GenomeNet

Database: Pfam
Entry: Pur_ac_phosph_N
LinkDB: Pur_ac_phosph_N
Original site: Pur_ac_phosph_N 
#=GF ID   Pur_ac_phosph_N
#=GF AC   PF16656.4
#=GF DE   Purple acid Phosphatase, N-terminal domain
#=GF AU   Punta M
#=GF SE   PDB:1kbp_A
#=GF GA   30.00 30.00;
#=GF TC   30.00 30.00;
#=GF NC   29.90 29.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   8683579
#=GF RT   Mechanism of Fe(III)-Zn(II) purple acid phosphatase based on
#=GF RT   crystal structures.
#=GF RA   Klabunde T, Strater N, Frohlich R, Witzel H, Krebs B;
#=GF RL   J Mol Biol. 1996;259:737-748.
#=GF DR   INTERPRO; IPR015914;
#=GF CC   This domain is found at the N-terminus of Purple acid
#=GF CC   phosphatase proteins.
#=GF SQ   3391
#=GS A0A0E0NXB3_ORYRU/68-155     AC A0A0E0NXB3.1
#=GS W9RDX2_9ROSA/140-231        AC W9RDX2.1
#=GS R6RV41_9FIRM/92-190         AC R6RV41.1
#=GS A0A094CKQ9_9PEZI/36-127     AC A0A094CKQ9.1
#=GS A0A0G0MMG9_9BACT/308-392    AC A0A0G0MMG9.1
#=GS W5TIM5_9NOCA/115-208        AC W5TIM5.1
#=GS A0A151EQZ9_9EURY/29-112     AC A0A151EQZ9.1
#=GS PPA12_ARATH/60-150          AC Q38924.3
#=GS B9H0V4_POPTR/81-172         AC B9H0V4.2
#=GS A0A0B2PWM0_GLYSO/70-159     AC A0A0B2PWM0.1
#=GS A0A0C3I260_9PEZI/70-174     AC A0A0C3I260.1
#=GS E1ZMF3_CHLVA/157-259        AC E1ZMF3.1
#=GS A0A0N5BA92_STREA/28-125     AC A0A0N5BA92.1
#=GS A0A0W8CCA0_PHYNI/68-165     AC A0A0W8CCA0.1
#=GS A0A0G0NI08_9BACT/3986-4084  AC A0A0G0NI08.1
#=GS A0A078K1E6_BRANA/54-148     AC A0A078K1E6.1
#=GS A8X727_CAEBR/21-107         AC A8X727.2
#=GS A0A0G1SHL0_9BACT/47-139     AC A0A0G1SHL0.1
#=GS A0A100YU31_9FIRM/56-148     AC A0A100YU31.1
#=GS K6U261_9CLOT/48-152         AC K6U261.1
#=GS A0A0G1R9M3_9BACT/179-267    AC A0A0G1R9M3.1
#=GS A0A0E0MJN8_ORYPU/44-131     AC A0A0E0MJN8.1
#=GS B9RWM5_RICCO/68-179         AC B9RWM5.1
#=GS K7IM68_NASVI/29-120         AC K7IM68.1
#=GS W2QC13_PHYPN/174-279        AC W2QC13.1
#=GS A0A0R3NYA0_DROPS/42-143     AC A0A0R3NYA0.1
#=GS W3WV72_9PEZI/34-123         AC W3WV72.1
#=GS G0RRS8_HYPJQ/66-169         AC G0RRS8.1
#=GS A0A0E0QGQ9_ORYRU/77-203     AC A0A0E0QGQ9.1
#=GS R5CVL7_9FIRM/1065-1160      AC R5CVL7.1
#=GS Q7UIH3_RHOBA/36-128         AC Q7UIH3.1
#=GS C3Z3N2_BRAFL/38-129         AC C3Z3N2.1
#=GS A0A0F5VT18_9ACTN/75-180     AC A0A0F5VT18.1
#=GS I4YJ71_WALMC/18-112         AC I4YJ71.1
#=GS K4CBN7_SOLLC/53-144         AC K4CBN7.1
#=GS A0A022PSB9_ERYGU/44-136     AC A0A022PSB9.1
#=GS C5YDS8_SORBI/167-275        AC C5YDS8.1
#=GS A0A0E0BFE0_9ORYZ/171-260    AC A0A0E0BFE0.1
#=GS A0A072U6M0_MEDTR/71-182     AC A0A072U6M0.1
#=GS A0A059LGY9_9CHLO/122-225    AC A0A059LGY9.1
#=GS S2D0A0_9BACT/27-112         AC S2D0A0.1
#=GS G0T1L1_RHOT2/45-137         AC G0T1L1.1
#=GS M4EDL4_BRARP/145-248        AC M4EDL4.1
#=GS A0A061FD96_THECC/58-152     AC A0A061FD96.1
#=GS A0A067FD35_CITSI/54-141     AC A0A067FD35.1
#=GS V4MHN2_EUTSA/172-280        AC V4MHN2.1
#=GS I1FMC5_AMPQE/150-251        AC I1FMC5.1
#=GS W7DEN0_9LIST/222-319        AC W7DEN0.1
#=GS A0A0B2PNE9_GLYSO/168-276    AC A0A0B2PNE9.1
#=GS A0A0L9V9D4_PHAAN/54-145     AC A0A0L9V9D4.1
#=GS K7LFF7_SOYBN/72-174         AC K7LFF7.1
#=GS B9H015_POPTR/71-182         AC B9H015.2
#=GS A0A0M3RE16_9BACI/985-1090   AC A0A0M3RE16.1
#=GS A0A0M2J7B2_9ACTN/74-179     AC A0A0M2J7B2.1
#=GS A0A0F0L9T2_9MICO/242-333    AC A0A0F0L9T2.1
#=GS R7CGS9_9FIRM/55-149         AC R7CGS9.1
#=GS K4R292_9ACTN/76-181         AC K4R292.1
#=GS A0A016V8J0_9BILA/17-103     AC A0A016V8J0.1
#=GS A0A168LPI5_9BACL/89-188     AC A0A168LPI5.1
#=GS V4RIF8_9ROSI/78-189         AC V4RIF8.1
#=GS H3GZF9_PHYRM/91-189         AC H3GZF9.1
#=GS A0A0D3HW06_9ORYZ/173-281    AC A0A0D3HW06.1
#=GS M1AIC8_SOLTU/168-276        AC M1AIC8.1
#=GS A0A0G0KPF3_9BACT/133-231    AC A0A0G0KPF3.1
#=GS A0A0G0T2K7_9BACT/2313-2412  AC A0A0G0T2K7.1
#=GS A0A0D3CI07_BRAOL/43-130     AC A0A0D3CI07.1
#=GS D9WCQ7_9ACTN/82-187         AC D9WCQ7.1
#=GS G4YJW0_PHYSP/154-259        AC G4YJW0.1
#=GS E3LNV3_CAERE/25-110         AC E3LNV3.1
#=GS C3ZMT7_BRAFL/37-127         AC C3ZMT7.1
#=GS K7W1T8_MAIZE/226-334        AC K7W1T8.1
#=GS A0A0D9V6T0_9ORYZ/145-246    AC A0A0D9V6T0.1
#=GS D0P2U6_PHYIT/97-195         AC D0P2U6.1
#=GS G5A0U3_PHYSP/66-163         AC G5A0U3.1
#=GS R6NFW2_9CLOT/686-801        AC R6NFW2.1
#=GS A0A068X497_HYMMI/1-83       AC A0A068X497.1
#=GS A0A0G1ND05_9BACT/73-158     AC A0A0G1ND05.1
#=GS A0A0G0EPY6_9BACT/1908-1998  AC A0A0G0EPY6.1
#=GS B9GWK4_POPTR/214-316        AC B9GWK4.2
#=GS B6HUH0_PENRW/33-119         AC B6HUH0.1
#=GS K7LXJ7_SOYBN/67-178         AC K7LXJ7.1
#=GS A0A059BMC4_EUCGR/165-252    AC A0A059BMC4.1
#=GS K3WPZ6_PYTUL/186-287        AC K3WPZ6.1
#=GS A0A0P0NHK2_9SPHI/50-133     AC A0A0P0NHK2.1
#=GS D2QUS8_SPILD/31-127         AC D2QUS8.1
#=GS A0A078M3X7_9STAP/80-231     AC A0A078M3X7.1
#=GS A0A0J7Z511_STRVR/31-126     AC A0A0J7Z511.1
#=GS M2Y0C9_DOTSN/29-119         AC M2Y0C9.1
#=GS Q63X35_BURPS/53-150         AC Q63X35.1
#=GS A0A0Q5V6H3_9FLAO/20-110     AC A0A0Q5V6H3.1
#=GS R0G573_9BRAS/57-148         AC R0G573.1
#=GS S0FLP3_9FIRM/32-141         AC S0FLP3.1
#=GS W2PQU2_PHYPN/95-193         AC W2PQU2.1
#=GS U2T819_LEIAQ/19-112         AC U2T819.1
#=GS A0A0G1KD60_9BACT/119-221    AC A0A0G1KD60.1
#=GS A0A0K9NKL2_ZOSMR/168-277    AC A0A0K9NKL2.1
#=GS I2GL27_9BACT/31-127         AC I2GL27.1
#=GS S8E0Z5_9LAMI/124-227        AC S8E0Z5.1
#=GS A0A0G2ALL7_9BACT/176-266    AC A0A0G2ALL7.1
#=GS D0MUK6_PHYIT/61-158         AC D0MUK6.1
#=GS R4LSU4_9ACTN/40-135         AC R4LSU4.1
#=GS T1KY41_TETUR/31-122         AC T1KY41.1
#=GS L1LZW1_PSEPU/38-134         AC L1LZW1.1
#=GS K3WNF6_PYTUL/70-169         AC K3WNF6.1
#=GS A0A0D2BAX9_9EURO/68-171     AC A0A0D2BAX9.1
#=GS V4RJD8_9ROSI/86-198         AC V4RJD8.1
#=GS Q10Q09_ORYSJ/172-280        AC Q10Q09.1
#=GS A0A0P0V8Z3_ORYSJ/1-87       AC A0A0P0V8Z3.1
#=GS A0A077S0P4_WHEAT/59-150     AC A0A077S0P4.1
#=GS K3X8L0_PYTUL/29-130         AC K3X8L0.1
#=GS A0A0G1JVH7_9BACT/2924-3008  AC A0A0G1JVH7.1
#=GS A0A0Q9TSE2_9BACL/55-141     AC A0A0Q9TSE2.1
#=GS A0A0M2JBK7_9ACTN/78-183     AC A0A0M2JBK7.1
#=GS Q9VZ56_DROME/38-141         AC Q9VZ56.2
#=GS A0A075KBC7_9FIRM/38-129     AC A0A075KBC7.1
#=GS M5WZ64_PRUPE/634-742        AC M5WZ64.1
#=GS A0A059CLT2_EUCGR/55-146     AC A0A059CLT2.1
#=GS A0A090Z5Z4_PAEMA/721-832    AC A0A090Z5Z4.1
#=GS R4K654_CLOPA/61-157         AC R4K654.1
#=GS A0A081CF39_PSEA2/33-122     AC A0A081CF39.1
#=GS G2FUL4_9FIRM/652-750        AC G2FUL4.1
#=GS U4TRK2_DENPD/26-117         AC U4TRK2.1
#=GS A0A078BX53_BRANA/49-136     AC A0A078BX53.1
#=GS A0A0G1JVH7_9BACT/2641-2729  AC A0A0G1JVH7.1
#=GS H2QG98_PANTR/32-125         AC H2QG98.1
#=GS I1IG28_BRADI/54-147         AC I1IG28.1
#=GS A0A067F911_CITSI/43-130     AC A0A067F911.1
#=GS F2EF31_HORVD/51-143         AC F2EF31.1
#=GS K3Y794_SETIT/48-135         AC K3Y794.1
#=GS K7LSE2_SOYBN/217-319        AC K7LSE2.1
#=GS A0A061GNY5_THECC/56-147     AC A0A061GNY5.1
#=GS M9M127_PAEPP/37-137         AC M9M127.1
#=GS A0A0X3XU29_9ACTN/49-144     AC A0A0X3XU29.1
#=GS G1RWS4_NOMLE/32-125         AC G1RWS4.1
