GenomeNet

Database: Pfam
Entry: DUF4881
LinkDB: DUF4881
Original site: DUF4881 
#=GF ID   DUF4881
#=GF AC   PF16222.5
#=GF DE   Domain of unknown function (DUF4881)
#=GF AU   Chang Y;0000-0002-2418-3433
#=GF SE   Jackhmmer JCSG target SP18621A
#=GF GA   146.10 146.10;
#=GF TC   206.00 205.90;
#=GF NC   55.10 21.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR032621;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This small family consists of several uncharacterized proteins 
#=GF CC   around 200 residues in length and is mainly found in various 
#=GF CC   Desulfovibrio species. The function of this protein is unknown.
#=GF SQ   15
#=GS A0A1G7M014_9DELT/25-198  AC A0A1G7M014.1
#=GS C4XQ17_DESMR/23-202      AC C4XQ17.1
#=GS T2GF58_DESGI/23-196      AC T2GF58.1
#=GS A0LFX4_SYNFM/25-204      AC A0LFX4.1
#=GS B8DII6_DESVM/22-201      AC B8DII6.1
#=GS G1UX44_9DELT/23-197      AC G1UX44.1
#=GS E8RD32_DESPD/25-204      AC E8RD32.1
#=GS A0A0F2J2Q8_9BACT/22-195  AC A0A0F2J2Q8.1
#=GS A0A1Y4D906_9DELT/21-193  AC A0A1Y4D906.1
#=GS A0A239B054_9DELT/24-203  AC A0A239B054.1
#=GS B8J1B2_DESDA/24-197      AC B8J1B2.1
#=GS Q72FR5_DESVH/24-203      AC Q72FR5.1
#=GS B6WY16_9DELT/22-196      AC B6WY16.1
#=GS A0A1Q8QGB0_9DELT/23-202  AC A0A1Q8QGB0.1
#=GS G7QB19_9DELT/23-201      AC G7QB19.1
A0A1G7M014_9DELT/25-198             .d--GGVEQGRCVAFDPAAKTVTIVVDVTHDQFNPHYSG-GVHTFKLPAESKDMGPAPTPGGRLMIDLKKSAVLIYEPVSKSVRELPVQFTDVEKNIGADHPKV------AGKTFPVVDKEQSSITVYSARLKALLTFKVPAEALDLPPYAWTAGHEVRVAFRnaEKGQAIRVMNVTKTNIFKK
C4XQ17_DESMR/23-202                 ..DYGKVDQGRTVAVDKDKKTVTFIRDKANDWQKPDYTYLPALTYSFPVDPAEMGETPKAGLRMKLDAEKAQVVLYDPKKQNFETIPIQIVDKQEGIDGKHPLVYDAAADKAKQFPALDKDKKTVSIYSGRQKLLVTFLVPEQYESLPAAAWDSGDEVRVYYK..EDGKALRLMNVTKTNIFKK
T2GF58_DESGI/23-196                 ..DYGNVIQGRVVEFNKETGIITFIKEESHDRKNPRYTALPPVTMRMPKDPHEIGPLPTPGGRIELNVKDNFVLVYDHDAKNFKKIPFTPVDIMTDVGRSHPMV------AGKTFPIIEKDKRTVQVYSGRQRLLAKFTVDDDAIQLPDNTWIAGDEVRIFYK..EEGQAARFMNITLTDIYKK
A0LFX4_SYNFM/25-204                 ..EYSKVDQGRAIALDKEKRTVTIIRDEKADPQNPDYSHLPPMTYSLPTDPAEMGPEPKVGLRMNLDAKSRQITIFDPASQNFKTITYTLIEEKDNVGRNDPLVFNEAENKAKKFPSVDREKKTISIYSGRQKIFITFSLPDEYFALPDHTWDAGDEVRMTFK..EPGKALRFMNISRTDIYKK
B8DII6_DESVM/22-201                 ..EYGKVDQGRVIAYDKNAKTVTLIQDKAMEPLNPDYSILPPHTYKLPVDPAEMGPEPKAGQRMKLDTKANIIRIFNTKTQAFEDITFKMVDLQENIDRNHPLVYDKATETAKKFPMVDRDKKTVTIYSGRQKMLCTISMPDEYFALPDSTWDAGDEVRVYYK..AEGVSLRFMNITKTDIFKK
