............G..L.LFTR......LneMM.......IL..L................DALR.E......VR.KYSDADLVK.................................QSVG.N.VQGEFNTHMR.LF.R.A...QRN.L..YIS..GAALF.L.WF........AIQRVA.SMISREAMLIASAEA-a.....................................................................
A0A2G9HW43_9LAMI/1-128                 ..................................................MALEW.VVLSY.VAA.AEATM.VLLL.T........L.P.A...GL.NP........L....RKGV.I.............S..V..T.....RN..L......L..K....P..F.LS..V..V........-..............-..-.--PF......C..VF.......LM..V................DIYW.K......YD.SRPRCKS--.................................AESC.S.PTELMRHQKS.TI.K.S...QRN.A..LLI..GAALM.L.YW........MLFAVT.RLAVKEEQLNERVE--rl....................................................................
J3LLU6_ORYBR/1-126                     ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.F-..-..-........-..............A..G.ILPF......A..AF.......QL..L................DIYW.K......QE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..VSACL.L.YW........CIFRIC.KYNKDIKALEET----ekrl..................................................................
W2PRW0_PHYPN/1-126                     ..............................................mlln-----.QLMFW.LMI.SEAII.CLLL.S........L.P.F...GQ.WI........A....HAVI.T.............F..L..A.....KT..L......K..D....T..P.AN..T..V........A..............T..V.VLSI......I..SL.......LF..I................SDVM.T......VY.KHSSSDEVL.................................----.-.---GDGMRIR.LL.T.A...QRD.M..YIT..GFCLF.L.FL........LLRLVY.ITLATNLRLEKSL---gam...................................................................
A0A0K0DKX3_ANGCA/165-285               ...........................................hpslavd-----.-----.---.-----.----.-........-.-.S...PY.VV........R...wSKLF.K.............S..R..L.....VS..S......L..A....A..H.GQ..I..Y........S..............Y..S.AAFV......L..FV.......LF..A................DSVR.E......VK.KYSHVEVAMe..............................ssVIHR.V.ADTDAIIHMR.LF.R.A...QRN.F..YIS..GFALL.L.FL........VIKRIM.GLISRGAQLEAASEA-a.....................................................................
A0A151W2Z6_HYPMA/1-139                 ..................................................MTIYY.SLTFM.LLA.AEMVT.FCLL.V........A.P.L...PY.KI........R....KKLF.T.............F..L..S.....ES..P......I..V....A..K.VA..Y..G........L..............K..I.SFIF......V..AI.......LF..A................DALQ.R......MF.RVTAEAELAks.............................ghQGVS.D.VRTETNLAAR.KF.Y.S...QRN.T..YLT..GFTLF.L.SL........VLTRTF.YIILDLIHTQEEYAK-l.....................................................................
A0A226MXC1_CALSU/1-69                  ..................................................MSLQW.TVVAM.FMY.TEVFL.VLLL.C........L.P.F...MS.PT........R...wQRIF.K.............S..C..L.....VG..L......A..L....A..Y.DN..T..A........F..............V..V.LIVI......L..VL.......LL..L................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------ggalh.................................................................
A0A0P1ACX9_9STRA/1052-1163             ...................................qllvlvhdsvfaqql-----.-----.---.-----.----.-........-.-.-...--.--........S....AAIK.S.............A..L..I.....LQ..V......A..D....S..L.TN..L..V........A..............T..V.VLAI......V..SI.......LF..V................SDVS.T......VY.KHHASDEVL.................................----.-.---SDGMRIR.LL.T.A...QRD.M..YIT..GFCLF.L.FL........LLRLVY.TTLVTNLHMEKNL---iam...................................................................
A9S3H1_PHYPA/1-126                     ..................................................MALEW.AALGA.VTA.AEALI.LLLL.T........M.P.G...LT.GI........R....KGLI.S.............V..A..-.....--..-......-..-....-..-.-R..S..A........L..............R..P.LLAV......V..PL.......AL..F................LALE.I......YW.KFDHMPECK.................................GPQC.D.PLQRDRAAKS.LM.K.S...QRN.A..ILV..GGALL.L.YW........VLYRVT.AMMVRMEQLSTQLKK-m.....................................................................
A0A0D3BBW1_BRAOL/1-126                 ..................................................MALQW.LILSY.VVA.AEVVI.AVIL.T........L.P.Y...PM.LL........K....KRIV.S.............L..V..S.....LI..L......Q..-....-..P.AA..S..I........-..............-..-.-VAF......A..GF.......QL..L................DLYW.K......N-.--EHRLMCS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AAGIL.L.YW........CIFRIC.KYNKDLEHLEE-----lekrc.................................................................
B3M8E5_DROAN/1-134                     ..................................................MSLVW.TLIAG.FLY.AEIAL.VLLL.V........L.P.V...AS.PY........R...wNRLF.K.............S..K..F.....LA..M......L..A....Q..Q.AH..I..Y........F..............F..L.IMGV......L..VL.......FL..L................EAIR.E......MR.KYSHFEQAG.................................--EV.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFSIF.L.VL........VIRRLV.TLVSAQANLLAQSEA-s.....................................................................
A0A1B8FHH7_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMGL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAte............................qsqTGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
A0A0D2PC52_9AGAR/1-140                 ..................................................MTIYY.SLTFM.LLA.SEMVT.FCLL.V........A.P.L...PY.SL........K....KRLF.T.............F..L..T.....ES..K......I..V....A..K.VA..Y..G........L..............K..I.SFIF......V..AI.......LF..A................DALQ.R......MF.RVTAESDLArh............................nkqGMLS.D.IRTDTGIAAR.KF.Y.A...QRN.V..YLT..GFCLF.L.SL........VLTRTF.YIILDLIHTQEEYAK-l.....................................................................
K3WFP5_PYTUL/1-128                     ..............................................mlln----Y.-VLFW.MMV.AEAMI.CLVI.S........L.P.F...GQ.KI........S....QKII.Q.............F..L..T.....SR..Lg....gK..D....S..N.AS..M..A........V..............T..I.ILAL......V..SI.......LF..L................SDVS.T......VY.KHHSRDTVL.................................----.-.---SDGMRIR.LL.A.A...QRD.M..YIS..GFCLF.L.FL........LLRLVY.TSMDKNIRLEKSL---gam...................................................................
H2XTD6_CIOIN/1-137                     ..................................................MSIQW.TFVAG.FLY.AEIVV.CILL.C........L.P.F...VS.SK........R...wQSIL.R.............S..R..L.....FA..L......F..V....S..Y.GN..I..Y........F..............M..V.LISI......L..CL.......LF..A................DAVR.E......VR.KYSLPDAQQ................................vNLSN.N.PNAQDHVLMM.LF.R.A...QRN.L..YIS..GFALF.L.WL........VLRRLV.LLISNSATLEIQGEA-f.....................................................................
K7G584_PELSI/1-136                     ..................................................MTFQW.TAVAT.FLY.TEIGV.ILLL.C........I.P.F...IS.PL........R...wQKIF.T.............I..P..L.....WN..K......I..A....N..Y.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAIR.E......VK.KYSTAHVGE................................kGANI.N.PNAFDHIQMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRTV.TLITQLAKE-------mgiqva................................................................
H0EVL4_GLAL7/1-50                      ..................................................MTLYY.SLVFV.LLV.AEMAL.FMLL.I........V.P.L...PF.TI........R....RRMF.T.............F..I..V.....NR..V......Y..R....V..Q.V-..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------ela...................................................................
A0A139AL23_GONPR/2-131                 .................................................a-SLFL.TLEAG.TFY.VLVAF.YLLL.A........I.P.I...FR.RQ........K....SNLV.Q.............S..I..N.....LP..T......F..A....-..-.-L..T..L........F..............G..V.IGAV......T..GI.......IF..L................DAIR.I......IY.EEPADSGDV.................................G---.S.KLMPLNERLR.YV.R.A...QRD.Y..WLS..LSCMV.M.GV........VINLTL.LNLRDYASVKTALK--ktk...................................................................