#=GS U7UE06_9FIRM/68-160         AC U7UE06.1
#=GS D5BE73_ZUNPS/69-175         AC D5BE73.1
#=GS A0A0D3GYD7_9ORYZ/63-163     AC A0A0D3GYD7.1
#=GS A0A0X3V4Y3_9ACTN/91-196     AC A0A0X3V4Y3.1
#=GS V9E365_PHYPR/67-164         AC V9E365.1
#=GS A0A0A0LRK5_CUCSA/60-151     AC A0A0A0LRK5.1
#=GS A0A067GD80_CITSI/59-150     AC A0A067GD80.1
#=GS U5GHV9_POPTR/51-138         AC U5GHV9.1
#=GS A0A0C2T2K3_AMAMU/1-87       AC A0A0C2T2K3.1
#=GS C2GEV9_9CORY/25-111         AC C2GEV9.1
#=GS W9RXZ3_9ROSA/15-96          AC W9RXZ3.1
#=GS PPA2_ARATH/145-247          AC Q9LMG7.1
#=GS A0A061FSS3_THECC/252-355    AC A0A061FSS3.1
#=GS A0A0D3VD52_9BACL/752-849    AC A0A0D3VD52.1
#=GS R6I8M7_9FIRM/700-815        AC R6I8M7.1
#=GS I1FS45_AMPQE/196-298        AC I1FS45.1
#=GS M0YS05_HORVD/47-135         AC M0YS05.1
#=GS A0A0D2VCQ9_GOSRA/141-245    AC A0A0D2VCQ9.1
#=GS A0A0D9Z9N8_9ORYZ/68-155     AC A0A0D9Z9N8.1
#=GS A0A0E0RKH3_ORYRU/444-538    AC A0A0E0RKH3.1
#=GS A0A176TDZ5_9FLAO/24-110     AC A0A176TDZ5.1
#=GS A0A0A1SY42_9HYPO/34-120     AC A0A0A1SY42.1
#=GS M7WV37_RHOT1/45-137         AC M7WV37.1
#=GS A0A162JD06_9PEZI/27-118     AC A0A162JD06.1
#=GS W5HP15_WHEAT/103-194        AC W5HP15.1
#=GS A0A0G1WH45_9BACT/317-405    AC A0A0G1WH45.1
#=GS B4F8V0_MAIZE/83-201         AC B4F8V0.1
#=GS A2R1M4_ASPNC/70-173         AC A2R1M4.1
#=GS B8ANS7_ORYSI/63-176         AC B8ANS7.1
#=GS R6SXH0_9BACE/32-130         AC R6SXH0.1
#=GS A0A061FK56_THECC/60-151     AC A0A061FK56.1
#=GS A0A147K259_9EURY/134-220    AC A0A147K259.1
#=GS M1BDJ4_SOLTU/15-127         AC M1BDJ4.1
#=GS G7Y8H2_CLOSI/37-129         AC G7Y8H2.1
#=GS A0A087HD53_ARAAL/61-152     AC A0A087HD53.1
#=GS G4ZZW6_PHYSP/96-194         AC G4ZZW6.1
#=GS A0A0B2QFR6_GLYSO/45-133     AC A0A0B2QFR6.1
#=GS I1R436_ORYGL/52-144         AC I1R436.1
#=GS M5TC38_9PLAN/36-128         AC M5TC38.1
#=GS G0RUS8_HYPJQ/23-113         AC G0RUS8.1
#=GS R0GHY0_9BRAS/54-166         AC R0GHY0.1
#=GS M4D9B2_BRARP/17-108         AC M4D9B2.1
#=GS G3XQ08_ASPNA/70-173         AC G3XQ08.1
#=GS T1KXV2_TETUR/32-123         AC T1KXV2.2
#=GS A0A0E0AY17_9ORYZ/177-288    AC A0A0E0AY17.1
#=GS A0A0C2ALL4_9ACTN/62-155     AC A0A0C2ALL4.1
#=GS W5BCH6_WHEAT/47-134         AC W5BCH6.1
#=GS S0GJN4_9PORP/269-364        AC S0GJN4.1
#=GS W4ZQQ8_WHEAT/172-285        AC W4ZQQ8.1
#=GS N1S268_FUSC4/75-176         AC N1S268.1
#=GS A0A0D2P070_GOSRA/184-292    AC A0A0D2P070.1
#=GS D3BJ35_POLPA/15-114         AC D3BJ35.1
#=GS J3NEE7_ORYBR/165-273        AC J3NEE7.1
#=GS M1AD80_SOLTU/53-144         AC M1AD80.1
#=GS A0A162LLJ0_9ACTN/1-94       AC A0A162LLJ0.1
#=GS E8NAG2_MICTS/48-143         AC E8NAG2.1
#=GS A0A0N4TSS9_BRUPA/46-134     AC A0A0N4TSS9.1
#=GS K4B3L9_SOLLC/56-147         AC K4B3L9.1
#=GS D6CY00_9BACE/260-356        AC D6CY00.1
#=GS F6HKK1_VITVI/2-80           AC F6HKK1.1
#=GS D3BF43_POLPA/46-187         AC D3BF43.1
#=GS A0A089ICS5_9BACL/753-850    AC A0A089ICS5.1
#=GS B4FKP7_MAIZE/52-139         AC B4FKP7.1
#=GS A0A078H7E5_BRANA/145-248    AC A0A078H7E5.1
#=GS A0A0G1U7N1_9BACT/206-292    AC A0A0G1U7N1.1
#=GS A0A024TEA4_9STRA/129-242    AC A0A024TEA4.1
#=GS M1D1Z7_SOLTU/56-147         AC M1D1Z7.1
#=GS D2RNV9_ACIFV/60-153         AC D2RNV9.1
#=GS D0NUG4_PHYIT/1-83           AC D0NUG4.1
#=GS A0A0D2ZV86_BRAOL/60-151     AC A0A0D2ZV86.1
#=GS B4JMN6_DROGR/2-89           AC B4JMN6.1
#=GS A0A078CPY0_BRANA/43-131     AC A0A078CPY0.1
#=GS W2PUE4_PHYPN/1-82           AC W2PUE4.1
#=GS R6PJ75_9CLOT/19-110         AC R6PJ75.1
#=GS A0A0P0VUV1_ORYSJ/41-149     AC A0A0P0VUV1.1
#=GS J3NFB3_ORYBR/53-144         AC J3NFB3.1
#=GS A0A096RFT2_MAIZE/67-158     AC A0A096RFT2.1
#=GS F9Z3J6_ODOSD/33-129         AC F9Z3J6.1
#=GS I1I8W6_BRADI/173-285        AC I1I8W6.1
#=GS A0A0J7Z6M1_STRVR/80-185     AC A0A0J7Z6M1.1
#=GS K1RZH9_CRAGI/3-74           AC K1RZH9.1
#=GS A0A0U2N9Q7_9BACL/1076-1175  AC A0A0U2N9Q7.1
#=GS A0A0B5DD86_9ACTN/48-143     AC A0A0B5DD86.1
#=GS A0A090II36_9GAMM/225-311    AC A0A090II36.1
#=GS A0A0G1D050_9BACT/43-128     AC A0A0G1D050.1
#=GS D8TBR4_SELML/77-168         AC D8TBR4.1
#=GS A0A0L8H5I1_OCTBM/1-84       AC A0A0L8H5I1.1
#=GS ACP7_HUMAN/32-125           AC Q6ZNF0.2
#=GS K0C6Y0_ALCDB/1124-1217      AC K0C6Y0.1
#=GS A0A0M2VT08_9BACL/1076-1175  AC A0A0M2VT08.1
#=GS K7H7C8_CAEJA/22-105         AC K7H7C8.1
#=GS I1R438_ORYGL/55-142         AC I1R438.1
#=GS W5N439_LEPOC/28-121         AC W5N439.1
#=GS A0A067FSP1_CITSI/169-277    AC A0A067FSP1.1
#=GS A0A0D2E4L5_9EURO/69-172     AC A0A0D2E4L5.1
#=GS J0DZ43_LOALO/1-78           AC J0DZ43.1
#=GS V4PJ70_9CAUL/53-154         AC V4PJ70.1
#=GS A0A0J1CTG6_9BURK/54-151     AC A0A0J1CTG6.1
#=GS D3BN02_POLPA/144-247        AC D3BN02.1
#=GS R7S961_TREMS/71-175         AC R7S961.1
#=GS G9N7D3_HYPVG/66-169         AC G9N7D3.1
#=GS A0A183QH72_9TREM/30-137     AC A0A183QH72.1
#=GS A0A0P0XNU8_ORYSJ/186-294    AC A0A0P0XNU8.1
#=GS A0A0D9WUQ9_9ORYZ/146-252    AC A0A0D9WUQ9.1
#=GS G0T435_SOYBN/60-151         AC G0T435.1
#=GS V4UHD2_9ROSI/43-130         AC V4UHD2.1
#=GS S2Y8N8_9BACL/986-1091       AC S2Y8N8.1
#=GS M1AWF5_SOLTU/165-273        AC M1AWF5.1
#=GS A0A0D9XPN9_9ORYZ/81-170     AC A0A0D9XPN9.1
#=GS A0A0B7N9E8_9FUNG/59-156     AC A0A0B7N9E8.1
#=GS U5FF77_POPTR/63-154         AC U5FF77.1
#=GS A0A0G1D637_9BACT/323-413    AC A0A0G1D637.1
#=GS A0A059BLE4_EUCGR/1-75       AC A0A059BLE4.1
#=GS A0A0E0P3W6_ORYRU/63-176     AC A0A0E0P3W6.1
#=GS K9B9F6_9STAP/72-224         AC K9B9F6.1
#=GS A0A1B6PD28_SORBI/64-157     AC A0A1B6PD28.1
#=GS A0A067LF84_JATCU/46-133     AC A0A067LF84.1
#=GS T0HMP1_9SPHN/40-140         AC T0HMP1.1
#=GS I1QLK5_ORYGL/177-288        AC I1QLK5.1
#=GS N4UGE1_FUSC1/75-176         AC N4UGE1.1
#=GS R5T6U2_9FIRM/41-133         AC R5T6U2.1
#=GS A0A101NVP0_9ACTN/56-149     AC A0A101NVP0.1
#=GS A0A0E0BUF2_9ORYZ/173-281    AC A0A0E0BUF2.1
#=GS B9SXP6_RICCO/60-151         AC B9SXP6.1
#=GS X6NTD5_RETFI/24-174         AC X6NTD5.1
#=GS R6MVT1_9BACE/45-136         AC R6MVT1.1
#=GS Q0AVG7_SYNWW/44-137         AC Q0AVG7.1
#=GS A0A0D2V8Z6_GOSRA/1-76       AC A0A0D2V8Z6.1
#=GS J0N5M6_9CLOT/56-152         AC J0N5M6.1
#=GS J3N632_ORYBR/1-75           AC J3N632.1
#=GS B1BZV7_9FIRM/238-330        AC B1BZV7.1
#=GS I1IUC5_BRADI/135-226        AC I1IUC5.1
#=GS A0A072VQW8_MEDTR/56-148     AC A0A072VQW8.1
#=GS A0A0L0LAW7_9BACT/153-239    AC A0A0L0LAW7.1
#=GS A0A094ERD0_9PEZI/39-130     AC A0A094ERD0.1
#=GS A0A0E0MCI6_ORYPU/139-227    AC A0A0E0MCI6.1
#=GS A0A1B6PF13_SORBI/73-166     AC A0A1B6PF13.1
#=GS A0A0D9WSJ1_9ORYZ/133-224    AC A0A0D9WSJ1.1
#=GS A0A0G0F7W2_9BACT/80-178     AC A0A0G0F7W2.1
#=GS F1A0C3_DICPU/214-317        AC F1A0C3.1
#=GS M4DT62_BRARP/176-285        AC M4DT62.1
#=GS W3A5M7_PHYPR/62-159         AC W3A5M7.1
#=GS U7UC34_9FIRM/57-147         AC U7UC34.1
#=GS I7A076_MELRP/24-120         AC I7A076.1
#=GS A0A0V8HL76_9BACI/984-1089   AC A0A0V8HL76.1
#=GS A0A059ANQ1_EUCGR/68-159     AC A0A059ANQ1.1
#=GS A0A0G1HH80_9BACT/47-139     AC A0A0G1HH80.1
#=GS A0A017SWE8_9DELT/87-188     AC A0A017SWE8.1
#=GS D5SQD8_PLAL2/52-139         AC D5SQD8.1
