GenomeNet

Database: Pfam
Entry: Herpes_pp38
LinkDB: Herpes_pp38
Original site: Herpes_pp38 
#=GF ID   Herpes_pp38
#=GF AC   PF04846.13
#=GF DE   Herpesvirus pp38 phosphoprotein
#=GF AU   Mifsud W;0000-0002-9805-6461
#=GF SE   Pfam-B_4545 (release 7.6)
#=GF GA   26.00 26.00;
#=GF TC   51.20 51.00;
#=GF NC   25.90 25.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR006930;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This protein represents a conserved region found in most
#=GF CC   herpesvirus pp38 phosphoproteins.
#=GF SQ   6
#=GS PP38_GAHVM/213-275    AC Q77MR0.1
#=GS Q785D5_9ALPH/139-201  AC Q785D5.1
#=GS PP24_GAHVM/93-155     AC Q77MT0.1
#=GS Q77Q52_9ALPH/213-275  AC Q77Q52.1
#=GS Q9QTE6_9ALPH/44-106   AC Q9QTE6.1
#=GS C8JQT2_9ALPH/93-155   AC C8JQT2.1
PP38_GAHVM/213-275               ENATMRSYMLVTLICSAKSLLLGSCMSFFAGMLVGRTADVKTPLWDTVCLLMAFCAGIVVGGV..
Q785D5_9ALPH/139-201             ENATMRSLMVITLIRSARSLVMGSCMAFFAGILIGRAVKVDSTGWQRAGLFMALCTGAIAGGI..
PP24_GAHVM/93-155                ENKNLRKKYNIILDVSTKILVFGTCIMFATGTLIGKGTKIQVPVCNSTNLALAFLAGFLTRHV..
Q77Q52_9ALPH/213-275             ENATMRSYMLVTLICSAKSLLLGSCMSFFAGMLVGRTADVKTPLWDTVCLLMAFCAGIVVGGV..
Q9QTE6_9ALPH/44-106              ENKKLRRGCNLVFTISNKTLVVGTCFMLAAGVLVGASGADHETACNKTNLLLVFVTALLTR--fi
C8JQT2_9ALPH/93-155              ENKNLRKKYNIILDVSTKILVFGTCIMFATGTLIGKGTKIQVPVCNSTNLALAFLAGFLTRHV..
#=GC seq_cons                    ENtshRphhslsLhsSsKoLVhGoChhFhAGhLlG+usclcsPlhsossLhhAFsAGhlsttV..
//
DBGET integrated database retrieval system