GenomeNet

Database: Pfam
Entry: EppA_BapA
LinkDB: EppA_BapA
Original site: EppA_BapA 
#=GF ID   EppA_BapA
#=GF AC   PF07268.11
#=GF DE   Exported protein precursor (EppA/BapA)
#=GF AU   Moxon SJ;0000-0003-4644-1816
#=GF SE   Pfam-B_17945 (release 10.0)
#=GF GA   29.10 29.10;
#=GF TC   29.50 263.30;
#=GF NC   28.30 21.80;
#=GF BM   hmmbuild --amino HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   12724373
#=GF RT   Immunological and genetic characterization of Borrelia
#=GF RT   burgdorferi BapA and EppA proteins. 
#=GF RA   Miller JC, Stevenson B; 
#=GF RL   Microbiology 2003;149:1113-1125.
#=GF DR   INTERPRO; IPR009894;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family consists of a number of exported protein precursor
#=GF CC   (EppA and BapA) sequences which seem to be specific to Borrelia
#=GF CC   burgdorferi (Lyme disease spirochete). bapA gene sequences are
#=GF CC   quite stable but the encoded proteins do not provoke a strong
#=GF CC   immune response in most individuals. Conversely, EppA proteins
#=GF CC   are much more antigenic but are more variable in sequence. It is
#=GF CC   thought that BapA and EppA play important roles during the
#=GF CC   Borrelia burgdorferi infectious cycle [1].
#=GF SQ   2
#=GS H7C7L7_BORBU/25-161  AC H7C7L7.1
#=GS H7C7N4_BORBU/20-156  AC H7C7N4.1
H7C7L7_BORBU/25-161             DIKKNYEKAKKAFSKEDYDLLNKRLDNYDFESEYDKSFFFAKAPEIRGSLRKIGIKENSVLLDALDVVGF-IKSKITTDFLSFIIMNINSLIKGYPNSIFDYLIQLDSDKIDYAEKYGEKARENFEESYKKDKITAVK
H7C7N4_BORBU/20-156             NIEENYTETKRAFSKEDFNLINKRLDNYDFKNEYEKSHVFSDAPRIRGDLRKIGIKEKSVFLDALEAIEYLIKIKISTDSI-FLSEDMIRLIGSYPDSIFNYLIQLNSDKIDYAEKYGDNARNNFKKDYSEDKANTVK
#=GC seq_cons                   sIccNYpcsK+AFSKEDasLlNKRLDNYDFcsEY-KSahFucAPcIRGsLRKIGIKEpSVhLDAL-slta.IK.KIoTD.l.Fl..sh.pLItuYPsSIFsYLIQLsSDKIDYAEKYG-pARpNFccsYpcDKhssVK
//
DBGET integrated database retrieval system