GenomeNet

Database: Pfam
Entry: Flavi_NS2B
LinkDB: Flavi_NS2B
Original site: Flavi_NS2B 
#=GF ID   Flavi_NS2B
#=GF AC   PF01002.22
#=GF DE   Flavivirus non-structural protein NS2B
#=GF AU   Finn RD;0000-0001-8626-2148
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_156 (release 3.0)
#=GF GA   23.50 23.50;
#=GF TC   23.80 100.40;
#=GF NC   23.30 19.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   9499070
#=GF RT   Signal peptidase cleavage at the flavivirus C-prM junction:
#=GF RT   dependence on the viral NS2B-3 protease for efficient processing
#=GF RT   requires determinants in C, the signal peptide, and prM. 
#=GF RA   Stocks CE, Lobigs M; 
#=GF RL   J Virol 1998;72:2141-2149.
#=GF RN   [2]
#=GF RM   7884844
#=GF RT   Formation of the flavivirus envelope: role of the viral NS2B-NS3
#=GF RT   protease. 
#=GF RA   Yamshchikov VF, Compans RW; 
#=GF RL   J Virol 1995;69:1995-2003.
#=GF DR   INTERPRO; IPR000487;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   Flaviviruses encode a single polyprotein. This is cleaved into
#=GF CC   three structural and seven non-structural proteins. All, but
#=GF CC   two, are cleaved by the NS2B-NS3 protease complex.
#=GF SQ   4
#=GS POLG_YEFV1/1358-1484      AC P03314.1
#=GS POLG_ZIKV/1373-1498       AC Q32ZE1.1
#=GS POLG_ZIKV/1373-1498       DR PDB; 5ZMS D; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5ZMQ E; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5GPI E; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5ZOB G; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5GPI A; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5YOD E; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5GJ4 A; 49-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6JPW C; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6L4Z G; 50-89;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6KK5 A; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5ZOB E; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5ZMQ C; 51-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5T1V A; 6-22;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6KK3 A; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6Y3B A; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5ZMS J; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6JPW A; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5ZOB A; 50-88;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5TFN B; 49-66;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6L50 G; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6JPW E; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5ZMS A; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6KK6 A; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5TFN A; 50-69;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5YOD C; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5ZMQ A; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6L50 E; 51-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5YOF A; 50-88;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5TFO A; 50-68;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5GJ4 C; 49-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6L4Z A; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5TFO B; 49-64;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5YOD A; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5GXJ A; 50-68;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6KPQ A; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5GPI C; 51-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5ZOB C; 50-88;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6L50 A; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5ZMS G; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5ZMQ G; 50-88;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5GJ4 G; 49-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5GPI G; 50-89;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5GXJ B; 48-68;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5GJ4 E; 49-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6JPW G; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5T1V B; 6-26;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6L4Z E; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 5YOD G; 50-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6KK4 A; 49-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6L4Z C; 51-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6L50 C; 51-87;
#=GS POLG_ZIKV/1373-1498       DR PDB; 6KK2 A; 50-87;
#=GS POLG_DEN1W/1349-1475      AC P17763.2
#=GS A0A2V1MW33_9LACO/167-293  AC A0A2V1MW33.1
POLG_YEFV1/1358-1484                 .VNEALAAAGLVGVLAGLAFQEMENFLGPIAVGGLLMMLVSVAGRVDGLELKKLGEVSWEEEAEISGSSARYDVALSEQGEFKLLSEEKVPWDQVVMTSLALVGAALHPFALLLVLAGWLFHVRGARR
POLG_ZIKV/1373-1498                  s--EVLTAVGLICALAGGFAKADIEMAGPMAAVGLLIVSYVVSGKSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMREIILKVVLMAICGMNPIAIPFAAGAWYVYVKTGKR
#=GR POLG_ZIKV/1373-1498       SS    X--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEEEEEEEEE----TTSEEESB--EEEEEE-TTS-EEE-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
POLG_DEN1W/1349-1475                 .LNEGIMAVGIVSILLSSLLKNDVPLAGPLIAGGMLIACYVISGSSADLSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKDEERDDTLTILLKATLLAISGVYPMSIPATLFVWYFWQKKKQR
A0A2V1MW33_9LACO/167-293             .LNEAIMAVGMVSILASSLLKNDIPMTGPLVAGGLLTVCYVLTGRSADLELERAADVRWEEQAEISGSSPILSITISEDGSMSIKNEEEEQTLTILIRTGLLVISGLFPVSIPITAAAWYLWEVKKQR
#=GC SS_cons                         X--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEEEEEEEEE----TTSEEESB--EEEEEE-TTS-EEE-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
#=GC seq_cons                        .lNEulhAVGlVulLAuuhhKsDlshsGPlsAGGLLhssYVloG+SsDLpLE+Au-VoWEE-AElSGuSsplsVslsEsGshplhsEEcsshhpIll+ssLLsIuGlaPhuIPhshuuWYha.+ptpR
//
DBGET integrated database retrieval system