#=GS V5RV84_9BACT/1611-1695      AC V5RV84.1
#=GS M5VW03_PRUPE/54-141         AC M5VW03.1
#=GS D8SVS9_SELML/141-244        AC D8SVS9.1
#=GS A0A0P1AKJ6_9STRA/86-192     AC A0A0P1AKJ6.1
#=GS G7IXK7_MEDTR/43-130         AC G7IXK7.1
#=GS V4STL8_9ROSI/169-277        AC V4STL8.1
#=GS A0A0J6ZPB5_9FIRM/30-125     AC A0A0J6ZPB5.1
#=GS T1LMZ2_TRIUA/160-269        AC T1LMZ2.1
#=GS A0A0G0T2X8_9BACT/6-96       AC A0A0G0T2X8.1
#=GS W5W597_9PSEU/58-163         AC W5W597.1
#=GS V7D3J7_PHAVU/82-194         AC V7D3J7.1
#=GS A2ZN55_ORYSI/66-157         AC A2ZN55.1
#=GS K7LHW3_SOYBN/47-134         AC K7LHW3.1
#=GS T1IRD3_STRMM/31-122         AC T1IRD3.1
#=GS A0A0E0BVP9_9ORYZ/66-157     AC A0A0E0BVP9.1
#=GS A0A0M3CFJ3_9SPHI/38-135     AC A0A0M3CFJ3.1
#=GS A0A017TFD5_9DELT/30-113     AC A0A017TFD5.1
#=GS A0A0N0TDC2_9ACTN/76-181     AC A0A0N0TDC2.1
#=GS A0A0G0JA05_9BACT/1404-1499  AC A0A0G0JA05.1
#=GS A0A075K6R6_9FIRM/39-135     AC A0A075K6R6.1
#=GS A0A0G1XDC1_9BACT/51-138     AC A0A0G1XDC1.1
#=GS F7APV1_HORSE/25-116         AC F7APV1.1
#=GS A0A0B2PVB9_GLYSO/54-145     AC A0A0B2PVB9.1
#=GS R5YAM8_9FIRM/62-155         AC R5YAM8.1
#=GS A0A0D2WPG4_CAPO3/70-162     AC A0A0D2WPG4.1
#=GS A0A061EK97_THECC/643-755    AC A0A061EK97.1
#=GS A0A0N0U4G2_9HYME/25-116     AC A0A0N0U4G2.1
#=GS B9HIE6_POPTR/180-288        AC B9HIE6.2
#=GS A0A127AMD0_9DELT/639-722    AC A0A127AMD0.1
#=GS A0A0D3D354_BRAOL/54-148     AC A0A0D3D354.1
#=GS A0A176J5D3_9BACI/1115-1215  AC A0A176J5D3.1
#=GS C5WST2_SORBI/175-283        AC C5WST2.1
#=GS A0A078E744_BRANA/143-246    AC A0A078E744.1
#=GS A0A0F7IFW4_9EURY/621-708    AC A0A0F7IFW4.1
#=GS I1MU36_SOYBN/92-183         AC I1MU36.1
#=GS I1PL09_ORYGL/52-141         AC I1PL09.1
#=GS A0A0X3SMJ8_9ACTN/66-183     AC A0A0X3SMJ8.1
#=GS A5N8V9_CLOK5/51-136         AC A5N8V9.1
#=GS A0A160IKU0_9BACI/985-1091   AC A0A160IKU0.1
#=GS A0A0G0UHT0_9BACT/44-134     AC A0A0G0UHT0.1
#=GS A0A078I9H0_BRANA/59-150     AC A0A078I9H0.1
#=GS A0A0U1QM85_9BACL/39-139     AC A0A0U1QM85.1
#=GS S8C684_9LAMI/5-97           AC S8C684.1
#=GS A0A078JJN4_BRANA/76-187     AC A0A078JJN4.1
#=GS A0A0E0LDX1_ORYPU/54-145     AC A0A0E0LDX1.1
#=GS A0A0K0EAF3_STRER/25-113     AC A0A0K0EAF3.1
#=GS V4SW87_9ROSI/216-319        AC V4SW87.1
#=GS H3H2W2_PHYRM/71-168         AC H3H2W2.1
#=GS H3GXL5_PHYRM/22-133         AC H3GXL5.1
#=GS G7L615_MEDTR/54-141         AC G7L615.1
#=GS A0A0E0BFD7_9ORYZ/146-234    AC A0A0E0BFD7.1
#=GS A0A0G1W6U6_9BACT/1183-1275  AC A0A0G1W6U6.1
#=GS D6K1I5_9ACTN/83-188         AC D6K1I5.1
#=GS A0A136KLQ2_9BACT/32-131     AC A0A136KLQ2.1
#=GS R4K6T8_CLOPA/49-144         AC R4K6T8.1
#=GS A0A183DK95_9BILA/1-78       AC A0A183DK95.1
#=GS W5GS60_WHEAT/1-80           AC W5GS60.1
#=GS A0A059BMI9_EUCGR/44-131     AC A0A059BMI9.1
#=GS A0A0L7QV16_9HYME/25-116     AC A0A0L7QV16.1
#=GS Q01ZC1_SOLUE/47-144         AC Q01ZC1.1
#=GS A0A0G3HIE4_9CORY/163-240    AC A0A0G3HIE4.1
#=GS A0A0N4YBN9_NIPBR/40-134     AC A0A0N4YBN9.1
#=GS A0A0G0EPY6_9BACT/1615-1706  AC A0A0G0EPY6.1
#=GS I1IXG9_BRADI/49-136         AC I1IXG9.1
#=GS K4CXG1_SOLLC/48-140         AC K4CXG1.1
#=GS A0A078HF42_BRANA/144-247    AC A0A078HF42.1
#=GS A0A024TI22_9STRA/80-177     AC A0A024TI22.1
#=GS A9U0Q4_PHYPA/74-185         AC A9U0Q4.1
#=GS M4F3X6_BRARP/43-130         AC M4F3X6.1
#=GS B5WPE7_9BURK/57-156         AC B5WPE7.1
#=GS I0Z217_COCSC/152-255        AC I0Z217.1
#=GS R6BPC8_9FIRM/75-172         AC R6BPC8.1
#=GS A0A087HDK4_ARAAL/44-133     AC A0A087HDK4.1
#=GS A0A0J1BK20_9SPHI/32-130     AC A0A0J1BK20.1
#=GS A0A061EBE6_THECC/176-284    AC A0A061EBE6.1
#=GS A0A0G1TB45_9BACT/66-155     AC A0A0G1TB45.1
#=GS F2U8E5_SALR5/37-136         AC F2U8E5.1
#=GS I3IMC5_9BACT/31-117         AC I3IMC5.1
#=GS A0A151SMJ7_CAJCA/72-184     AC A0A151SMJ7.1
#=GS A0A0W8D2I7_PHYNI/20-120     AC A0A0W8D2I7.1
#=GS R5R657_9FIRM/100-195        AC R5R657.1
#=GS D8SYQ0_SELML/73-183         AC D8SYQ0.1
#=GS F8AZC8_FRADG/9-103          AC F8AZC8.1
#=GS W1PSR3_AMBTC/46-133         AC W1PSR3.1
#=GS M0ZS86_SOLTU/47-135         AC M0ZS86.1
#=GS A0A0K9PLM9_ZOSMR/78-190     AC A0A0K9PLM9.1
#=GS A0A0G1BZF4_9BACT/1356-1456  AC A0A0G1BZF4.1
#=GS W2RI01_PHYPN/62-159         AC W2RI01.1
#=GS A0A0R0BLR2_9GAMM/47-142     AC A0A0R0BLR2.1
#=GS PPA9_ARATH/143-246          AC Q9ZQ81.1
#=GS V9EPT2_PHYPR/243-349        AC V9EPT2.1
#=GS A0A166ES63_DAUCA/52-139     AC A0A166ES63.1
#=GS M2XXL8_GALSU/129-244        AC M2XXL8.1
#=GS A0A090LLM7_STRRB/1-84       AC A0A090LLM7.1
#=GS A0A0S7XLK7_9BACT/30-106     AC A0A0S7XLK7.1
#=GS A0A0B0NDX7_GOSAR/58-149     AC A0A0B0NDX7.1
#=GS G7KLC0_MEDTR/71-182         AC G7KLC0.2
#=GS X0C4R0_FUSOX/75-176         AC X0C4R0.1
#=GS K3Y7K6_SETIT/112-199        AC K3Y7K6.1
#=GS I1GQN0_BRADI/67-157         AC I1GQN0.1
#=GS A0A0K9PZI5_ZOSMR/149-253    AC A0A0K9PZI5.1
#=GS A0A0G1NZQ5_9BACT/1954-2037  AC A0A0G1NZQ5.1
#=GS V4LMR6_EUTSA/65-168         AC V4LMR6.1
#=GS F0SQ14_RUBBR/59-173         AC F0SQ14.1
#=GS A0A183AC67_9TREM/28-121     AC A0A183AC67.1
#=GS B9RGF7_RICCO/220-322        AC B9RGF7.1
#=GS D8S4S9_SELML/1-94           AC D8S4S9.1
#=GS M0WKF6_HORVD/63-176         AC M0WKF6.1
#=GS A0A0L0D9T5_THETB/138-241    AC A0A0L0D9T5.1
#=GS E3LJQ2_CAERE/43-136         AC E3LJQ2.1
#=GS A0A0G1QVM7_9BACT/1483-1570  AC A0A0G1QVM7.1
#=GS U5RWF2_9CLOT/45-112         AC U5RWF2.1
#=GS A0A090SHU6_9VIBR/310-404    AC A0A090SHU6.1
#=GS M8ARZ8_TRIUA/143-248        AC M8ARZ8.1
#=GS A0A0G0MNR8_9BACT/2024-2108  AC A0A0G0MNR8.1
#=GS E3NT34_CAERE/20-115         AC E3NT34.1
#=GS A0A068SCY1_9FUNG/62-166     AC A0A068SCY1.1
#=GS C0PDY0_MAIZE/66-179         AC C0PDY0.1
#=GS B4L6R8_DROMO/1-95           AC B4L6R8.2
#=GS Q86IH2_DICDI/184-299        AC Q86IH2.1
#=GS W4FTY6_9STRA/128-237        AC W4FTY6.1
#=GS Q741N5_MYCPA/69-162         AC Q741N5.1
#=GS A0A0B0M7C6_GOSAR/169-277    AC A0A0B0M7C6.1
#=GS A0A0D2S6J5_GOSRA/80-183     AC A0A0D2S6J5.1
#=GS A0A0D2W8U8_GOSRA/56-147     AC A0A0D2W8U8.1
#=GS A0A0G0QNR1_9BACT/45-135     AC A0A0G0QNR1.1
#=GS S2XLY7_9BACL/483-586        AC S2XLY7.1
#=GS V6MGX3_9BACL/38-138         AC V6MGX3.1
#=GS W9RG64_9ROSA/50-137         AC W9RG64.1
#=GS F7EI35_MACMU/32-125         AC F7EI35.1
#=GS V7AEU9_PHAVU/54-145         AC V7AEU9.1
#=GS A0A102CZU7_9BACT/41-138     AC A0A102CZU7.1
#=GS R7DJF1_9PORP/612-696        AC R7DJF1.1
#=GS A0A0C1MXN9_9CYAN/19-103     AC A0A0C1MXN9.1
#=GS A0A0A2TMD8_9FIRM/46-138     AC A0A0A2TMD8.1
#=GS A0A0G0Y1S6_9BACT/1110-1209  AC A0A0G0Y1S6.1
#=GS B9RHA3_RICCO/58-149         AC B9RHA3.1
#=GS W2Q499_PHYPN/198-304        AC W2Q499.1
#=GS W9RRF3_9ROSA/1-76           AC W9RRF3.1
#=GS M0SE93_MUSAM/55-146         AC M0SE93.1
#=GS A0A0S9R9N1_9ACTN/35-128     AC A0A0S9R9N1.1
#=GS Q5BAS0_EMENI/33-121         AC Q5BAS0.1
#=GS A0A0D3H2H4_9ORYZ/244-355    AC A0A0D3H2H4.1
#=GS A0A0G1Q468_9BACT/1007-1100  AC A0A0G1Q468.1
#=GS H3GMG0_PHYRM/183-288        AC H3GMG0.1
#=GS I1LP05_SOYBN/106-208        AC I1LP05.2
#=GS A0A059AEB4_EUCGR/219-322    AC A0A059AEB4.1
#=GS V4TFD7_9ROSI/142-245        AC V4TFD7.1