C1GHQ7_PARBD/1-127                     ..................................................-----.-----.---.--MVI.FVGL.I........I.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......L..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQMELSSYske..........................lggaGTAA.L.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEDKVK--ly....................................................................
A0A0L0HNI7_SPIPN/7-73                  ...................................slagattgspidass-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.H.IANLNDLYTA.RF.R.G...QRD.F..YIL..AFTLF.C.ST........VLYQLH.MLLIKMDKY-------rlqrnel...............................................................
A0A0R3WN21_HYDTA/1-34                  ..................................................MSLLW.TITAT.FLY.TEAAV.ITLL.L........M.P.F...IS.SK........M....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------qvr...................................................................
A0A1Y1Y7V1_9FUNG/1-134                 ..................................................MVLYY.SIVFG.LLI.FEMTL.FGLM.V........F.P.F...PK.KW........K....RAAL.M.............K..I..D.....ES..G......I..I....R..R.NQ..Y..I........I..............N..I.VGFF......V..FI.......LF..I................DSVN.R......MI.RATEEVNQA.................................N-LA.D.PRTDTQLHVK.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........IINRTF.AILMDLFYVQEELEK-f.....................................................................
H2V2U3_TAKRU/1-136                     ..................................................MTLQW.TVVAF.FLY.AEIGL.NLIL.C........I.P.F...IS.AK........R...wRLVF.N.............W..R..I.....WK..L......L..S....P..Y.WN..K..C........F..............F..T.MILV......L..IV.......LL..L................DAVR.E......VD.KYSRPEPLQ.................................DAKA.N.PSVYDHVHMK.LF.R.A...QRN.L..YIS..GFSLF.L.WL........IMRRIF.SLLNQIAVTLEDN---tsl...................................................................
A0A075A7C2_9TREM/67-204                ................................................im---LW.HLTAA.FLY.LEMFS.VFLL.I........I.P.L...FS.SR........S...wAKFF.K.............T..G..W.....VQ..K......L..A....A..F.ST..Y..Y........F..............N..F.FLVL......L..GL.......VL..L................EALR.Q......VM.NQRSAYETLk..............................shPSEL.R.PETESLYLMR.MF.R.A...QRN.L..YIA..GFALF.M.WF........VFRRLI.RLISEHAQMSASQEA-s.....................................................................
C6T197_SOYBN/1-126                     ..................................................MGLQW.LILTY.VVA.TEAAV.AILL.T........L.P.T...PK.LL........R....NRFA.S.............L..V..S.....L-..-......I..L....Q..P.AL..F..I........V..............P..F.AGFH......L..LD.......LY..W................KNEH.R......LM.CTSEV----.................................---C.T.AAERDRYEKS.IY.K.A...QRN.V..ILC..VTACL.L.YW........SISRIC.KYQKEIQSLEE-----vekri.................................................................
A0A091DMG0_FUKDA/1-136                 ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PR........R...wHKIF.K.............S..R..V.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LL..L................DAYR.E......TC.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A167N0B4_9PEZI/1-141                 ..................................................MTLYY.TLVFV.LLM.AEMGL.FVLL.I........V.P.L...PF.SI........K....RKMF.T.............F..L..S.....EN..P......V..V....A..K.IQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAATads...........................gsaGAAI.L.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEEKLRA-y.....................................................................
V9DZ47_PHYPR/1-113                     .................................................m-----.-----.---.-----.----.T........I.P.F...PG.LM........L...nRGIV.K.............FgdF..V.....FN..I......R..I....G..T.LS..V..F........S..............V..I.TFIS......F..VV.......LV..A................QTYD.L......QK.RYSLPSDPH.................................-LEV.H.YSADLQKKAS.RW.R.S...ERN.W..WIS..ALTFT.I.YW........MLLRFH.AMKKKLLKAQH-----ed....................................................................
A0A080WNZ6_TRIRC/1-124                 ..................................................-----.-----.---.--MAI.FVGL.I........V.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELTGFda.............................anSGHA.I.GTERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDILRLEDKVK--my....................................................................
A0A1U7S6M1_ALLSI/1-101                 ...............................................mip-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..L.....WN..K......I..A....I..Y.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAIR.E......VK.KYSAAHATE................................kVASV.H.QNAFDHIQMK.LF.R.S...QRN.L..YIS..GFSLF.L.WL........VLRRTI.TLITQLAKE-------mgiqval...............................................................
L1J661_GUITH/1-128                     .................................................m----Y.ALYSY.MLF.GECAV.CAVL.M........A.L.S...FA.PS........F...iKRPM.K.............S..A..I.....QS..V......Q..V....P..F.SR..E..I........I..............V..G.FGVI......L..VA.......AF..A................DSYL.K......AT.KHRHPHTDG.................................----.-.WKDKMEHQNK.RL.R.A...ERN.I..YIS..FGCMF.I.FL........VVCQLW.SLIKRVTELEEKVA--rd....................................................................
A0A0N0DHQ3_FUSLA/1-144                 ..................................................MTLYY.TLVFM.LLV.FEMGL.FMLL.I........F.P.M...PF.NV........K....RKIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQLELAAAseqa........................khgggGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIIEVMRLEDKVRS-y.....................................................................
A0A1U8L1P0_GOSHI/1-126                 ..................................................MALQW.MILTY.VVA.AEAAL.ALLL.T........L.P.S...PK.LL........K....NRLV.S.............L..I..S.....L-..-......-..-....-..I.LQ..P..A........L..............-..F.IVPF......A..GF.......QL..L................DIYW.K......NE.HRLMCTSE-.................................--IC.T.AAERDRYEKS.FY.K.S...QRN.V..ILC..VTACL.L.YW........CIQRIC.KYNKEIQSLEE-----iekry.................................................................
A0A1W0E2B9_9MICR/69-117                ............................................mnites-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.-------KLL.EY.Q.S...QRN.M..YLC..AFAIF.L.YF........NLRRLV.TILDKNFSSAK-----dnty..................................................................
A0A0S7E0Z9_9EURO/1-143                 ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........I.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFtkdg.........................ngmgRAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDRVKH-l.....................................................................
A0A2K5MXD9_CERAT/1-137                 ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................rSSTS.R.PDAYEHTQMK.LF.R.K...KKK.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A0M9FRG1_9TRYP/3-130                 .........................................sfialeinv-----.-----.VMI.PVLAL.FLLF.C........V.P.V...TA.VS........K...iAERL.T.............R..V..I.....ES..R......S..L....N..G.LT..A..M........S..............A..M.AIIS......S..FA.......FL..F................HFLE.W......HS.KYETKEKF-.................................---V.D.ISLQLQHDNK.RL.R.L...ERN.M..YIQ..LTTCV.L.CL........AVKKCA.TLLHQR----------deqatpv...............................................................
W7X7M6_TETTS/1-138                     ...................................miltklvyligiaqt-----.-----.---.--FYF.FLLL.L........V.P.F...NV.TI........R....KIVL.S.............I..L..F.....HN..K......F..S....D..T.FK..K..I........S..............F..G.FLVS......V..FV.......IC..L................HSMT.Q......IN.EFQNFLIQEq..............................nsDHQD.I.HNIEQQTRVN.FN.K.N...VKY.F..YLT..FYVLT.V.NL........CIYGYT.FYLKKLDELEDKIK--ti....................................................................
A0A1E3IA53_9TREE/1-113                 .................................................m-----.-----.---.-----.----.-........-.-.-...PF.AI........R....KKMF.H.............F..L..S.....EN..P......I..V....A..K.IQ..Y..G........L..............K..I.TFIF......V..AV.......LF..V................DALQ.R......MI.RIAQEGATAk..............................mkQDMS.D.VRTETNYAAR.RF.Y.A...QRN.L..YLT..GATLF.L.SL........LLARVF.YIILDFIHVQENYTS-l.....................................................................
