GenomeNet

Database: Pfam
Entry: OspE
LinkDB: OspE
Original site: OspE 
#=GF ID   OspE
#=GF AC   PF02471.19
#=GF DE   Borrelia outer surface protein E
#=GF PI   OspEF; 
#=GF AU   Mian N;0000-0003-4284-4749
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_962 (release 5.4)
#=GF GA   25.00 25.00;
#=GF TC   26.90 173.40;
#=GF NC   23.10 21.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   8982001
#=GF RT   Homology throughout the multiple 32-kilobase circular plasmids
#=GF RT   present in Lyme disease spirochetes. 
#=GF RA   Casjens S, van Vugt R, Tilly K, Rosa PA, Stevenson B; 
#=GF RL   J Bacteriol 1997;179:217-227.
#=GF RN   [2]
#=GF RM   8655548
#=GF RT   A family of genes located on four separate 32-kilobase circular
#=GF RT   plasmids in Borrelia burgdorferi B31. 
#=GF RA   Stevenson B, Tilly K, Rosa PA; 
#=GF RL   J Bacteriol 1996;178:3508-3516.
#=GF RN   [3]
#=GF RM   19001079
#=GF RT   Borrelia burgdorferi infection-associated surface proteins ErpP,
#=GF RT   ErpA, and ErpC bind human plasminogen.
#=GF RA   Brissette CA, Haupt K, Barthel D, Cooley AE, Bowman A, Skerka C,
#=GF RA   Wallich R, Zipfel PF, Kraiczy P, Stevenson B;
#=GF RL   Infect Immun. 2009;77:300-306.
#=GF DR   INTERPRO; IPR003483;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This is a family of outer surface proteins (Osp) from the
#=GF CC   Borrelia spirochete [1]. The family includes OspE, and
#=GF CC   OspEF-related proteins (Erp) [2,3]. These proteins are coded for
#=GF CC   on different circular plasmids in the Borrelia genome.
#=GF SQ   4
#=GS H7C7N5_BORBU/41-147   AC H7C7N5.1
#=GS G8JZS0_BORBU/45-151   AC G8JZS0.1
#=GS Q9S036_BORBU/54-160   AC Q9S036.1
#=GS Q9S036_BORBU/54-160   DR PDB; 4BOB A; 33-139;
#=GS Q9S0E0_BORBU/151-253  AC Q9S0E0.2
H7C7N5_BORBU/41-147              FSEFTVKIK.NKNNSNNWADLGDLVVRKEKDGIETGLNAGGHSATFFSLEEEEINNFIKAMTEGGSFKTSLYYGYNDEESDKNVIKNKEIKTKIEKINDTEYITFLGD
G8JZS0_BORBU/45-151              FSEFTVKIK.NKNNSNNWADLGDLVVRKEKDGIETGLNAGGHSATFFSLEEEEINNFIKAMTEGGSFKTSLYYGYNDEESDKNVIKNKEIKTKIEKINDTEYITFLGD
Q9S036_BORBU/54-160              FSKFTVKIK.NKDNNSNWTDLGDLVVRKEENGIDTGLNAGGHSATFFSLKESEVNNFIKAMTKGGSFKTSLYYGYKYEQSSANGIQNKEIITKIESINGAEHIAFLGD
#=GR Q9S036_BORBU/54-160   SS    --EEEEEEE.EE-TTS-EEEEEEEEEEE-SSSEEEEEEETTEEEEEEEE-GGGHHHHHHHHHHS-EEE-SEE---TTBGGGTT-EET-EEEEEEEESSSSEEEEEEEE
Q9S0E0_BORBU/151-253             FFDFNVYIKyKKTNIGNWIDLGTLDLIKEEYSIVTDLNVGGHTARLFSVKESEINNFVNSMIRGGAFNAD-YYGYQEGED----YKIKNIETKIETINDSQFITFLGR
#=GC SS_cons                     --EEEEEEE.EE-TTS-EEEEEEEEEEE-SSSEEEEEEETTEEEEEEEE-GGGHHHHHHHHHHS-EEE-SEE---TTBGGGTT-EET-EEEEEEEESSSSEEEEEEEE
#=GC seq_cons                    FS-FTVKIK.NKsNssNWsDLGDLVVRKEcsGI-TGLNAGGHSATFFSLcEpEINNFIKAMTcGGSFKTSLYYGYp-EESstNsIKNKEIcTKIEpINDoEaITFLGD
//
DBGET integrated database retrieval system