#=GS A0A0G0GHW0_9BACT/189-277    AC A0A0G0GHW0.1
#=GS G3J4A5_CORMM/73-174         AC G3J4A5.1
#=GS D2VCD2_NAEGR/31-130         AC D2VCD2.1
#=GS A0A078FNU1_BRANA/173-280    AC A0A078FNU1.1
#=GS A0A059DFL1_EUCGR/1-75       AC A0A059DFL1.1
#=GS M4F891_BRARP/61-152         AC M4F891.1
#=GS R6DVD1_9FIRM/34-128         AC R6DVD1.1
#=GS R0G4V5_9BRAS/57-148         AC R0G4V5.1
#=GS I3LZ30_ICTTR/32-125         AC I3LZ30.1
#=GS A0A0E0MQ19_ORYPU/564-656    AC A0A0E0MQ19.1
#=GS A0A087SN34_AUXPR/76-188     AC A0A087SN34.1
#=GS Q764C1_PHAVU/60-151         AC Q764C1.1
#=GS A0A0L8HI16_OCTBM/36-138     AC A0A0L8HI16.1
#=GS Q9U309_CAEEL/22-117         AC Q9U309.1
#=GS A0A0F7GCR8_9CHLR/40-132     AC A0A0F7GCR8.1
#=GS A0A0G0YV40_9BACT/29-117     AC A0A0G0YV40.1
#=GS A0A0E3WGT0_9BACL/607-706    AC A0A0E3WGT0.1
#=GS W2ZET4_PHYPR/174-279        AC W2ZET4.1
#=GS A0A0B0MRB3_GOSAR/69-181     AC A0A0B0MRB3.1
#=GS V4UUX0_9ROSI/87-174         AC V4UUX0.1
#=GS D8UDV5_VOLCA/84-198         AC D8UDV5.1
#=GS F3Z681_9ACTN/60-155         AC F3Z681.1
#=GS A0A067RT69_ZOONE/23-114     AC A0A067RT69.1
#=GS V9F974_PHYPR/174-279        AC V9F974.1
#=GS A0A168LPI5_9BACL/528-625    AC A0A168LPI5.1
#=GS A0A0J7XZ74_9SPHN/38-134     AC A0A0J7XZ74.1
#=GS R6WW38_9PORP/269-363        AC R6WW38.1
#=GS H9JFJ6_BOMMO/807-898        AC H9JFJ6.1
#=GS B6IEC7_CAEBR/20-104         AC B6IEC7.1
#=GS A0A166GFG1_DAUCA/56-147     AC A0A166GFG1.1
#=GS R6EIX1_9FIRM/1-85           AC R6EIX1.1
#=GS A0A151T035_CAJCA/50-161     AC A0A151T035.1
#=GS A0A0S6XU45_9FUNG/37-124     AC A0A0S6XU45.1
#=GS D2W3L7_NAEGR/22-122         AC D2W3L7.1
#=GS A0A0G0EZ74_9BACT/579-666    AC A0A0G0EZ74.1
#=GS A0A0G0PFY8_9BACT/43-128     AC A0A0G0PFY8.1
#=GS V4MED8_EUTSA/58-148         AC V4MED8.1
#=GS M4B968_HYAAE/134-239        AC M4B968.1
#=GS V9GH45_9BACL/51-148         AC V9GH45.1
#=GS A0A0M3C9T5_9SPHI/32-142     AC A0A0M3C9T5.1
#=GS K3WGB9_PYTUL/43-152         AC K3WGB9.1
#=GS A0A0K9NP95_ZOSMR/73-186     AC A0A0K9NP95.1
#=GS W5B898_WHEAT/142-247        AC W5B898.1
#=GS Q2QLL9_ORYSJ/59-150         AC Q2QLL9.1
#=GS W4XDN4_STRPU/115-208        AC W4XDN4.1
#=GS A0A151UAS9_CAJCA/1-90       AC A0A151UAS9.1
#=GS A0A0P1B5P9_9STRA/91-188     AC A0A0P1B5P9.1
#=GS A0A0L8H5Z7_OCTBM/1-84       AC A0A0L8H5Z7.1
#=GS U2Q764_9CLOT/55-142         AC U2Q764.1
#=GS A0A0B2QG87_GLYSO/100-187    AC A0A0B2QG87.1
#=GS A0A061G610_THECC/170-278    AC A0A061G610.1
#=GS M4BKT0_HYAAE/50-165         AC M4BKT0.1
#=GS A0A0E0R4B3_ORYRU/171-259    AC A0A0E0R4B3.1
#=GS A0A0G0Y948_9BACT/44-132     AC A0A0G0Y948.1
#=GS R0G5E0_9BRAS/48-135         AC R0G5E0.1
#=GS A0A0P7XBX9_9BACT/279-360    AC A0A0P7XBX9.1
#=GS M0S360_MUSAM/55-146         AC M0S360.1
#=GS A0A0Q0VFN3_9SPHI/38-136     AC A0A0Q0VFN3.1
#=GS A0A0V2F806_CAUVI/46-142     AC A0A0V2F806.1
#=GS W2PP21_PHYPN/100-198        AC W2PP21.1
#=GS A0A067G3U1_CITSI/176-284    AC A0A067G3U1.1
#=GS A0A0K9RS91_SPIOL/1-75       AC A0A0K9RS91.1
#=GS D1BNN2_VEIPT/55-146         AC D1BNN2.1
#=GS A0A150ARJ3_9BACT/7-99       AC A0A150ARJ3.1
#=GS A0A0L0LFB6_9BACT/316-401    AC A0A0L0LFB6.1
#=GS M0WQ43_HORVD/176-285        AC M0WQ43.1
#=GS A0A061FJT8_THECC/836-939    AC A0A061FJT8.1
#=GS A0A0K9PZS7_ZOSMR/54-146     AC A0A0K9PZS7.1
#=GS T0R9R0_9STRA/191-284        AC T0R9R0.1
#=GS R4KH61_9FIRM/48-140         AC R4KH61.1
#=GS B4NC50_DROWI/33-137         AC B4NC50.1
#=GS G4KSE0_OSCVS/43-140         AC G4KSE0.1
#=GS U5FI45_POPTR/63-154         AC U5FI45.1
#=GS A0A087G9Y9_ARAAL/171-279    AC A0A087G9Y9.1
#=GS H2WND8_CAEJA/59-152         AC H2WND8.2
#=GS M7Z1G0_TRIUA/47-134         AC M7Z1G0.1
#=GS A0A0M0J785_9EUKA/224-336    AC A0A0M0J785.1
#=GS A0A143Z131_9LACT/49-141     AC A0A143Z131.1
#=GS A0A0G0XUH2_9BACT/175-266    AC A0A0G0XUH2.1
#=GS R7C4M5_9FIRM/65-191         AC R7C4M5.1
#=GS A0A0F7TXJ3_9EURO/35-122     AC A0A0F7TXJ3.1
#=GS L1JM98_GUITH/263-382        AC L1JM98.1
#=GS M5XBB0_PRUPE/169-276        AC M5XBB0.1
#=GS L1KYG0_9ACTN/87-192         AC L1KYG0.1
#=GS A0A0B3VMH1_9FIRM/45-131     AC A0A0B3VMH1.1
#=GS A0A0D9Y0R6_9ORYZ/965-1073   AC A0A0D9Y0R6.1
#=GS A0A0D2T8X0_GOSRA/108-219    AC A0A0D2T8X0.1
#=GS A0A0B0P6P7_GOSAR/61-152     AC A0A0B0P6P7.1
#=GS E0VL88_PEDHC/34-125         AC E0VL88.1
#=GS A0A0W8C7E9_PHYNI/189-294    AC A0A0W8C7E9.1
#=GS A0A0C2T9S2_AMAMU/1-87       AC A0A0C2T9S2.1
#=GS A0A0G1S0K6_9BACT/152-238    AC A0A0G1S0K6.1
#=GS A0A0G1ASL4_9BACT/43-131     AC A0A0G1ASL4.1
#=GS M7Z6I1_TRIUA/141-254        AC M7Z6I1.1
#=GS A0A0A0LL67_CUCSA/68-181     AC A0A0A0LL67.1
#=GS D8QZ61_SELML/197-298        AC D8QZ61.1
#=GS A0A0D5VKG6_9BURK/55-151     AC A0A0D5VKG6.1
#=GS D1BCR8_SANKS/243-337        AC D1BCR8.1
#=GS W6RWG7_9CLOT/63-151         AC W6RWG7.1
#=GS A0A0G0YV40_9BACT/233-316    AC A0A0G0YV40.1
#=GS V6K1W2_STRRC/74-179         AC V6K1W2.1
#=GS A0A0D2XTT0_FUSO4/28-116     AC A0A0D2XTT0.1
#=GS A0A0D3EKQ3_9ORYZ/57-148     AC A0A0D3EKQ3.1
#=GS R0FNL8_9BRAS/48-135         AC R0FNL8.1
#=GS A0A0W8C569_PHYNI/61-158     AC A0A0W8C569.1
#=GS C5XWK4_SORBI/144-251        AC C5XWK4.1
#=GS A0A165Y458_DAUCA/63-154     AC A0A165Y458.1
#=GS A0A096T6R9_MAIZE/174-282    AC A0A096T6R9.1
#=GS H6RSK7_BLASD/44-132         AC H6RSK7.1
#=GS D3AU75_9CLOT/157-251        AC D3AU75.1
#=GS A0A194YKI3_SORBI/55-145     AC A0A194YKI3.1
#=GS S3D410_OPHP1/34-119         AC S3D410.1
#=GS A0A0B0PGL6_GOSAR/60-151     AC A0A0B0PGL6.1
#=GS A0A061GP98_THECC/62-153     AC A0A061GP98.1
#=GS A0A0L8GF81_OCTBM/45-135     AC A0A0L8GF81.1
#=GS A0A0S7Y8C6_9BACT/843-932    AC A0A0S7Y8C6.1
#=GS A0A0B2PTW0_GLYSO/15-96      AC A0A0B2PTW0.1
#=GS B8BMN4_ORYSI/164-272        AC B8BMN4.1
#=GS I1RKT7_GIBZE/34-123         AC I1RKT7.1
#=GS A0A151DZ89_9EURY/47-128     AC A0A151DZ89.1
#=GS I1GKW0_BRADI/63-176         AC I1GKW0.1
#=GS A0A1B6PKN0_SORBI/90-178     AC A0A1B6PKN0.1
#=GS W1SJF4_9BACI/485-593        AC W1SJF4.1
#=GS A0A0P1AG99_9STRA/189-295    AC A0A0P1AG99.1
#=GS A0A0G0NC38_9BACT/42-125     AC A0A0G0NC38.1
#=GS A0A0N1NFS7_9ACTN/74-179     AC A0A0N1NFS7.1
#=GS A0A059DFE8_EUCGR/1-85       AC A0A059DFE8.1
#=GS A0A0B8PU02_9VIBR/64-150     AC A0A0B8PU02.1
#=GS A0A168F9L9_CORDF/34-120     AC A0A168F9L9.1
#=GS A0A0L0NG60_9HYPO/23-113     AC A0A0L0NG60.1
#=GS K0JZC5_SACES/44-134         AC K0JZC5.1
#=GS I4DHV7_ORYSJ/173-281        AC I4DHV7.1
#=GS A0A0D3FKI8_9ORYZ/68-155     AC A0A0D3FKI8.1
#=GS M5VU99_PRUPE/66-156         AC M5VU99.1
#=GS A8J3E9_CHLRE/67-186         AC A8J3E9.1
#=GS D0NUN3_PHYIT/111-208        AC D0NUN3.1
#=GS E3JBW9_FRASU/51-145         AC E3JBW9.1
#=GS G0RHA2_HYPJQ/34-120         AC G0RHA2.1
#=GS A0A0D9XP48_9ORYZ/219-308    AC A0A0D9XP48.1
#=GS PPA11_ARATH/54-130          AC Q9SI18.1
#=GS C4Q6M8_SCHMA/41-132         AC C4Q6M8.2
#=GS A0A0F4K506_9ACTN/78-183     AC A0A0F4K506.1
#=GS A0A0H2KT56_9MICO/235-329    AC A0A0H2KT56.1
#=GS V4AHM2_LOTGI/25-117         AC V4AHM2.1
#=GS G9MZW9_HYPVG/34-121         AC G9MZW9.1
#=GS L0G1G5_ECHVK/29-116         AC L0G1G5.1
#=GS X8FM88_MYCUL/63-157         AC X8FM88.1
#=GS D7MBM6_ARALL/51-147         AC D7MBM6.1
#=GS A0A0G0EKL6_9BACT/1908-1996  AC A0A0G0EKL6.1