A0A0D9P079_METAN/1-141                 ..................................................MTLYY.SLVFF.LLV.LEMVL.FMLL.L........I.P.L...PH.TA........K....RKVF.T.............F..I..S.....EN..P......I..I....S..K.VM..Y..W........L..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLEVVAAgeq...........................askGAAI.L.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIIDNIKLEDKVQA-f.....................................................................
M3ZBY1_NOMLE/1-137                     ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................kSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKELS-----nkdvl.................................................................
A0A2I4AZ84_9TELE/1-136                 ..................................................MTLQW.TAVAT.FLY.VEIGI.IVIL.C........L.P.F...IS.AR........R...wQSIF.N.............L..R..I.....WN..W......M..A....R..F.WN..K..C........F..............L..T.MIII......L..VV.......LF..L................DAVR.E......VR.KYSNKEITP.................................DSKL.Q.PNIFDHLHMK.LF.R.A...QRN.L..YIS..GFAVF.L.WL........VMKRLI.TLINQLASVSEM----tvaf..................................................................
H0VCJ0_CAVPO/1-136                     ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....S..Y.GN..T..F........F..............V..V.LIII......L..VL.......LL..L................DAFR.E......TR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A2H2ZSW8_9HYPO/1-143                 ..................................................MTLYY.TLVFG.LLM.AEMAL.FMLL.L........V.P.L...PF.SA........K....RKIF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..W........M..............K..I.TFFF......I..LI.......LF..V................DSLN.R......VY.RVQLEVMAAheha.........................vkgnAAAV.M.GSERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKLRA-y.....................................................................
A0A2B7WYQ6_9EURO/1-142                 ..................................................MTLYY.SLVFL.LLV.VEMVI.FVGL.I........I.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......V..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQTELSSYske..........................mgstGTAA.L.GPERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVKQ-l.....................................................................
A0A2I3MV91_PAPAN/1-137                 ..................................................MTLQW.AAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................rSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
G5EBI0_CAEEL/1-134                     ..................................................MTLQW.TIVAG.VLY.AEIAI.TFTL.L........L.P.W...IR.PT........L...wSKLF.K.............S..R..L.....FT..A......L..A....K..H.AH..I..Y........S..............I..T.FGFV......L..FI.......LF..A................DGVR.E......TM.KYNGLEGQM.................................G--R.T.AESDATHHMR.LF.R.A...QRN.L..YIS..GFALL.L.WL........VIQRIM.TLLGRAAQLEAASEA-a.....................................................................
A0A1L9N6Q8_ASPTU/1-146                 ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........I.P.L...PF.TV........K....RKLF.A.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFgkegg......................tmgfrhRAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEDRVR--ll....................................................................
E2RRL9_CANLF/1-139                     ..................................................MTLQW.VAVAT.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........R...wQKIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LFlvI................DAVR.E......VR.KYSSIPAIE................................kGLTT.R.PGAYEHAQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snkgvl................................................................
A0A087RKP7_APTFO/1-78                  .................................................l-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..-F.......LF..A................DAVR.E......VK.KYSAVHVNE................................kAANV.N.ANAFDHIQMK.LF.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTV.TLLTQLAKGMASHAA-l.....................................................................
F7FAT9_MONDO/1-135                     ..................................................MSLQW.AAVAT.FFY.AEILA.AVLL.C........S.P.F...IS.PQ........K...wLKIF.R.............S..R..L.....VR..Q......V..V....N..R.GK..P..Y........F..............S..V.LLLI......L..VL.......LF..M................DALW.E......MR.KFDSSEKKG.................................-LRN.N.TVALEQYHMK.LY.R.A...QWN.L..HLT..SFSLL.M.SL........LLRRLV.TLQSQQALLQASREA-l.....................................................................
A0A1L9VUP1_ASPGL/1-142                 ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........I.P.L...PF.TI........K....RKLF.T.............F..I..S.....ES..P......V..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELSSFske..........................ggamGAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILELLRLEDKVKH-l.....................................................................
A0A2A4JIK1_HELVI/1-134                 ..................................................MSIQW.TFIAG.YLY.FEVAV.VIIM.I........L.P.I...FS.PR........R...wNQFF.K.............S..R..L.....FA..M......F..R....E..H.AA..I..Y........F..............Y..V.LLGV......L..CL.......FL..F................DAIR.E......MR.KYSHSMDGA.................................N--V.H.LQSEMKNSVK.LF.R.A...QRN.F..YIT..GFAIF.L.SF........VIRRLV.TMLIIQDELSKKAEK-i.....................................................................
A0A1E5R9D0_9ASCO/1-131                 ..................................................MAVYL.SILFG.LLV.LQVVT.LVVL.S........L.P.L...PT.LL........R....KAIV.K.............L..Y.dQ.....FL..Y......K..S....S..Q.VK..T..I........L..............L..V.VNIL......V..IS.......LF..V................DSYK.R......AS.VP---LPKT.................................--EN.G.LMLQPEILAT.KA.Y.H...QRN.V..YIS..GFILY.S.MI........VIPIML.GLITRVTKLSSEI---sty...................................................................
A0A093P162_PYGAD/1-138                 ..................................................MTFQW.MAVAT.FLY.GEIGV.ILVL.C........L.P.F...VS.PL........R...wQKIF.M.............I..P..L.....WS..R......M..A....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VK.KYSAVHVNG................................kAANV.N.TNAFDHIXXXxXX.X.X...QRN.L..YLS..GFSLF.L.WL........VLRRTV.TLLTQLAKGMASHA--al....................................................................
A0A0L7R1B6_9HYME/1-135                 ..................................................MTLQW.TLIAG.FLY.AEIVI.VLLL.I........L.P.I...IS.AT........R...wQKVF.K.............S..R..F.....LQ..G......L..G....N..Q.AS..F..Y........F..............L..V.LLAV......L..VI.......FL..L................DAIR.E......IR.KYSTVGKYA.................................-AHA.P.LDSEVQGNMR.LF.R.A...QRN.L..YIS..GFALF.L.SF........IIKRLV.ILISAQATLLAQSEA-a.....................................................................
A0A151IT42_9HYME/1-136                 ..................................................MSLQW.TLIAG.FLY.IEVAI.VLLL.V........L.P.V...AS.PT........R...wQKFF.K.............S..R..F.....LQ..S......L..N....N..Q.AS..I..Y........F..............V..V.LLGV......L..VL.......FL..L................DAIR.E......MR.KYSTSLDHT.................................DHHH.Q.LNVEMQENMR.LF.R.A...QRN.F..YIS..GFALF.L.SL........VIRRLV.ILISAQASLLAQNEA-a.....................................................................
S7XH23_SPRLO/1-72                      ..................................................MSLAT.KSIQL.TLF.SEILL.FSLL.L........I.P.F...PI.KI........R....NKLI.F.............Y..L..T.....LS..K......A..L....-..-.FQ..I..I........C..............G..I.QL-M......V..LF.......TF..M................DSLY.K......I-.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------ttdyys................................................................
A0A1D6JVL3_MAIZE/1-142                 ..................................................MALQW.MILAC.VVA.VEAAV.AALV.T........L.P.V...PR.AV........R....GQIV.A.............L..T..S.....L-..-......F..L....Q..P.LS..S..V........I..............P..F.AAFQ......I..LD.......LY..W................KKEH.R......LM.CTSEICTAEerir........................feksvTFPD.L.SSMFLDFVLF.MF.K.A...QRN.V..ILC..VSACL.L.YW........CIYRIV.KLNKDIKALEETE---krl...................................................................
