GenomeNet

Database: Pfam
Entry: DUF809
LinkDB: DUF809
Original site: DUF809 
#=GF ID   DUF809
#=GF AC   PF05663.14
#=GF DE   Protein of unknown function (DUF809)
#=GF AU   Moxon SJ;0000-0003-4644-1816
#=GF SE   Pfam-B_7264 (release 8.0)
#=GF GA   25.00 25.00;
#=GF TC   312.70 312.50;
#=GF NC   24.00 23.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR008527;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family consists of several proteins of unknown function
#=GF CC   Raphanus sativus (Radish) and Brassica napus (Rape).
#=GF SQ   1
#=GS J7M805_RAPSA/1-138  AC J7M805.1
J7M805_RAPSA/1-138             MITFFEKLSTFCHNLTPTECKVSVISFFLLAFLLMAHIWLSWFSNNQHCLRTMRHLEKLKIPYEFQYGWLGVKITIKSNVPNDEVTKKVSPIIKGEIEGKEEKKEGKGEIEGKEEKKEGKGEIEGKEEKKRLENGPRK
#=GC seq_cons                  MITFFEKLSTFCHNLTPTECKVSVISFFLLAFLLMAHIWLSWFSNNQHCLRTMRHLEKLKIPYEFQYGWLGVKITIKSNVPNDEVTKKVSPIIKGEIEGKEEKKEGKGEIEGKEEKKEGKGEIEGKEEKKRLENGPRK
//
DBGET integrated database retrieval system