#=GS W5FLX6_WHEAT/174-282        AC W5FLX6.1
#=GS F6W4G5_ORNAN/8-147          AC F6W4G5.1
#=GS A0A0D2P079_GOSRA/169-277    AC A0A0D2P079.1
#=GS U7PSI1_SPOS1/25-116         AC U7PSI1.1
#=GS A0A0G1WBG5_9BACT/256-348    AC A0A0G1WBG5.1
#=GS A0A0M2Y1G6_9SPHI/28-128     AC A0A0M2Y1G6.1
#=GS C9KKM6_9FIRM/74-162         AC C9KKM6.1
#=GS A0A0G0BSZ4_9BACT/84-171     AC A0A0G0BSZ4.1
#=GS B3MQN7_DROAN/40-144         AC B3MQN7.1
#=GS R4KAZ7_9FIRM/35-142         AC R4KAZ7.1
#=GS Q9VZ58_DROME/38-132         AC Q9VZ58.1
#=GS K3Z5V8_SETIT/66-157         AC K3Z5V8.1
#=GS A0A0B8N0F6_9EURO/36-123     AC A0A0B8N0F6.1
#=GS D7U5K3_VITVI/63-154         AC D7U5K3.1
#=GS W9SND1_9ROSA/52-148         AC W9SND1.1
#=GS V9EDV8_PHYPR/95-193         AC V9EDV8.1
#=GS A0A0Q9JDI3_9BACL/33-121     AC A0A0Q9JDI3.1
#=GS A0A074KWP3_9BACT/38-123     AC A0A074KWP3.1
#=GS A0A0G0E6A2_9BACT/1779-1863  AC A0A0G0E6A2.1
#=GS A0A0G3GWR7_9CORY/33-122     AC A0A0G3GWR7.1
#=GS C5XMG6_SORBI/208-311        AC C5XMG6.1
#=GS I0RXD7_MYCXE/66-159         AC I0RXD7.1
#=GS D8RHK7_SELML/1-96           AC D8RHK7.1
#=GS L8HCK0_ACACA/307-409        AC L8HCK0.1
#=GS A0A0R0AZW9_9GAMM/39-134     AC A0A0R0AZW9.1
#=GS A0A059A6Z4_EUCGR/185-293    AC A0A059A6Z4.1
#=GS A0A075K9Z9_9FIRM/34-127     AC A0A075K9Z9.1
#=GS A0A0D9Y1T8_9ORYZ/777-873    AC A0A0D9Y1T8.1
#=GS A0A0G1ZVJ1_9BACT/237-327    AC A0A0G1ZVJ1.1
#=GS R5XZJ1_9CLOT/60-148         AC R5XZJ1.1
#=GS G7JA61_MEDTR/71-183         AC G7JA61.2
#=GS Q24GM0_TETTS/267-369        AC Q24GM0.1
#=GS A0A067DIL4_CITSI/86-198     AC A0A067DIL4.1
#=GS U6Q3A1_9CLOT/987-1097       AC U6Q3A1.1
#=GS A0A0L0LK32_9BACT/160-246    AC A0A0L0LK32.1
#=GS M4EDN0_BRARP/178-286        AC M4EDN0.1
#=GS H2K9C5_STRHJ/71-176         AC H2K9C5.1
#=GS A0A0D3HIB6_9ORYZ/56-143     AC A0A0D3HIB6.1
#=GS A0A0L9TR24_PHAAN/53-144     AC A0A0L9TR24.1
#=GS Q4WE06_ASPFU/69-173         AC Q4WE06.1
#=GS A0A162NQH5_9BACT/48-146     AC A0A162NQH5.1
#=GS Q6ZI95_ORYSJ/177-288        AC Q6ZI95.1
#=GS A0A0D6TIB4_9FLAO/20-110     AC A0A0D6TIB4.1
#=GS R7C6Z3_9CLOT/1-91           AC R7C6Z3.1
#=GS N1RV39_FUSC4/28-116         AC N1RV39.1
#=GS A0A0Q4H5Z5_9MICO/247-338    AC A0A0Q4H5Z5.1
#=GS E6U7F2_ETHHY/48-185         AC E6U7F2.1
#=GS A0A0S4JC58_BODSA/177-271    AC A0A0S4JC58.1
#=GS A0A0N0A428_9NOCA/41-155     AC A0A0N0A428.1
#=GS A0A0D2U3R3_GOSRA/58-149     AC A0A0D2U3R3.1
#=GS A9S5K7_PHYPA/49-138         AC A9S5K7.1
#=GS R5IK64_9PORP/43-137         AC R5IK64.1
#=GS A0A167G2Z7_9BACL/35-133     AC A0A167G2Z7.1
#=GS Q0AVJ0_SYNWW/46-138         AC Q0AVJ0.1
#=GS J3NEE8_ORYBR/176-284        AC J3NEE8.1
#=GS A0A0G0JA05_9BACT/1103-1196  AC A0A0G0JA05.1
#=GS A0A1B6PIK2_SORBI/205-323    AC A0A1B6PIK2.1
#=GS A0A0T6LTE4_9ACTN/82-187     AC A0A0T6LTE4.1
#=GS A0A0V0YRR7_9BILA/3-70       AC A0A0V0YRR7.1
#=GS W5H5P4_WHEAT/74-166         AC W5H5P4.1
#=GS A0A099WB08_9LIST/222-319    AC A0A099WB08.1
#=GS W2YSW4_PHYPR/243-349        AC W2YSW4.1
#=GS A0A0N1KM94_9BURK/55-151     AC A0A0N1KM94.1
#=GS H0WY64_OTOGA/32-125         AC H0WY64.1
#=GS R0HJI3_9BRAS/44-135         AC R0HJI3.1
#=GS F4KTN8_HALH1/29-118         AC F4KTN8.1
#=GS Q2QLL6_ORYSJ/66-131         AC Q2QLL6.1
#=GS A0A0G1TBW8_9BACT/278-373    AC A0A0G1TBW8.1
#=GS M0WKF8_HORVD/63-176         AC M0WKF8.1
#=GS W9R991_9ROSA/54-165         AC W9R991.1
#=GS L7F9E2_9ACTN/77-182         AC L7F9E2.1
#=GS R6E1I5_9BACE/25-132         AC R6E1I5.1
#=GS A0A067S7A9_9AGAR/38-128     AC A0A067S7A9.1
#=GS A9PF43_POPTR/77-192         AC A9PF43.1
#=GS A0A0S2TEK9_9GAMM/575-676    AC A0A0S2TEK9.1
#=GS A0A0M2YZ16_9ACTN/74-179     AC A0A0M2YZ16.1
#=GS D3F6U4_CONWI/47-163         AC D3F6U4.1
#=GS A0A0D1WYJ2_9EURO/69-172     AC A0A0D1WYJ2.1
#=GS A0A0C9MZ00_SPHPI/45-138     AC A0A0C9MZ00.1
#=GS A0A087H7R4_ARAAL/74-186     AC A0A087H7R4.1
#=GS A2WW15_ORYSI/85-186         AC A2WW15.1
#=GS A0A089IRM8_9BACL/316-426    AC A0A089IRM8.1
#=GS A0A194RHJ9_PAPMA/33-124     AC A0A194RHJ9.1
#=GS A0A074XFE4_AURPU/71-174     AC A0A074XFE4.1
#=GS J1K108_9RHIZ/72-218         AC J1K108.1
#=GS D7MHN1_ARALL/53-144         AC D7MHN1.1
#=GS F7W6U3_SORMK/27-101         AC F7W6U3.1
#=GS S8EB77_9LAMI/171-279        AC S8EB77.1
#=GS R6XFP2_9FIRM/227-328        AC R6XFP2.1
#=GS A0A0P1AWD5_9STRA/1-83       AC A0A0P1AWD5.1
#=GS V9EGJ3_PHYPR/20-120         AC V9EGJ3.1
#=GS M1BIV5_SOLTU/218-320        AC M1BIV5.1
#=GS M7YZ57_TRIUA/181-284        AC M7YZ57.1
#=GS A0A0F4Z5N0_TALEM/29-116     AC A0A0F4Z5N0.1
#=GS A0A101HIM7_9PORP/220-317    AC A0A101HIM7.1
#=GS W5I3D6_WHEAT/55-146         AC W5I3D6.1
#=GS Q9VZ57_DROME/38-131         AC Q9VZ57.1
#=GS A0A0S7X283_9BACT/212-302    AC A0A0S7X283.1
#=GS A0A072VTY2_MEDTR/194-297    AC A0A072VTY2.1
#=GS S8C1Q7_9LAMI/57-149         AC S8C1Q7.1
#=GS L5KMS2_PTEAL/35-128         AC L5KMS2.1
#=GS A9URA5_MONBE/27-126         AC A9URA5.1
#=GS W2PUM3_PHYPN/243-349        AC W2PUM3.1
#=GS A0A0L0N0Z7_9HYPO/39-128     AC A0A0L0N0Z7.1
#=GS K4CBX6_SOLLC/187-295        AC K4CBX6.1
#=GS W6QHE1_PENRF/33-122         AC W6QHE1.1
#=GS A0A0N5BAV9_STREA/79-175     AC A0A0N5BAV9.1
#=GS H3HAI8_PHYRM/71-168         AC H3HAI8.3
#=GS A0A1B6PDP5_SORBI/168-276    AC A0A1B6PDP5.1
#=GS G8TEK4_NIAKG/34-115         AC G8TEK4.1
#=GS A0A0E0ACE9_9ORYZ/54-145     AC A0A0E0ACE9.1
#=GS G9YFZ7_9FIRM/29-124         AC G9YFZ7.1
#=GS H2SPA2_TAKRU/408-499        AC H2SPA2.1
#=GS A0A0D3DXG6_BRAOL/145-248    AC A0A0D3DXG6.1
#=GS H3NKV8_9LACT/94-260         AC H3NKV8.1
#=GS B9S512_RICCO/79-191         AC B9S512.1
#=GS A0A0D9VVS2_9ORYZ/92-179     AC A0A0D9VVS2.1
#=GS A0A0D9ZFS8_9ORYZ/8-89       AC A0A0D9ZFS8.1
#=GS A0A101SSU4_9ACTN/78-183     AC A0A101SSU4.1
#=GS A0A0C1FDP5_9SPHI/44-143     AC A0A0C1FDP5.1
#=GS B8BJ51_ORYSI/56-144         AC B8BJ51.1
#=GS V7AD87_PHAVU/217-319        AC V7AD87.1
#=GS W5BR98_WHEAT/1-43           AC W5BR98.1
#=GS A0A0D3H8N5_9ORYZ/178-289    AC A0A0D3H8N5.1
#=GS A0A0K9QJ04_SPIOL/176-284    AC A0A0K9QJ04.1
#=GS A0A0K9PN95_ZOSMR/57-149     AC A0A0K9PN95.1
#=GS B8BN70_ORYSI/57-151         AC B8BN70.1
#=GS M4EZR4_BRARP/60-151         AC M4EZR4.1
#=GS U7PSG6_SPOS1/72-176         AC U7PSG6.1
#=GS A0A0C1VKH4_9ACTN/81-187     AC A0A0C1VKH4.1
#=GS A0A0P0XZH6_ORYSJ/100-189    AC A0A0P0XZH6.1
#=GS A0A0J9V2D1_FUSO4/50-138     AC A0A0J9V2D1.1
#=GS M0SF11_MUSAM/170-278        AC M0SF11.1
#=GS J1L4T2_9EURY/29-106         AC J1L4T2.1
#=GS A0A0N8K3V1_9RHOB/241-340    AC A0A0N8K3V1.1
#=GS D3IJN0_9BACT/35-123         AC D3IJN0.1
#=GS B4M7R1_DROVI/46-140         AC B4M7R1.2
#=GS A0A0D1AMG7_9SPHN/53-149     AC A0A0D1AMG7.1
#=GS A0A0U3PNR7_9ACTN/80-185     AC A0A0U3PNR7.1
#=GS A0A059DG26_EUCGR/56-143     AC A0A059DG26.1
#=GS A0A152A5S8_9MYCE/29-129     AC A0A152A5S8.1
#=GS D8RMJ0_SELML/62-153         AC D8RMJ0.1
#=GS U4U327_DENPD/26-117         AC U4U327.1
#=GS A0A0G1BZF4_9BACT/1790-1877  AC A0A0G1BZF4.1
#=GS D3B6U1_POLPA/32-129         AC D3B6U1.1
#=GS W5F9N2_WHEAT/17-108         AC W5F9N2.1
#=GS A0A0D3HIB4_9ORYZ/171-260    AC A0A0D3HIB4.1
#=GS A0A151TLN0_CAJCA/54-145     AC A0A151TLN0.1