A0A225UGY0_9STRA/1-128                 ..............................................mlln-----.HLMFW.MMI.TEALI.CLVL.S........L.P.F...GQ.WL........S....HAVI.S.............F..L..M.....KN..Lg....gK..D....S..P.AN..T..V........A..............T..V.VLAI......V..SI.......LF..L................SDVS.T......VY.KHSSSDEVL.................................----.-.---SDGMRIR.LL.T.A...QRD.M..YIT..GFCLF.L.FL........LLRLVY.IALATNLRLEKSL---gam...................................................................
R8BGV1_TOGMI/1-142                     ..................................................MTLYY.TLVFL.LLV.AEMAL.FMLL.I........V.P.L...PF.SV........R....RKMF.T.............F..I..S.....EN..R......Y..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAses..........................ngknAPAI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMILEVLRLEEKIKQ-y.....................................................................
A0A183BL87_GLOPA/1-100                 ..................................................MTLQW.TVIAF.VLY.SEIAT.IVVL.L........L.P.W...IR.PT........M...wKKVF.N.............S..R..I.....LH..K......L..K....Q..F.ST..V..Y........S..............Y..S.FIFV......L..IL.......LF..I................DATR.E......VR.KYSHVDASK................................eLTGR.V.AEADAVIHMR.LF.-.-...---.-..---..-----.-.--........------.----------------si....................................................................
W0TBF3_KLUMD/1-151                     ..................................................MSIYF.SSLFV.LLV.AEMSI.MFVL.V........M.P.L...HY.QV........R....KRIV.A.............T..S..D.....KF..L......G..S....S..Q.VR..T..V........I..............A..I.VSCL......V..LL.......LF..V................DSWK.R......AS.VPVSSQSYSpshghghg.................lgsasglaSHDP.A.ATTSTRSLAS.RA.Y.N...QRN.V..YIS..GFILY.F.TL........CIPVLL.NLLSRLVKYETLLR--el....................................................................
G7XIC9_ASPKW/1-146                     ..................................................MTLYY.SLVFC.LLV.FEMAV.FMGL.I........I.P.L...PF.TV........K....RKLF.A.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELASFgkegg......................tmgfrhRAAA.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEDRVR--ll....................................................................
A0A1D2VQH6_9ASCO/1-135                 ..................................................MSLYY.TMVFA.ILV.TEMVL.FASL.S........L.P.L...PS.KL........R....RPLL.K.............T..I..S.....QP..F......Q..S....K..Q.FK..V..V........M..............R..C.ILAF......I..LL.......LF..V................DAWN.K......LS.AIDQELKLS.................................ESIV.A.GTPRSEIQAK.KF.Y.A...QRN.L..YLC..GFSLF.L.TL........ILNRTY.SLVAELILTKDKLRA-k.....................................................................
A0A0F9WFT3_9MICR/1-74                  ..................................................MGITT.RLVQS.VLY.SEMVL.FTLL.I........I.P.L...PK.KC........K....KAVI.N.............T..L..F.....TS..R......V..F....R..P.LI..H..L........L..............Y..V.VYAM......I..LI.......MF..I................DAVL.K......L-.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------nmnip.................................................................
A0A0L9VIJ3_PHAAN/1-126                 ..................................................MALQW.LILTY.VVA.AEAAV.AILL.T........L.P.T...PK.LL........R....NRFA.S.............L..V..S.....LI..-......-..-....-..-.LQ..P..A........L..............-..F.IVPF......A..GF.......HL..L................DIYW.K......NE.HRLMCT---.................................SEVC.T.AAERDRYEKS.IY.K.A...QRN.V..ILC..ITSIL.L.YW........SISRIC.KYQKDVESMEE-----vekry.................................................................
W5DX55_WHEAT/1-126                     ..................................................MGLQW.MLLTC.VVG.AEAAV.AALL.T........L.P.A...PR.AV........R....AQIV.G.............L..T..S.....M-..-......L..L....Q..P.--..-..-........F..............A..A.VLPF......A..AF.......QL..L................DIYW.K......NE.---HRLICT.................................GEMC.T.SEERVRFEKS.IF.K.S...QRN.V..ILC..VSVFI.L.YW........SIYRIC.KFNKDIKALE------evekri................................................................
A0A1E3NED0_9ASCO/1-131                 ..................................................MSIQM.TLIFA.LLT.VEFGL.VSVL.L........L.P.L...PP.KV........Q....SLVL.R.............K..Y..D.....EA..I......S..N....S..N.FA..I..V........L..............A..F.TDAL......V..GV.......MF..V................DAFK.N......GF.KLLERGDEI.................................I--E.F.SKNVWDARAK.KF.Y.S...QRN.L..YIL..GAILA.L.QA........CVWFMS.MLLKSTVKNKA-----llg...................................................................
A0A084QGE0_STAC4/1-143                 ..................................................MTLYY.TLVFI.LLM.LEMAL.FMLL.I........V.P.L...PF.TL........K....RRIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQMELIAAteqa.........................knggGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMIIEVMRLEDRVRS-y.....................................................................
A0A2K3E5Z9_CHLRE/1-136                 ..................................................MASSW.KVVVNwLLP.PPLIL.TILL.M........L.P.V...PQ.VV........R....KGLL.A.............F..T..R.....QF..L......F..M....K..L.AG..Q..V........L..............L..V.HVAL......V..IT.......GA..A................FTAS.S......MH.TYHISRTPL.................................PDTL.T.PNQRTAILAK.RW.R.E...ERN.F..WIA..TLTFL.L.WG........LLYRFY.ALAIDHVALRDRVRQ-l.....................................................................
A0A1B0A7H3_GLOPL/1-46                  ..............................................mqrr-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.---------M.RF.K.A...QRS.L..CIS..GFPIF.L.AL........VIRRLV.TLISAQANLLDQNEA-t.....................................................................
A0A2I4EW72_9ROSI/1-126                 ..................................................MALQW.MILTY.IVA.AEAAI.AVLL.T........L.P.S...PK.VV........K....NRLV.S.............L..I..S.....LI..L......-..-....-..-.-Q..P..A........-..............L..F.IVPF......A..GF.......QL..L................DIYW.K......NE.HRLMCTSE-.................................--IC.T.AAERDRYEKS.IY.K.A...QRN.G..VLC..AASIL.L.YW........SMYRIC.KYHKEIQSLEE-----vekry.................................................................
A0A0C3BTV4_9HOMO/1-139                 ..................................................MTIYY.SLTFM.LLA.AEMGT.FCAL.V........A.P.L...PY.AV........R....KRLF.R.............F..L..S.....ES..P......I..V....A..K.IA..Y..G........L..............K..I.SFIF......V..GI.......LF..A................DALQ.R......MF.RVTAEADLGkg.............................rgQGMQ.D.VRTETNFAAR.KF.Y.A...QRN.V..YLT..GFTLF.L.SL........VLTRTF.YIILDLIHTQEEYAK-l.....................................................................
A0A0E0GBG5_ORYNI/1-126                 ..................................................MALQW.MILAC.VVA.AEAAV.AVML.T........L.P.A...PR.AV........R....KQIV.G.............L..T..S.....M-..-......L..L....Q..P.FA..G..-........-..............-..-.ILPF......A..AF.......QL..L................DIYW.K......NE.HRLMCT---.................................SEIC.T.ADERIRFEKS.IF.K.A...QRN.V..ILC..VSACL.L.YW........CIFRIC.KYNKDIKALEET----ekrl..................................................................
R7Z691_CONA1/1-144                     ..................................................MTLYY.SLVFL.ILV.TEMVI.FMSL.I........V.P.L...PF.TW........R....RKLF.T.............F..I..S.....ES..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELAAAaesp........................agrggAAVL.G.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEENK--rm....................................................................