G1UX44_9DELT/23-197                 fd--GGVEQGRCVAFDPAAKTLTIVVDVTHDQSAPHYSG-DVHTFKLPAEARDMGPAPTVGGRLMIELEKSALLLYDPDSKSIKELPVQFTDVEKNISAKHPKV------AGKTFPVVDKEKQTVTVYSKRLQALITFKVPAPALDLPPYVWTAGDEMRIAYRnaDKGQAIRIMNVSKTNIFKK
E8RD32_DESPD/25-204                 ..DYGKVEQGRAIAFDKDKKEVTLIHDSAMDPQKPVYDVLPPSVFKLPTDPKETGPEPKAGQRLKLDTDKKIIVIFDTNTQKIVEVPITIVDLQQPVDKEHPLVYDKAEKKAKKFPAVDKEKKTITIYSGRQKMLCTFSVPDQYFSYPDSTWDAGDEVRLYYK..TAGQSLRFMNISKTDIFKK
A0A0F2J2Q8_9BACT/22-195             .d-EGKVIQGRVIAYDKENKKVTFIEDKSIIKGKPEYTLLPPVVFTTPEDKNEMGAHPSVGQRMKLDVDKNTINIFDTATQQFKEIAYTLIERKDNVSKESPLV------RDKKFPIVDKNAKTIQIFSKRQKILVTFSLPEEYFSLPDETWAAGDEVRIYYK..EPGKALRMMNITTTDLFKK
A0A1Y4D906_9DELT/21-193             ..EFGQVEQGRCVAYDASKQTFTMVLDVNHDVQNPSYTG-GVMTYTMPADPAEIGPEPVPGGRVQINTEKSEVIIFRD--GKLETVKVEFTDIQKNILPSNPKV------AGHKFPVIDKDNGTITEYSKRLHEIVTFKVPAEYLELPPSTWEAGDECRIYYKenAKHQALRFMNVSKTNIFKK
A0A239B054_9DELT/24-203             ep--GKVDQGRVIKFDEATKTITIIRDKANDTQNPDYTYLPPITYTLPSNPAEVGPLPKAGGRMKIDNKKNQVTIFDPATQNFKTIDFIMVDFKENIDKKHPLVFDKEADKAKKFPVIDKEKKTVTIYSGRQKTLSVIQLPEEYFAMPDSTWDAGDEARVYYK..EDGKALRFMNISKTDIYKK
B8J1B2_DESDA/24-197                 .e--GGVEQGRCVAFNPEAKTLTIVVDVTHDQFNPHYSG-GVHTFKLPTVAGEMGPLPEVGGRLMIDLEKNTVLVFDPESKTVREIPVQFVDVEKNIRPRHPKV------AGKTFPVVDKEQQTVTVYSNRLSALITFKVPAGDIDLPPYVWAAGNEMRIAFRnsDKNQAIRIMNVTRTNIFSK
Q72FR5_DESVH/24-203                 ..EYGKVDQGRVIAFDKQAKTVTLIQDKLAEPMNPDYSTLPPHTYKLPADPAEMGPEPKAGLRMKLDTKANIVKIFNPKTQAFEDITITVIDLQQNIDRQHPLVFDKATDTAKKFPMVDRDKKTITIYSGRQKMLCTFSVPDEYFSMPDHTWEAGDEVRVYYK..TEGVSLRFMNISKTDIFKK
B6WY16_9DELT/22-196                 ..EFGQVEQGRCVAFNPETKTLLVVLDVNHDQLNPHYSG-GIHEYTLPADPAEIGPLPVPGGRVMFDLEKSTVTIFNPETKALEVLNVTFTDVEKGIKRTHPKV------HGKTFPIIDKDKMSVTEYSARLQALVTFTIPADKIDLPPSTWEAGDEVRMYYKenAKHQALRFMNITRTNIFKK
A0A1Q8QGB0_9DELT/23-202             ..DYGKVDQGRTVAVDKDKKTLTFIRDKANDWQKPDYTYLPALTYSFPVVAAEMGEIPKAGLRMKLDADKSQIVMYDPKKQNFETIAIQVVDKQEGIDSKHPLVFDAAAEKAKPFPAVDKDKKTVTIYSGRQKLLVTFIVPDEYLALPAAAWDAGDEVRVYYK..DEGKALRLMNVTKTNIFKK
G7QB19_9DELT/23-201                 ..DYGKVDQGRTVAIDKEKKLITMIPNMSTDPAKGDFK-LPAITFTYPTDPQDMGQEPKAGLRMKLDTDKGEIVLYDPKKQNFETIPIQIVDKQQGIDSKHPLVFDATTEKAKKFPVVDKDKKLVTIYSGSQKMLVSFIPPEEYLALPASAWDAGDIVRIYFK..TEGTALRVMNVTSTNIFKK
#=GC seq_cons                       ..-aGKV-QGRsVAaDK-sKTlTlIpDpspD.tNPcYohLPshTapLPsDPuEMGPtPcsGtRhcLDs-KspllIFDPcoQsFcsIslphlDlpcNIcpcHPLV......puKpFPlVDK-KKTVTIYSGRQKhLlTFpVP-EYhuLPssTW-AGDEVRlYYK..-cGpALRhMNlTKTsIFKK
//
DBGET integrated database retrieval system