#=GS A0A0L9ULM6_PHAAN/50-142     AC A0A0L9ULM6.1
#=GS D7KQJ7_ARALL/142-250        AC D7KQJ7.1
#=GS A0A102CYR5_9BACT/32-121     AC A0A102CYR5.1
#=GS C5XLM4_SORBI/68-159         AC C5XLM4.1
#=GS A0A067GDK8_CITSI/59-150     AC A0A067GDK8.1
#=GS D0N2Z3_PHYIT/189-293        AC D0N2Z3.1
#=GS B4EKR2_BURCJ/53-150         AC B4EKR2.1
#=GS A0A103DWK7_9BURK/36-132     AC A0A103DWK7.1
#=GS A0A0A2VQD4_BEABA/34-123     AC A0A0A2VQD4.1
#=GS C5LTK3_PERM5/11-144         AC C5LTK3.1
#=GS I1PI45_ORYGL/166-274        AC I1PI45.1
#=GS L8GNJ7_ACACA/1-75           AC L8GNJ7.1
#=GS R5R2S1_9FIRM/239-333        AC R5R2S1.1
#=GS L1QCP3_9CLOT/62-149         AC L1QCP3.1
#=GS D7T9W8_VITVI/229-337        AC D7T9W8.1
#=GS A0A117RZF8_9ACTN/90-195     AC A0A117RZF8.1
#=GS A0A078FT75_BRANA/145-248    AC A0A078FT75.1
#=GS A0A0D3H8N6_9ORYZ/157-265    AC A0A0D3H8N6.1
#=GS A0A0L0QLN7_VIRPA/700-799    AC A0A0L0QLN7.1
#=GS A0A0G1C6K6_9BACT/34-119     AC A0A0G1C6K6.1
#=GS A0A074L068_9BACT/44-144     AC A0A074L068.1
#=GS A0A0G1BZF4_9BACT/1655-1745  AC A0A0G1BZF4.1
#=GS A0A0G0RIB3_9BACT/43-129     AC A0A0G0RIB3.1
#=GS T0S7S1_9STRA/25-119         AC T0S7S1.1
#=GS A0A0B4HKR0_9HYPO/69-171     AC A0A0B4HKR0.1
#=GS A0A0L9V8E0_PHAAN/54-146     AC A0A0L9V8E0.1
#=GS A0A0U1LZV7_9EURO/330-416    AC A0A0U1LZV7.1
#=GS Q2TY95_ASPOR/68-171         AC Q2TY95.1
#=GS A0A061EAS8_THECC/171-279    AC A0A061EAS8.1
#=GS A0A023BX03_9FLAO/21-112     AC A0A023BX03.1
#=GS M0YS06_HORVD/47-135         AC M0YS06.1
#=GS M7Z1C7_TRIUA/53-140         AC M7Z1C7.1
#=GS G0LAW7_ZOBGA/29-113         AC G0LAW7.1
#=GS A0A059CXQ5_EUCGR/63-154     AC A0A059CXQ5.1
#=GS W5G2V5_WHEAT/174-282        AC W5G2V5.1
#=GS W7YV21_9BACL/102-198        AC W7YV21.1
#=GS M0T9R0_MUSAM/43-130         AC M0T9R0.1
#=GS A0A133ZMJ6_9CORY/34-120     AC A0A133ZMJ6.1
#=GS B8AAW1_ORYSI/206-309        AC B8AAW1.1
#=GS M4ELF6_BRARP/71-183         AC M4ELF6.1
#=GS A0A0D9V6F3_9ORYZ/55-146     AC A0A0D9V6F3.1
#=GS A0A0D1JZU6_9MYCO/53-146     AC A0A0D1JZU6.1
#=GS B4JMN4_DROGR/15-112         AC B4JMN4.1
#=GS A0A0G0GKE2_9BACT/48-141     AC A0A0G0GKE2.1
#=GS K3YLE6_SETIT/158-269        AC K3YLE6.1
#=GS R5BD39_9FIRM/59-157         AC R5BD39.1
#=GS A0A016V969_9BILA/12-97      AC A0A016V969.1
#=GS M5VQF9_PRUPE/19-110         AC M5VQF9.1
#=GS D8SLM4_SELML/62-153         AC D8SLM4.1
#=GS A0A0G0I9G2_9BACT/120-217    AC A0A0G0I9G2.1
#=GS R5AWN8_9BACE/257-354        AC R5AWN8.1
#=GS A0A176VHJ1_MARPO/220-329    AC A0A176VHJ1.1
#=GS A0A0K9RCQ9_SPIOL/218-326    AC A0A0K9RCQ9.1
#=GS A0A0K1PZR4_9DELT/1144-1237  AC A0A0K1PZR4.1
#=GS A0A098F3A5_9BACI/985-1090   AC A0A098F3A5.1
#=GS A0A168C8H4_CORDF/26-115     AC A0A168C8H4.1
#=GS B8MJR7_TALSN/36-123         AC B8MJR7.1
#=GS A0A0W7VZQ8_9HYPO/34-120     AC A0A0W7VZQ8.1
#=GS B2FLX5_STRMK/45-140         AC B2FLX5.1
#=GS A0A0J8BGM4_BETVU/219-321    AC A0A0J8BGM4.1
#=GS G2P277_STRVO/82-187         AC G2P277.1
#=GS U5FFI0_POPTR/63-154         AC U5FFI0.1
#=GS A0A0G1AUX7_9BACT/1235-1330  AC A0A0G1AUX7.1
#=GS M0W2V5_HORVD/98-206         AC M0W2V5.1
#=GS D7LUA9_ARALL/44-133         AC D7LUA9.1
#=GS A0A0K9XCF4_9ACTN/82-187     AC A0A0K9XCF4.1
#=GS G4YIT8_PHYSP/197-303        AC G4YIT8.1
#=GS C7PUL7_CHIPD/51-147         AC C7PUL7.1
#=GS I0GVQ5_SELRL/57-146         AC I0GVQ5.1
#=GS A0A059A641_EUCGR/185-293    AC A0A059A641.1
#=GS A0A0M9ZMJ3_9ACTN/74-179     AC A0A0M9ZMJ3.1
#=GS A0A132AKY9_SARSC/9-99       AC A0A132AKY9.1
#=GS A0A0D2TSP5_GOSRA/4-94       AC A0A0D2TSP5.1
#=GS V4S1N1_9ROSI/86-198         AC V4S1N1.1
#=GS A0A0B5EVH6_STRA4/81-186     AC A0A0B5EVH6.1
#=GS A0A0A1T6V4_9HYPO/73-174     AC A0A0A1T6V4.1
#=GS J9R0E5_RIEAN/53-180         AC J9R0E5.1
#=GS R0FVU9_9BRAS/54-145         AC R0FVU9.1
#=GS A0A0F4P0M9_PSEO7/24-112     AC A0A0F4P0M9.1
#=GS Q82JN5_STRAW/105-210        AC Q82JN5.1
#=GS A0A078BQP7_CAEEL/1-64       AC A0A078BQP7.1
#=GS A0A0L9U563_PHAAN/71-183     AC A0A0L9U563.1
#=GS R7I2U7_9CLOT/1-91           AC R7I2U7.1
#=GS I0YTQ3_COCSC/127-219        AC I0YTQ3.1
#=GS W2Z5X0_PHYPR/198-304        AC W2Z5X0.1
#=GS G7K8G7_MEDTR/49-138         AC G7K8G7.1
#=GS R5CGX0_9FIRM/57-152         AC R5CGX0.1
#=GS A0A0G1YKH6_9BACT/141-227    AC A0A0G1YKH6.1
#=GS A0A152A8H9_9MYCE/178-298    AC A0A152A8H9.1
#=GS A0A183BKX1_GLOPA/58-150     AC A0A183BKX1.1
#=GS W9ST17_9ROSA/71-183         AC W9ST17.1
#=GS I1LP06_SOYBN/106-208        AC I1LP06.2
#=GS W7YV21_9BACL/541-638        AC W7YV21.1
#=GS A0A0R0CMR0_9GAMM/32-127     AC A0A0R0CMR0.1
#=GS U5FH15_POPTR/63-154         AC U5FH15.1
#=GS R5AJK2_9BACT/506-609        AC R5AJK2.1
#=GS A0A132AKG0_SARSC/1-80       AC A0A132AKG0.1
#=GS A0A0N1G342_9ACTN/79-185     AC A0A0N1G342.1
#=GS A0A0P9ETN2_RHOGW/1-80       AC A0A0P9ETN2.1
#=GS A0A0E0RKH4_ORYRU/59-150     AC A0A0E0RKH4.1
#=GS A0A176W2M9_MARPO/74-166     AC A0A176W2M9.1
#=GS A0A150MDV3_9BACI/41-137     AC A0A150MDV3.1
#=GS K0YR79_9CORY/50-141         AC K0YR79.1
#=GS A0A0G0IC78_9BACT/584-684    AC A0A0G0IC78.1
#=GS V9DVT3_PHYPR/199-305        AC V9DVT3.1
#=GS V4M3T9_EUTSA/61-152         AC V4M3T9.1
#=GS A0A0G1XQJ1_9BACT/550-650    AC A0A0G1XQJ1.1
#=GS A0A061FD44_THECC/45-134     AC A0A061FD44.1
#=GS A0A090LQY9_STRRB/27-122     AC A0A090LQY9.1
#=GS A0A139WZN4_9CYAN/9-119      AC A0A139WZN4.1
#=GS W5FBI2_WHEAT/178-287        AC W5FBI2.1
#=GS A0A0K9QN59_SPIOL/64-155     AC A0A0K9QN59.1
#=GS G7XII2_ASPKW/70-173         AC G7XII2.1
#=GS T0Q8K1_9STRA/70-169         AC T0Q8K1.1
#=GS A0A0L0DMA7_THETB/28-118     AC A0A0L0DMA7.1
#=GS A0A0M2XZA0_9SPHI/30-126     AC A0A0M2XZA0.1
#=GS A0A061GIQ7_THECC/63-154     AC A0A061GIQ7.1
#=GS A0A0D2RL65_GOSRA/60-151     AC A0A0D2RL65.1
#=GS A0A0W8DVY2_PHYNI/107-222    AC A0A0W8DVY2.1
#=GS A0A059CL76_EUCGR/55-146     AC A0A059CL76.1
#=GS A0A0D2VHQ3_GOSRA/56-147     AC A0A0D2VHQ3.1
#=GS M0XWB1_HORVD/108-197        AC M0XWB1.1
#=GS B9SRV6_RICCO/1-75           AC B9SRV6.1
#=GS F4EW18_SELS3/47-137         AC F4EW18.1
#=GS A0A0G0XTJ7_9BACT/43-128     AC A0A0G0XTJ7.1
#=GS D7L636_ARALL/64-176         AC D7L636.1
#=GS A0A096UEP2_MAIZE/174-282    AC A0A096UEP2.1
#=GS A0A147JXI4_9EURY/520-604    AC A0A147JXI4.1
#=GS K9QTU8_NOSS7/36-156         AC K9QTU8.1
#=GS A0A150AHW4_9BACT/45-148     AC A0A150AHW4.1
#=GS A0A0G1YMU0_9BACT/128-218    AC A0A0G1YMU0.1
#=GS A0A0D3HX61_9ORYZ/516-610    AC A0A0D3HX61.1
#=GS B6QKE0_TALMQ/29-116         AC B6QKE0.1
#=GS J3L4Y1_ORYBR/210-313        AC J3L4Y1.1
#=GS M5RHP0_9PLAN/2-98           AC M5RHP0.1
#=GS PPA6_ARATH/50-147           AC Q9C510.1
#=GS A0A0G1WH45_9BACT/416-504    AC A0A0G1WH45.1
#=GS G2Q6P4_MYCTT/72-174         AC G2Q6P4.1
#=GS T1JVC5_TETUR/23-113         AC T1JVC5.1
#=GS I1GNM1_BRADI/51-145         AC I1GNM1.1
#=GS D3BNI1_POLPA/11-108         AC D3BNI1.1
#=GS A0A0G1QVM7_9BACT/1590-1675  AC A0A0G1QVM7.1
#=GS A0A0G1U4P6_9BACT/512-602    AC A0A0G1U4P6.1
#=GS A9RPR4_PHYPA/164-266        AC A9RPR4.1
#=GS V4U3U7_9ROSI/76-188         AC V4U3U7.1
#=GS A0A0E0RKH2_ORYRU/464-558    AC A0A0E0RKH2.1
#=GS A0A0K0FUZ8_9BILA/14-102     AC A0A0K0FUZ8.1
#=GS A0A0E0RKH4_ORYRU/445-539    AC A0A0E0RKH4.1
#=GS M8AQC5_TRIUA/17-108         AC M8AQC5.1