A0A1L8F1N4_XENLA/1-135                 ..................................................MSLQW.TAVAT.FLY.VEVFL.VLLL.C........I.P.F...IS.PT........R...wQKIF.K.............S..R..L.....VQ..L......L..V....S..Y.GN..T..F........F..............L..V.LIVI......L..VL.......LL..L................DAFR.E......IQ.KYGVGELVD.................................-LKN.N.PVAVEHIHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.MLISKQATLLASNEA-f.....................................................................
A0A2B7Z488_9EURO/1-140                 ..................................................MTLYY.SLVFL.LLM.VEMGI.FCAL.I........V.P.L...PF.AV........R....RKLF.T.............F..I..S.....ES..P......A..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELPSYsk............................dagRRSA.V.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILEVLRLEDKVHQ-l.....................................................................
A0A251RQZ4_HELAN/1-126                 ..................................................MALQW.MILTY.VVA.AEAAI.AFLL.T........L.P.S...PK.AL........K....STLV.S.............L..I..S.....LI..L......Q..P....-..-.--..-..-........S..............M..F.IVPF......A..GF.......QL..L................DIYW.-......--.KNEHRLMCS.................................GETC.T.AAERDRYEKS.IF.K.A...QRN.V..ILC..FSACL.L.YW........CIYRVC.KYHKEIQSMEE-----vekry.................................................................
A2DY63_TRIVA/1-133                     .................................................m--LYW.ALVIF.LEL.LAIAG.SVLL.L........I.P.L...PL.KL........R....QKII.D.............L..F..Y.....SK..-......-..-....-..-.-K..Y..W........L..............L..G.LIGL......F..SL.......LF..A................QEFT.E......QA.KYAMRRRQA.................................----.T.NDQSQFYATE.TF.K.H...QRN.M..YIAvlGIVLFgI.VF........ILAKLL.----------------knftveigllqeqlavhqrkeq................................................
A0A1L1RWD3_CHICK/1-74                  ..................................................MSLQW.TVVAT.FLY.AEVFL.VLLL.C........V.P.F...VS.PP........Ge..wQKIF.K.............S..R..L.....VG..L......A..V....A..Y.GN..T..A........F..............V..V.LIVI......L..VL.......LL..L................GAAP.R......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------ltge..................................................................
A0A2I2U2L4_FELCA/1-136                 ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....M..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
A0A194RAD5_PAPMA/1-134                 ..................................................MSLQW.TFIAG.YLY.FEIAV.VIIM.I........L.P.I...FS.PR........R...wHQFF.R.............S..R..L.....FA..M......F..Q....Q..H.AA..L..Y........F..............Y..A.FLGV......L..TL.......FL..M................DAIR.E......MR.KYSNSSEPL.................................P--S.H.LSTEMKGHVK.LF.R.A...QRN.F..YIT..SFAIF.L.AF........VIKRLV.TMLIIQYELEVKAEK-i.....................................................................
A0A1E5RHE2_9ASCO/1-171                 ..................................................MSLYF.AFIYG.LLV.IEMGI.FSIM.I........L.P.M...PN.FL........MgskkHFIR.A.............V..N..F.....VI..Q......G..N....D..T.LK..M..V........S..............K..C.VIIF......I..TI.......FF..L................DCVN.K......LN.KLQMAIQVFstskismgyntpmnqn.innnnnnnmaglvdgmSNEY.M.NLSKNELYKN.KF.Y.S...QRN.L..YLT..GFTLF.L.SL........AILRIS.SIIMDLLNVKDNLN--kh....................................................................
S6EDL2_ZYGB2/1-140                     ..................................................MSLYL.SGLFG.LLT.VEMTI.LFVV.V........L.P.L...PF.VV........R....RKIY.A.............L..Y..Y.....KW..T......S..S....R..K.VM..T..S........I..............Y..I.FAGL......V..SI.......LF..F................DSWR.RaqfkvwLH.HYSREHQEV.................................D-EN.G.SVTPTQALAT.RA.Y.N...QRN.T..YIS..GFILY.F.LV........CIPSVF.TIIRRLIKYQNLIN--kl....................................................................
YETL_DICDI/1-135                       ..................................................MEFLM.TLVFL.VLL.VEIVF.CTFF.M........L.P.V...SM.HL........R....KNVY.N.............K..L..D.....KL..F......G..G....Q..N.AK..I..F........L..............K..V.LALL......V..II.......VF..C................DSIV.N......SY.NINKKLHTP.................................ELTG.A.KFDRQNEYTR.MF.R.Y...QRN.S..YIC..GFCLY.L.FF........LIYRSQ.GIISQLSNVEASKT--ai....................................................................
A0A225A6E6_9EURO/1-147                 ..................................................MTLYY.TLVFL.LLV.FEMVV.FLGL.I........V.P.L...PY.TV........K....RKLF.A.............F..I..S.....ES..P......I..V....A..K.LQ..Y..G........L..............R..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQLEMSAFskdpga.....................glrmnsRAAA.L.GAERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.IMIVEVLRLEDRVK--ll....................................................................
D7L7W4_ARALL/1-126                     ..................................................MALQW.LILSY.VVA.AEVAI.AVIL.T........L.P.Y...PM.LM........K....KRIV.S.............L..V..S.....LI..L......-..N....P..A.AS..I..V........-..............-..-.--AF......A..GF.......QL..L................DIYW.K......NE.---HRLLCS.................................SEVC.T.TTERDRYEKS.IY.K.A...QRN.G..VLC..AAGIL.L.YW........CIFRIC.KYHKDLERLEE-----lekry.................................................................
A0A0G2GRH8_9PEZI/1-143                 ..................................................MTLYY.SMVFM.LLV.AEMVI.FMSL.I........V.P.L...PF.TW........R....RKLF.T.............F..I..S.....ES..A......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAssae.........................kqgrAAVI.G.GPERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEENNS-l.....................................................................
A0A139A7I0_GONPR/1-129                 ..................................................MALHY.DLCFL.LLV.AEMIF.LGLL.L........L.P.W...PN.AA........R....KGIL.K.............A..L..D.....KN..P......V..V....E..T.IS..Q..T........L..............R..V.LFLF......V..LI.......LF..V................DSVR.G......IL.KETPP----.................................--SL.D.PHHTEHHQMQ.KF.A.S...QRN.F..YLT..GFTLF.L.YP........VTSRLV.SLLIQVSLSESNA---etl...................................................................
A0A183CFX0_GLOPA/29-93                 ....................................ptihvdaskeltgr-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.V.AEADAVIHMR.LF.R.A...QRN.L..YLS..GFSLL.L.AL........---RIV.TLLARCAHLELA----aeaamk................................................................
A0A087H1U1_ARAAL/1-126                 ..................................................MALQW.LILSY.VVA.AEAVI.VSLL.T........L.P.Y...PM.LL........K....KRVV.S.............L..F..S.....LI..L......-..-....-..-.-Q..P..A........A..............-..S.IVAF......A..GF.......QL..L................DIYW.K......--.-NEHRLSCS.................................SEVC.T.ATERDRYEKS.IY.K.A...QRN.V..VLC..AGAIL.L.YW........CIYRIC.KYNKDLEVLQAT----ekrl..................................................................
A0A1I7RHS9_BURXY/1-136                 ..................................................MTLQW.TVVAG.ILY.LEIGV.VLTL.L........L.P.W...IR.PH........H...wRKLF.N.............S..R..L.....AS..S......I..S....K..F.AS..V..Y........F..............Y..A.VVAV......L..ML.......LL..L................DAVR.E......VR.KYSDADITT.................................EVRR.A.LESDAMIHMR.LF.R.S...QRN.L..YIS..GFALL.L.FI........IINRLV.TLISRTAALQASADA-a.....................................................................
A0A0A1PB07_9FUNG/1-133                 ..................................................MTIYY.TTTFF.ILV.IEMIV.FCIL.V........L.P.L...PS.RW........R....RALF.K.............F..A..S.....TS..P......L..V....G..K.AL..N..T........L..............R..I.IFGF......I..FV.......LF..I................DAVN.R......LQ.RIEEGEDNH.................................--KH.D.YGYEVGLKAR.KF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.SLIVQMLKREEELE--ya....................................................................
E3N5U9_CAERE/65-198                    ..................................................MTLQW.TIVAG.VLY.AEIAA.TFIL.L........L.P.W...IR.PT........L...wSKLF.K.............S..R..L.....FT..A......L..S....K..H.AH..I..Y........S..............M..T.FGFV......L..FI.......LF..A................DGVR.E......TM.KYNGLEDKM.................................Q--R.T.AESDATHHMR.LF.R.A...QRN.L..YIS..GFSLL.L.WM........VIQRIM.TLLSRAAQLEAASEA-a.....................................................................
A0A1G4KJK0_9SACH/1-136                 ..................................................MTLYY.TFVFG.ILS.LEMVM.FLLL.A........L.P.V...PS.KF........R....KPIT.M.............A..L..I.....RP..F......R..L....T..Q.VQ..V..A........I..............K..C.ILAF......I..LL.......LF..V................DTIN.R......VY.SINADLSQT................................tVAAV.G.VSDRSEVQSR.KF.Y.A...QRN.M..YLT..GITLF.L.TF........TVFRTY.GLVWELLELKEQYRS-s.....................................................................
A0A1W5DA80_9LECA/293-435               .................................................p-SLIY.SPVFV.LLV.LEMSI.FMLL.I........V.P.L...PY.TW........R....RKLF.A.............F..I..S.....DS..P......L..V....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQVELALAkqqg.........................gaagAAAI.G.GSERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDTLRLEEKVKR-y.....................................................................
A0A218UGH4_9PASE/1-137                 ..................................................MTFQW.TAVAT.FLY.GEIGI.ILVL.C........V.P.F...IS.PL........R...wQKIF.M.............F..P..L.....WS..K......M..V....V..F.WN..K..M........F..............L..T.IIVL......L..IV.......LF..L................DAIR.E......VK.KYSSVHVNE................................kAAHV.N.SSAFDHIQMK.LF.R.S...QRN.L..YLS..GFSLF.L.WL........VLRRTI.TLLTQLAKEMASHAA-l.....................................................................
A0A0N0NN16_9EURO/1-143                 ..................................................MTLYY.SLVFA.LLM.AEMAI.FMGL.I........I.P.M...PF.KM........K....RKMY.N.............F..I..S.....ES..P......L..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..V................DSVN.R......VY.RVQVEMSALmkds.........................sgagRAAA.I.GSERMEVQAR.KF.Y.S...QRN.M..YLT..GFTLF.L.SL........ILNRTY.MMVLDVLRLEEKNR--my....................................................................
A0A087XDW4_POEFO/1-136                 ..................................................MTLQW.TAVAF.FLY.AEIVF.NLIL.C........I.P.F...IS.AH........R...wHLVF.R.............W..R..I.....WS..W......L..S....P..Y.WN..K..F........F..............F..A.MIMA......L..VV.......LF..C................DAIR.D......VQ.KYSGPEPVH.................................DAQA.S.PNLYDHVHMK.LF.R.A...QRN.L..YIC..GFSLF.L.WL........VMRRIV.TLLNQIAETSVN----tagl..................................................................
A0A177WT29_BATDE/1-102                 ..................................................-----.-----.---.-----.----.-........-.-.-...--.--........-....--ML.K.............W..V..S.....NS..K......I..V....V..K.IS..Y..V........M..............R..I.MFVF......V..VV.......LF..V................DSLN.N......VM.KKHEHDEHG.................................HSHA.D.AHTESMVRAK.MF.Y.A...QRN.L..YLT..GSVVF.L.SL........VLNRFF.AMVFELMKNEEKSE--vl....................................................................
A0A1U7S150_ALLSI/1-136                 ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........V.P.F...IS.AT........R...wQKIF.R.............S..R..L.....VR..A......V..V....T..Y.GN..T..F........F..............I..V.LIVI......L..IL.......LL..I................DAVR.E......IR.KYDEVPEKV.................................SLQH.S.PGALEHVHMK.LF.R.A...QRN.L..YLA..GFALL.L.SF........LLRRLV.TLLSQQASLQASNEA-f.....................................................................
G4MX02_MAGO7/1-141                     ..................................................MTLYY.TLVFV.LLM.AEMGL.FMLL.I........V.P.L...PF.TI........R....RRMF.T.............F..I..S.....EN..P......L..V....A..K.VQ..Y..A........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELVAAsen...........................nknAPTI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEEKVKQ-y.....................................................................
A0A183VRI8_TRIRE/1-88                  .................................................l-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............F..I.HFCF......L..SF.......CF..T................EAVR.N......SW.TQKQAYNTLk..............................ahPYEL.R.PETESLYLMR.MF.R.A...QRN.L..YIC..GFSLF.T.WF........VLRRLV.CLLSEHAQMSASMEA-s.....................................................................
A0A1Y1V539_9FUNG/9-141                 ...............................................gpi-----.---SY.LLI.GHCVT.ITFL.S........L.P.S...FP.LR........R....QIVE.K.............I.aR..G.....QN..K......I..L....N..R.IR..F..V........Y..............I..I.LHVF......I..LL.......LF..V................DNLK.R......MS.YLKEQVGKAy...............................tDNRT.D.NATLSDFSKR.LH.K.S...QRD.F..YIL..IFTLF.C.AI........ITYLLH.LLVLKMEN--------yrikylel..............................................................
A0A1J6JCB5_NICAT/1-126                 ..................................................MALQW.MILTY.VVA.AEAAV.AILL.T........L.P.S...PK.AI........K....SRIV.S.............L..I..S.....LA..L......Q..P....S..-.--..-..-........-..............L..F.IVPF......A..GF.......QL..L................DIYW.K......NE.H---RLMCT.................................GEIC.T.AAERDRYEKS.IY.K.A...QRN.A..ILC..LAACL.L.YW........CIYRVC.KYYKEIQNIEE-----vekrl.................................................................
A0A1B0D9D3_PHLPP/1-134                 ..................................................MSLVW.TLIAT.FLY.AEIGI.VLLL.V........L.P.I...AS.PM........R...wQKFF.R.............S..R..F.....LA..M......I..G....R..Q.AQ..M..Y........F..............Y..L.LLAV......L..VV.......FL..I................EAVR.E......MR.KYSHTDPAQ.................................--EA.H.LNVGMQHSMR.LF.R.A...QRN.F..YIS..GFAIF.L.VL........VIRRLV.LLISAQASLLAQAEA-s.....................................................................
A0A0V1P5H2_9BILA/149-284               ..................................................MSLQW.TLVAL.LLY.VEVFV.LSCM.L........L.P.W...IR.PS........S...wQRLF.R.............S..R..F.....LR..F......I..Q....T..Y.SS..L..Y........I..............Y..C.FALM......L..LL.......LF..L................DALR.E......VR.KYSDADLVK.................................QSVG.N.VQGEFNTHMR.LF.R.A...QRN.L..YIS..GAALF.L.WF........AIQRVA.SMISREAMLIASAEA-a.....................................................................
A0A094DGU3_9PEZI/1-140                 ..................................................MTLYY.SLVFM.LLV.AEMAL.FVLL.I........V.P.L...PF.NW........R....LKLY.T.............F..I..S.....ES..P......V..I....A..K.VQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELALAte............................qsqTGAV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.LMIMETLRLETKLKQ-y.....................................................................
N1JDR0_BLUG1/1-139                     ..................................................MTLYY.SLVFI.LLV.AEMGL.FMLL.I........V.P.L...PF.TI........R....RKMF.T.............F..I..S.....ES..P......I..V....A..K.FQ..Y..A........M..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQLELAESnk.............................sqGSPV.L.GHERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILDVLRLEEKVKK-y.....................................................................