#=GS G2RGJ3_THITE/36-121         AC G2RGJ3.1
#=GS A0A0A1V6C6_9HYPO/69-171     AC A0A0A1V6C6.1
#=GS A0A0D2UCQ1_GOSRA/60-151     AC A0A0D2UCQ1.1
#=GS F2UKX4_SALR5/99-190         AC F2UKX4.1
#=GS K4A790_SETIT/171-279        AC K4A790.1
#=GS A0A0G0JA05_9BACT/1200-1290  AC A0A0G0JA05.1
#=GS H3GBF7_PHYRM/46-161         AC H3GBF7.1
#=GS Q0CWA3_ASPTN/67-171         AC Q0CWA3.1
#=GS A0A0T5ZZ07_9BACT/1-62       AC A0A0T5ZZ07.1
#=GS W5FCY0_WHEAT/85-203         AC W5FCY0.1
#=GS K4CQY9_SOLLC/48-136         AC K4CQY9.1
#=GS A0A0A0LR86_CUCSA/177-285    AC A0A0A0LR86.1
#=GS C4IIN9_CLOBU/61-149         AC C4IIN9.1
#=GS W9RAH0_9ROSA/203-311        AC W9RAH0.1
#=GS A0A0D9Y1T9_9ORYZ/65-137     AC A0A0D9Y1T9.1
#=GS A0A0D2SAD0_GOSRA/73-185     AC A0A0D2SAD0.1
#=GS A0A024GJF9_9STRA/39-144     AC A0A024GJF9.1
#=GS A0A078IWD1_BRANA/53-147     AC A0A078IWD1.1
#=GS A0A0E0N3Q1_ORYRU/206-309    AC A0A0E0N3Q1.1
#=GS M0Y7U1_HORVD/85-177         AC M0Y7U1.1
#=GS U5CYW7_AMBTC/86-177         AC U5CYW7.1
#=GS A0A0R3P3Y3_DROPS/42-143     AC A0A0R3P3Y3.1
#=GS A8XTP7_CAEBR/46-139         AC A8XTP7.2
#=GS A0A0C2ZBS2_9HOMO/1-79       AC A0A0C2ZBS2.1
#=GS A0A0G1U8B4_9BACT/1567-1665  AC A0A0G1U8B4.1
#=GS K8Z245_NANGC/45-168         AC K8Z245.1
#=GS R5UXL6_9BACT/265-353        AC R5UXL6.1
#=GS B5GCP1_STRSH/62-157         AC B5GCP1.1
#=GS A0A0N4ZQH4_PARTI/26-119     AC A0A0N4ZQH4.1
#=GS A0A0N1FSY9_9ACTN/78-183     AC A0A0N1FSY9.1
#=GS W7SUE8_9PSEU/51-144         AC W7SUE8.1
#=GS F0SF17_PSESL/21-113         AC F0SF17.1
#=GS A0A0G4J5I3_PLABS/166-257    AC A0A0G4J5I3.1
#=GS L8FYE5_PSED2/70-174         AC L8FYE5.1
#=GS R6YVF7_9BACE/45-136         AC R6YVF7.1
#=GS F0XBL4_GROCL/70-173         AC F0XBL4.1
#=GS A0A0G1WH45_9BACT/216-306    AC A0A0G1WH45.1
#=GS A0A0A0LWA9_CUCSA/62-153     AC A0A0A0LWA9.1
#=GS A0A044UEU8_ONCVO/46-137     AC A0A044UEU8.1
#=GS A6DMR8_9BACT/24-105         AC A6DMR8.1
#=GS U5HIV4_USTV1/56-149         AC U5HIV4.1
#=GS E9ENB8_METRA/26-116         AC E9ENB8.1
#=GS W4FSD2_9STRA/128-237        AC W4FSD2.1
#=GS R5IYI8_9CLOT/55-151         AC R5IYI8.1
#=GS M4CRV9_BRARP/60-147         AC M4CRV9.1
#=GS C3ZZU0_BRAFL/24-115         AC C3ZZU0.1
#=GS M4FGY5_BRARP/75-186         AC M4FGY5.1
#=GS A0A0G1K2Y4_9BACT/34-120     AC A0A0G1K2Y4.1
#=GS A0A059BLC6_EUCGR/1-77       AC A0A059BLC6.1
#=GS A0A0D3BK13_BRAOL/49-144     AC A0A0D3BK13.1
#=GS A0A176W291_MARPO/78-169     AC A0A176W291.1
#=GS A0A101NYA6_9ACTN/74-179     AC A0A101NYA6.1
#=GS Q54BS2_DICDI/21-117         AC Q54BS2.1
#=GS A0A0V2FD45_CAUVI/43-143     AC A0A0V2FD45.1
#=GS G0IXK3_CYCMS/231-326        AC G0IXK3.1
#=GS A0A0G0IBQ4_9BACT/822-915    AC A0A0G0IBQ4.1
#=GS A0A0G1U6G5_9BACT/47-137     AC A0A0G1U6G5.1
#=GS A0A0L9VP92_PHAAN/74-185     AC A0A0L9VP92.1
#=GS Q7XVG3_ORYSJ/52-141         AC Q7XVG3.1
#=GS PPA21_ARATH/51-138          AC Q9LXI4.1
#=GS A0A101EYK0_9BACT/25-115     AC A0A101EYK0.1
#=GS M0USG3_HORVD/55-146         AC M0USG3.1
#=GS A0A0E0B509_9ORYZ/186-294    AC A0A0E0B509.1
#=GS A0A158NSC8_ATTCE/30-121     AC A0A158NSC8.1
#=GS A0A0D2JRB2_9DELT/123-217    AC A0A0D2JRB2.1
#=GS B8M2M8_TALSN/32-119         AC B8M2M8.1
#=GS M5WCJ4_PRUPE/166-274        AC M5WCJ4.1
#=GS V4AER7_LOTGI/168-263        AC V4AER7.1
#=GS N4UF48_FUSC1/69-170         AC N4UF48.1
#=GS W5EW95_WHEAT/27-67          AC W5EW95.1
#=GS F4L0X8_HALH1/22-113         AC F4L0X8.1
#=GS F0ZBD3_DICPU/24-120         AC F0ZBD3.1
#=GS W2T0P9_NECAM/1-72           AC W2T0P9.1
#=GS A0A0E0BVP5_9ORYZ/58-149     AC A0A0E0BVP5.1
#=GS W5F648_WHEAT/139-247        AC W5F648.1
#=GS A0A0G1LBR3_9BACT/42-128     AC A0A0G1LBR3.1
#=GS B9IJI2_POPTR/70-182         AC B9IJI2.2
#=GS A0A0M9ZJU6_9ACTN/56-149     AC A0A0M9ZJU6.1
#=GS A0A0D2QJD8_GOSRA/61-152     AC A0A0D2QJD8.1
#=GS A0A024GVU8_9STRA/140-246    AC A0A024GVU8.1
#=GS A0A078H7F7_BRANA/178-286    AC A0A078H7F7.1
#=GS A6C7F2_9PLAN/41-137         AC A6C7F2.1
#=GS A0A0D2SE28_GOSRA/97-209     AC A0A0D2SE28.1
#=GS A0A151SR68_CAJCA/453-544    AC A0A151SR68.1
#=GS M7ZW23_TRIUA/161-253        AC M7ZW23.1
#=GS A0A078IC94_BRANA/61-152     AC A0A078IC94.1
#=GS A0A0D2X5D2_CAPO3/144-244    AC A0A0D2X5D2.1
#=GS A0A0K0FU16_9BILA/79-175     AC A0A0K0FU16.1
#=GS A0A091DBW4_FUKDA/28-121     AC A0A091DBW4.1
#=GS E3NI17_CAERE/20-115         AC E3NI17.1
#=GS A0A074XWF3_AURPU/33-122     AC A0A074XWF3.1
#=GS A0A0B0NR04_GOSAR/59-150     AC A0A0B0NR04.1
#=GS L0DPB6_SINAD/41-133         AC L0DPB6.1
#=GS L1M9J8_9BACT/45-136         AC L1M9J8.1
#=GS A0A069DLN1_9BACL/1078-1177  AC A0A069DLN1.1
#=GS A0A0G1PKU7_9BACT/1476-1567  AC A0A0G1PKU7.1
#=GS A0A0D9XA43_9ORYZ/178-275    AC A0A0D9XA43.1
#=GS R9AG81_WALI9/22-118         AC R9AG81.1
#=GS A0A0N0A900_9ACTN/70-175     AC A0A0N0A900.1
#=GS A0A0D9ZFS6_9ORYZ/63-176     AC A0A0D9ZFS6.1
#=GS R5GK44_9BACT/27-117         AC R5GK44.1
#=GS M8AZP4_TRIUA/44-135         AC M8AZP4.1
#=GS F2UHU8_SALR5/29-118         AC F2UHU8.1
#=GS M0ZWN4_SOLTU/17-108         AC M0ZWN4.1
#=GS E1VVZ0_GLUAR/220-311        AC E1VVZ0.1
#=GS G4Q306_ACIIR/31-121         AC G4Q306.1
#=GS M1VGQ9_CYAM1/128-235        AC M1VGQ9.1
#=GS A0A026WWS0_CERBI/22-113     AC A0A026WWS0.1
#=GS A0A0Q6Y5Q0_9MICO/55-152     AC A0A0Q6Y5Q0.1
#=GS A0A061E9V0_THECC/171-279    AC A0A061E9V0.1
#=GS F8K1E0_STREN/56-149         AC F8K1E0.1
#=GS A0A024JX34_9MYCO/68-162     AC A0A024JX34.1
#=GS A2XIP0_ORYSI/68-155         AC A2XIP0.1
#=GS S8DCH9_9LAMI/48-139         AC S8DCH9.1
#=GS A0A0B1TSC7_OESDE/40-134     AC A0A0B1TSC7.1
#=GS A0A0K8LC31_9EURO/34-123     AC A0A0K8LC31.1
#=GS A0A0G1HS13_9BACT/47-139     AC A0A0G1HS13.1
#=GS A0A0N0A473_9ACTN/75-180     AC A0A0N0A473.1
#=GS D2VI40_NAEGR/49-149         AC D2VI40.1
#=GS A0A0D2QJH5_GOSRA/169-277    AC A0A0D2QJH5.1
#=GS B6QIV6_TALMQ/35-122         AC B6QIV6.1
#=GS A0A0C2JJ49_THEKT/144-245    AC A0A0C2JJ49.1
#=GS A0A0G1Q3J8_9BACT/42-130     AC A0A0G1Q3J8.1
#=GS U3AS85_9CAUL/150-248        AC U3AS85.1
#=GS A0A0R3SYY7_HYMDI/18-106     AC A0A0R3SYY7.1
#=GS F2UJ11_SALR5/126-227        AC F2UJ11.1
#=GS A0A067LB35_JATCU/170-278    AC A0A067LB35.1
#=GS A0A0K9QP40_SPIOL/342-433    AC A0A0K9QP40.1
#=GS A0A078IFS5_BRANA/60-151     AC A0A078IFS5.1
#=GS L8H162_ACACA/156-258        AC L8H162.1
#=GS W2Y9V2_PHYPR/67-164         AC W2Y9V2.1
#=GS A0A0W8C5X2_PHYNI/243-349    AC A0A0W8C5X2.1
#=GS W5GCP3_WHEAT/63-155         AC W5GCP3.1
#=GS M4FFP5_BRARP/54-148         AC M4FFP5.1
#=GS A0A0W8BX37_PHYNI/201-306    AC A0A0W8BX37.1
#=GS M0QXC1_HUMAN/32-125         AC M0QXC1.1
#=GS R6I7G2_9FIRM/45-133         AC R6I7G2.1
#=GS A0A022QVD0_ERYGU/72-184     AC A0A022QVD0.1
#=GS V4UUP3_9ROSI/59-150         AC V4UUP3.1
#=GS K3XWN3_SETIT/55-145         AC K3XWN3.1
#=GS B8N7N3_ASPFN/34-123         AC B8N7N3.1
#=GS W7MWA6_GIBM7/76-178         AC W7MWA6.1
#=GS A0A0F0HUV3_9PSEU/52-145     AC A0A0F0HUV3.1
#=GS G0T437_SOYBN/145-251        AC G0T437.1
#=GS A0A0F7U1T8_9EURO/34-122     AC A0A0F7U1T8.1
#=GS A0A0E0JPF2_ORYPU/62-153     AC A0A0E0JPF2.1
#=GS A0A151TVS7_CAJCA/1-76       AC A0A151TVS7.1
#=GS A0A0E0Q3A6_ORYRU/142-247    AC A0A0E0Q3A6.1