A0A1S3MZ22_SALSA/20-141                ................................vcfslfnlrflcsgaaew-----.-----.---.-----.----.-........-.-.-...--.--........-....QCIF.Q.............L..R..I.....WN..K......M..A....R..F.WN..K..F........F..............L..A.MIII......L..IV.......LF..L................DALR.E......VR.KYSGAGNSK.................................DANL.H.PNMFDHLHMK.LF.R.A...QRN.L..YIS..GFTLF.L.WL........VLRRVI.TLINQLAMES------gttasl................................................................
A0A1S3GMX9_DIPOR/2-110                 ................................................ly-----.-----.---.-----.----.-........-.-.-...--.--........R...wQKIF.S.............F..S..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIVL......L..IV.......LF..L................DAVR.E......VR.KYSTTPALE................................kSTTN.R.PGAYEHSQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snksvl................................................................
X0LTU1_FUSOX/1-143                     ..................................................MTLYY.TLVFM.LLV.FEMAL.FMLL.I........F.P.M...PF.NV........K....RKIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAseqs.........................kqggGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRA-y.....................................................................
L2FSK3_COLGN/1-141                     ..................................................MTLYY.TLVFM.LLM.AEMGL.FMLL.I........V.P.L...PF.AI........K....RRLF.T.............F..I..S.....ES..P......I..V....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELALAtek...........................qnsGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRS-y.....................................................................
W4FKA2_9STRA/2-128                     ..............................................finl-----.-MMFW.LMC.VEGFI.CILL.C........I.P.F...FK.HA........T....QAVV.N.............F..L..S.....SN..V......F..T....A..T.SHltT..V........G..............Y..G.ILAL......V..GV.......MF..L................ANLQ.T......TY.NHHMSDEAV.................................----.-.---SDGFRIR.LL.A.A...QRD.M..YIS..GICLF.L.NL........LLQMLY.SSMVVNIKLEKSL---gam...................................................................
A0A2I2U7Z5_FELCA/118-253               ..................................................MSLQW.TAVAT.FLY.AEVFA.VLLL.C........I.P.F...IS.PK........R...wQKIF.K.............S..R..L.....VE..L......V..V....M..Y.GN..T..F........F..............V..V.LIVI......L..VL.......LV..I................DAVR.E......IR.KYDDVTEKV.................................NLQN.N.PGAMEHFHMK.LF.R.A...QRN.L..YIA..GFSLL.L.SF........LLRRLV.TLISQQATLLASNEA-f.....................................................................
I3KB96_ORENI/1-135                     ..................................................MSLQW.TAVAT.FLY.AEVFL.VLLL.C........I.P.F...IS.PK........R...wNSIF.K.............S..R..I.....VK..A......I..T....L..Y.GN..T..A........F..............M..V.AIAI......L..VF.......LL..I................DAFR.E......VR.KYSVTEKVD.................................-LAN.H.PTAIEHIHMK.LF.R.A...QRN.E..YIA..GFALL.L.CL........LLRRLA.TLLSQQASLMASNEA-f.....................................................................
A0A1L9P6E6_ASPVE/1-143                 ..................................................MTLYY.SLVFV.LLV.LEMGV.FMGL.I........V.P.L...PF.SV........R....RKLF.T.............F..V..S.....ES..P......V..I....A..K.LQ..Y..G........L..............R..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLEVSAFskeg.........................gnvgRGAA.L.GTDRSEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRVK--ll....................................................................
W6QDV2_PENRF/1-142                     ..................................................MTLYY.SLVFL.LLV.FEMGV.FLAL.V........I.P.L...PH.VV........K....RKLF.A.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQQELSAFakd..........................gpgmGAAH.L.GTDRMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TMILETLRLEDRV---rli...................................................................
A0A0A1PEZ4_9FUNG/1-133                 ..................................................MTIYY.TTTFF.ILV.IEMIV.FCIL.V........L.P.L...PS.RW........R....RALF.K.............F..A..S.....TS..P......L..V....G..K.AL..N..T........L..............R..I.IFGF......I..FV.......LF..I................DAVN.R......LQ.RIEEGEDNH.................................--KH.D.YGYEVGLKAR.KF.Y.A...QRN.L..YLT..GFTLF.L.SL........ILERTS.SLIVQMLKREEELE--ya....................................................................
A0A1A6GXQ4_NEOLE/1-95                  ..................................................MTIQW.VAVAS.FLY.AEIGL.ILIF.C........L.P.F...IP.PQ........Rv..lRRLV.T.............L..I..T.....Q-..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------lakeisnkgvlktqaentnkaakkfmeeneklkwvlknhgkdeeniletenkk.................
A0A1D5QRG9_MACMU/1-111                 ...........................................iheifcl-----.-----.---.-----.----.-........-.-.-...--.--........-....-KIF.S.............F..N..V.....WG..K......I..A....T..F.WN..K..A........F..............L..T.IIIL......L..IV.......LF..L................DAVR.E......VR.KYSSVHTIE................................rSSTS.R.PDAYEHTQMK.LF.R.S...QRN.L..YIS..GFSLF.F.WL........VLRRLV.TLITQLAKEL------snksvl................................................................
A0A183I357_9BILA/384-520               ..................................................MTLQW.FVVAL.ILY.LEIAV.VLLL.L........L.P.W...IR.PS........L...wSKFF.K.............S..R..I.....VK..T......F..E....K..H.AN..V..Y........F..............I..S.VLCI......L..LL.......LF..A................DAIR.E......VR.KYANEVAIE................................aSIRH.T.ADSENVVHMR.LF.R.A...QRN.L..YIS..GFALL.L.FL........VIKRLA.ALLSRGALLEAAAEA-a.....................................................................
X0CXD0_FUSOX/1-143                     ..................................................MTLYY.TLVFM.LLV.FEMAL.FMLL.I........V.P.M...PF.NV........K....RKIF.T.............F..I..S.....EN..P......V..V....A..K.IQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAseqs.........................kqggGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVRA-y.....................................................................
F0XAI8_GROCL/1-140                     ..................................................MTLYF.SLVFA.LLM.AEMGL.FLVL.I........T.P.L...PF.AA........K....RKMY.R.............F..L..S.....EN..P......V..V....A..K.IQ..Y..G........M..............K..I.AFIF......I..LI.......LF..V................DSAN.R......VY.RVQVELSTLae............................ngnGAAI.M.GRERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.TLVIEVLRLEEKIKT-f.....................................................................
A0A1S3ZUE0_TOBAC/1-126                 ..................................................MALQW.MILTY.VVA.AEAAV.AILL.T........L.P.S...PK.AI........K....SRIV.S.............L..I..S.....LT..L......Q..P....S..-.--..-..-........-..............L..F.IVPF......A..GF.......QL..L................DIYW.K......NE.HR---LMCT.................................GEIC.T.AAERNRYEKS.IY.K.A...QRN.A..ILC..LAACL.L.YW........CIYRVC.KYYKEIQSVEE-----vekrl.................................................................
A0A135TWS7_9PEZI/99-239                ..................................................MTLYY.TLVFM.LLM.AEMGL.FMLL.L........V.P.L...PF.TV........K....RKLF.T.............F..I..S.....ES..P......I..V....A..K.VQ..Y..W........M..............K..I.TFVF......I..LI.......LF..I................DSVN.R......VY.RVQVELAIAten...........................qnsGAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILEVMRLEDKVR--gy....................................................................
J9VSY5_CRYNH/1-138                     ..................................................MTLYY.SICFA.LLM.SELSL.FCTI.V........C.P.M...PF.AI........R....KKMF.H.............F..L..S.....EN..P......V..V....A..K.IQ..Y..G........L..............K..I.TFIF......V..AV.......LF..V................DALQ.R......MI.RIAQEGATAk..............................mkQDMA.D.ARTETNYAAR.RF.Y.A...QRN.L..YLT..GATLF.L.SL........LLARVF.YIILDFIQVQESYTA-l.....................................................................
A0A0C4DT17_MAGP6/1-141                 ..................................................MTLYY.TLVFV.LLM.AEMAL.FMLL.I........L.P.M...PF.TI........R....RKMF.T.............F..I..S.....EN..P......L..V....A..K.VQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQLELAAAtes...........................sknTATI.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.SMILEVLRLEEKVKQ-y.....................................................................
Q4D7Z9_TRYCC/2-134                     .............................................lslfa-----.VEVTY.LIV.PAMVI.FVMF.V........A.P.I...PG.LS........H...yVSRA.V.............S..F..V.....ER..L......N..F....H..G.VS..L..L........L..............L..V.TLVT......F..VS.......FV..V................QLVD.W......RK.KYSQGKPRF.................................---A.D.LSLEVDWEAK.KW.R.F...ERN.M..YIH..ALATV.L.CA........SIMKFS.RLYTAL----------ekystaavga............................................................
B4N4B2_DROWI/1-133                     ..................................................MSLVW.TLIAG.FLY.AEIIV.VLLL.V........L.-.V...GN.PY........R...wNRFF.K.............S..K..F.....LA..M......M..A....Q..Q.AH..I..Y........F..............F..L.IMGV......L..VL.......FL..L................EAIR.E......MR.KYSSHEQSG.................................--EV.H.LNVEMQHSMR.LF.R.A...QRN.F..YIS..GFSIF.L.VL........VIRRLV.TLISAQANLMAQSEA-s.....................................................................
A0A0L0SV53_ALLMA/1-142                 ..................................................MSLAN.QISFA.VLA.VEGVV.VVLL.S........I.P.L...PA.KA........R....KALA.R.............L..L..T.....ES..A......L..A....K..Q.AS..V..P........F..............W..F.LAIF......L..AV.......NF..A................DATL.R......QY.RLSQQHHGVeid..........................shhhQHVG.Y.PINDMDPRAK.LF.Q.A...QRN.M..YLT..GSALF.L.LF........VINVLR.GLLVEVVRAETKLAA-l.....................................................................
W4XKT2_STRPU/1-75                      ..................................................MTLQW.TFVAA.FLY.LEVFA.LILL.M........L.P.F...IK.PY........M...wQRFF.N.............S..G..I.....VK..S......I..T....A..Y.AY..I..Y........F..............N..V.FLFI......L..VL.......LF..L................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------vedfihvskcf...........................................................
A0A1S3JN79_LINUN/1-96                  ................................................mi-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......I..T....S..Y.AN..Y..Y........F..............T..V.FIVI......L..MV.......VF..G................DAIR.E......VY.KYSGEEKML................................dPKTT.H.HDTLEHIQLR.LF.R.S...QRN.L..YIA..GFALF.L.WL........VLKRLV.VLISTAATLTAQR---dva...................................................................
A0A1B9GVQ5_9TREE/1-70                  .......................................mvriaqegaaa-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.------KAK.................................PDVT.D.VRTETNYAAR.RF.Y.A...QRN.L..YLT..GATLF.L.SL........LLARVF.YIVLDFIHVQESYTA-l.....................................................................
A0A1S3MZH5_SALSA/1-136                 ..................................................MTLQW.TAVAL.FLY.VEIGV.LLIL.C........L.P.F...IS.AT........R...wQCIF.Q.............L..R..I.....WN..K......M..A....R..F.WN..K..F........F..............L..A.MIII......L..IV.......LF..L................DALR.E......VR.KYSGAGNSK.................................DANL.H.PNMFDHLHMK.LF.R.A...QRN.L..YIS..GFTLF.L.WL........VLRRVI.TLINQLAMES------gttasl................................................................
A0A0A1NYX6_9FUNG/1-93                  .................................................m-----.-----.---.-----.----.-........-.-.-...--.--........-....----.-.............-..-..-.....--..-......-..-....E..K.AM..Y..A........L..............K..I.VFGF......I..FV.......LF..I................DTIN.R......LQ.RIEAEADAE................................qQHHH.D.YNYETSLKAK.KF.Y.S...QRN.L..YLT..GFTLF.L.SL........ILERTS.ALVLELAKREEELKS-a.....................................................................
A0A183CFX0_GLOPA/1-39                  ..................................................MTLQW.TVIAF.VLY.SEIAT.IVVL.L........L.P.W...IR.PT........-....----.-.............-..-..-.....--..-......-..-....-..-.--..-..-........-..............-..-.----......-..--.......--..-................----.-......--.---------.................................----.-.----------.--.-.-...---.-..---..-----.-.--........------.----------------ihvdaskel.............................................................
C5WRK5_SORBI/1-126                     ..................................................MALQW.MILAC.VVA.VEAAV.AALV.T........L.P.V...PR.AV........R....GQIV.A.............L..T..S.....L-..-......F..L....Q..P.--..-..-........L..............S..T.VIPF......A..AF.......QL..L................DIYW.K......K-.--EHRLMCT.................................AEIC.T.AEERIRFEKS.MF.K.A...QRN.V..ILC..VSACL.L.YW........CIYRIV.KFNKDIKALEETE---krl...................................................................
A0A183JX73_9TREM/1-137                 .................................................m---LW.HIVVT.FLY.SEMFV.VLLM.I........L.P.F...FS.SQ........T...wSKFF.K.............F..S..I.....IQ..K......I..S....E..K.SS..F..Y........F..............R..L.FLVM......L..VC.......VL..A................EALR.N......IW.VLRQAYNSIk..............................dhPHEM.R.PETESLYLMR.MF.R.A...QRN.F..YIT..GFSLF.V.WF........VLHRLV.SLLSEHAKMQASEEA-s.....................................................................
M7TFF0_EUTLA/3-143                     ............................................iliinq-----.-QVFL.LLV.AEMAL.FMLL.V........I.P.L...PF.SL........R....RRIF.T.............F..I..S.....EN..P......I..V....A..K.LQ..Y..G........L..............K..I.TFIF......I..LI.......LF..L................DSVN.R......VY.RVQVELAMAtds...........................akgSAAV.M.GHERLEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILETLRLEQKVKS-y.....................................................................
A0A0L1HZY0_9PLEO/1-141                 ..................................................MTLYY.SLVFL.LLV.TEMLI.FCAL.I........V.P.L...PF.TW........R....RKLF.T.............F..I..S.....ES..P......I..I....A..K.LQ..Y..G........M..............K..I.TFIF......I..LI.......LF..I................DSVN.R......VY.RVQIELSGSddq...........................grsGVAA.G.GIERMEVQAR.KF.Y.S...QRN.M..YLC..GFTLF.L.SL........ILNRTY.VMILDVLRLEEEVKT-l.....................................................................
E0CVQ1_VITVI/1-124                     ................................................mi-----.QLLFT.VIF.AEMAM.IMVL.L........F.K.T...--.-P........L....RKLV.I.............M..G..L.....DR..V......K..R....G..R.GP..I..M........V..............K..T.VAAT......V..LV.......VL..I................SSVY.S......MM.KIRKRGIDD.................................D-VV.N.PT--DQVLMA.KH.L.L...--E.T..SLM..GFTLF.L.AL........MIDRLH.HYIRELRLRRKSME--ai....................................................................
#=GC seq_cons                          ..................................................MoL.a.sllhh.hLh.sEhsl.hhlL.h........l.P.h...s..sh........+....p+la.p.............h..h.........s.........h..s....s..p.hp..h..h........h..............h..h.hhhh......l..ll.......LF..l................Dulp.c......hh.+hptphttt.................................stts.t.sstchchph+.hF.h.u...QRN.h..Yls..GFsLF.L..L........llpRhh.shlhchhphptp.t..h.....................................................................
//
DBGET integrated database retrieval system