#=GS H3EWH7_PRIPA/49-144         AC H3EWH7.1
#=GS A0A0Q4Q9G0_9BACL/599-705    AC A0A0Q4Q9G0.1
#=GS R9P097_PSEHS/34-120         AC R9P097.1
#=GS J2K5M6_9ACTN/86-191         AC J2K5M6.1
#=GS A0A059W8M0_STRA9/91-196     AC A0A059W8M0.1
#=GS A0A067Q9A0_9HOMO/40-127     AC A0A067Q9A0.1
#=GS F0XDX6_GROCL/33-122         AC F0XDX6.1
#=GS A0A0G1EBW3_9BACT/48-137     AC A0A0G1EBW3.1
#=GS Q0J0L3_ORYSJ/186-294        AC Q0J0L3.1
#=GS A0A0E0P3W8_ORYRU/63-176     AC A0A0E0P3W8.1
#=GS A0A024UTB7_9STRA/1-86       AC A0A024UTB7.1
#=GS V4U3L0_9ROSI/78-189         AC V4U3L0.1
#=GS D7MGL9_ARALL/172-280        AC D7MGL9.1
#=GS F9WZK8_ZYMTI/29-115         AC F9WZK8.1
#=GS A0A0Q5QBT8_9FLAO/21-110     AC A0A0Q5QBT8.1
#=GS R5K5D4_9CLOT/235-329        AC R5K5D4.1
#=GS A0A0P0NI43_9SPHI/33-131     AC A0A0P0NI43.1
#=GS A0A0K1JDW6_9MICO/67-160     AC A0A0K1JDW6.1
#=GS D7B7A3_NOCDD/36-123         AC D7B7A3.1
#=GS M4DJP3_BRARP/143-246        AC M4DJP3.1
#=GS A0A0N1EDF9_9SPHN/25-125     AC A0A0N1EDF9.1
#=GS A0A0G0QRS9_9BACT/174-263    AC A0A0G0QRS9.1
#=GS M0WRY8_HORVD/175-288        AC M0WRY8.1
#=GS A0A0G0BNC0_9BACT/308-396    AC A0A0G0BNC0.1
#=GS K3ZRC8_SETIT/150-254        AC K3ZRC8.1
#=GS R6HZQ0_9FIRM/49-138         AC R6HZQ0.1
#=GS J3NEE6_ORYBR/164-272        AC J3NEE6.1
#=GS Q93XG4_SOYBN/72-184         AC Q93XG4.1
#=GS R6VQY0_9BACT/287-387        AC R6VQY0.1
#=GS D7LG89_ARALL/60-151         AC D7LG89.1
#=GS C9RL59_FIBSS/785-865        AC C9RL59.1
#=GS F0ZSZ8_DICPU/136-240        AC F0ZSZ8.1
#=GS A0A0L8H6Z1_OCTBM/1-84       AC A0A0L8H6Z1.1
#=GS A0A090DV63_9CHLA/31-119     AC A0A090DV63.1
#=GS U7DZC7_POPTR/63-154         AC U7DZC7.1
#=GS A0A0A1MJW3_9FUNG/59-160     AC A0A0A1MJW3.1
#=GS A2YHH3_ORYSI/142-247        AC A2YHH3.1
#=GS A0A176VGE7_MARPO/220-319    AC A0A176VGE7.1
#=GS D7LB83_ARALL/54-148         AC D7LB83.1
#=GS A0A059ADB7_EUCGR/219-322    AC A0A059ADB7.1
#=GS I2JMH5_9GAMM/74-173         AC I2JMH5.1
#=GS B0WRM8_CULQU/25-116         AC B0WRM8.1
#=GS B4GTD5_DROPE/4-87           AC B4GTD5.1
#=GS A0A151TVN7_CAJCA/44-131     AC A0A151TVN7.1
#=GS K4BSC3_SOLLC/64-176         AC K4BSC3.1
#=GS H3GR12_PHYRM/205-310        AC H3GR12.1
#=GS A0A0D2U273_GOSRA/47-139     AC A0A0D2U273.1
#=GS A0A0E0MNX6_ORYPU/864-972    AC A0A0E0MNX6.1
#=GS K3WND8_PYTUL/77-174         AC K3WND8.1
#=GS A0A0G2ZXQ7_9DELT/229-312    AC A0A0G2ZXQ7.1
#=GS I7Z876_9GAMM/70-168         AC I7Z876.1
#=GS I1R7G6_ORYGL/120-228        AC I1R7G6.1
#=GS A0A087ZWE4_APIME/25-116     AC A0A087ZWE4.1
#=GS S8ED44_9LAMI/169-278        AC S8ED44.1
#=GS A0A0D3GLH5_9ORYZ/142-247    AC A0A0D3GLH5.1
#=GS A0A059LNF5_9CHLO/20-133     AC A0A059LNF5.1
#=GS C9Z590_STRSW/80-185         AC C9Z590.1
#=GS A0A0X8E2Z2_9MICO/240-331    AC A0A0X8E2Z2.1
#=GS D4YMS9_9MICO/37-133         AC D4YMS9.1
#=GS F4PNQ9_DICFS/30-186         AC F4PNQ9.1
#=GS F0ZBD4_DICPU/23-119         AC F0ZBD4.1
#=GS A0A0B2AF13_9MICC/64-157     AC A0A0B2AF13.1
#=GS A0A0K9PXA7_ZOSMR/51-142     AC A0A0K9PXA7.1
#=GS A0A1B6QJQ7_SORBI/108-195    AC A0A1B6QJQ7.1
#=GS A0A0D3H2H5_9ORYZ/177-288    AC A0A0D3H2H5.1
#=GS A0A059D7Z9_EUCGR/145-247    AC A0A059D7Z9.1
#=GS F6UAF3_ORNAN/34-110         AC F6UAF3.2
#=GS T1MCA0_TRIUA/171-300        AC T1MCA0.1
#=GS E1WXV8_HALMS/30-125         AC E1WXV8.1
#=GS A0A0J8BZ70_BETVU/57-143     AC A0A0J8BZ70.1
#=GS D8RZB9_SELML/170-283        AC D8RZB9.1
#=GS R6TIC8_9STAP/34-134         AC R6TIC8.1
#=GS F4PPK2_DICFS/171-279        AC F4PPK2.1
#=GS D2VG13_NAEGR/99-204         AC D2VG13.1
#=GS A0A0E0LX88_ORYPU/178-294    AC A0A0E0LX88.1
#=GS A0A0B8NIN9_9VIBR/47-131     AC A0A0B8NIN9.1
#=GS W6NDK4_CLOTY/53-147         AC W6NDK4.1
#=GS S2YDH2_9ACTN/74-179         AC S2YDH2.1
#=GS A0A0F7TWD5_9EURO/67-171     AC A0A0F7TWD5.1
#=GS A0A139I9Z6_9PEZI/399-502    AC A0A139I9Z6.1
#=GS A0A136P209_9CHLR/1502-1584  AC A0A136P209.1
#=GS D0MX64_PHYIT/201-306        AC D0MX64.1
#=GS M9MDW8_PSEA3/85-173         AC M9MDW8.1
#=GS A0A0G0T0X9_9BACT/724-814    AC A0A0G0T0X9.1
#=GS X0JA09_FUSOX/75-176         AC X0JA09.1
#=GS F0XB68_GROCL/30-120         AC F0XB68.1
#=GS A0A0U5CH83_9EURO/71-161     AC A0A0U5CH83.1
#=GS A0A0P1ACC3_9STRA/200-305    AC A0A0P1ACC3.1
#=GS G2PS40_MURRD/28-112         AC G2PS40.1
#=GS A0A0B2WR91_9HYPO/41-132     AC A0A0B2WR91.1
#=GS V5E3N3_KALBG/34-120         AC V5E3N3.1
#=GS D9XIU3_STRVT/82-187         AC D9XIU3.1
#=GS ACP7_MOUSE/32-125           AC Q8BX37.2
#=GS D7L1V7_ARALL/59-157         AC D7L1V7.1
#=GS A0A098LKA2_9BACT/165-246    AC A0A098LKA2.1
#=GS A0A0G0ZWR6_9BACT/235-336    AC A0A0G0ZWR6.1
#=GS F7G9N0_MONDO/38-131         AC F7G9N0.1
#=GS M7X328_RHOT1/86-189         AC M7X328.1
#=GS M0ULR7_HORVD/107-215        AC M0ULR7.1
#=GS A0A0U3P3K6_9LACT/53-205     AC A0A0U3P3K6.1
#=GS A0A175YNS7_DAUCA/142-245    AC A0A175YNS7.1
#=GS A0A177BWR5_9PLEO/34-120     AC A0A177BWR5.1
#=GS S2J469_MUCC1/43-140         AC S2J469.1
#=GS Q8H5T7_ORYSJ/142-247        AC Q8H5T7.1
#=GS A0A0E0RJ39_ORYRU/120-228    AC A0A0E0RJ39.1
#=GS A0A069KAM7_9ACTN/48-143     AC A0A069KAM7.1
#=GS A0A0A0KIN1_CUCSA/54-141     AC A0A0A0KIN1.1
#=GS E8R2J3_ISOPI/43-141         AC E8R2J3.1
#=GS A0A0C1YQ20_9CYAN/41-137     AC A0A0C1YQ20.1
#=GS A0A162I1A0_9HYPO/34-123     AC A0A162I1A0.1
#=GS A0A0K0FUM9_9BILA/28-125     AC A0A0K0FUM9.1
#=GS R6I8A0_9FIRM/38-131         AC R6I8A0.1
#=GS A0A162XP78_9FLAO/21-112     AC A0A162XP78.1
#=GS R6XJH7_9BACT/31-122         AC R6XJH7.1
#=GS A0A022RCP7_ERYGU/58-149     AC A0A022RCP7.1
#=GS A0A0M2Z802_9ACTN/68-161     AC A0A0M2Z802.1
#=GS G3J2J7_CORMM/29-104         AC G3J2J7.1
#=GS R6ACW7_9FIRM/43-135         AC R6ACW7.1
#=GS J5JRW6_BEAB2/34-123         AC J5JRW6.1
#=GS A2ZN54_ORYSI/59-150         AC A2ZN54.1
#=GS S8CDC9_9LAMI/1-89           AC S8CDC9.1
#=GS A0A0E0MNX4_ORYPU/1440-1548  AC A0A0E0MNX4.1
#=GS A0A164XGH0_DAUCA/168-276    AC A0A164XGH0.1
#=GS A9V8T6_MONBE/154-256        AC A9V8T6.1
#=GS G9P6D2_HYPAI/34-122         AC G9P6D2.1
#=GS A0A067JR67_JATCU/70-182     AC A0A067JR67.1
#=GS F0ZTM6_DICPU/12-139         AC F0ZTM6.1
#=GS A8WMV6_CAEBR/21-116         AC A8WMV6.1
#=GS D8S6N1_SELML/73-183         AC D8S6N1.1
#=GS A0A0J8BS79_BETVU/62-153     AC A0A0J8BS79.1
#=GS V6J737_9BACL/42-140         AC V6J737.1
#=GS A0A0G0FGQ6_9BACT/907-1002   AC A0A0G0FGQ6.1
#=GS B8BM28_ORYSI/52-144         AC B8BM28.1
#=GS A0A176WK56_MARPO/91-178     AC A0A176WK56.1
#=GS U5DBQ9_AMBTC/46-133         AC U5DBQ9.1
#=GS A0A176WCI7_MARPO/70-181     AC A0A176WCI7.1
#=GS B7Q0U0_IXOSC/16-108         AC B7Q0U0.1
#=GS A0A0K9RH06_SPIOL/70-181     AC A0A0K9RH06.1
#=GS A0A0G0A094_TRIHA/22-112     AC A0A0G0A094.1
#=GS A0A067CDN4_SAPPC/131-238    AC A0A067CDN4.1
#=GS A7S863_NEMVE/23-134         AC A7S863.1
#=GS A0A0D3HIB3_9ORYZ/148-237    AC A0A0D3HIB3.1
#=GS R0I7R9_9BRAS/54-149         AC R0I7R9.1
#=GS V7ACX0_PHAVU/54-145         AC V7ACX0.1
#=GS A0A061NX16_9BACL/291-393    AC A0A061NX16.1
#=GS A0A0L0C031_LUCCU/44-136     AC A0A0L0C031.1
#=GS K3Z626_SETIT/56-147         AC K3Z626.1
#=GS M3Z223_MUSPF/32-125         AC M3Z223.1
#=GS A0A0B0NJN9_GOSAR/1-75       AC A0A0B0NJN9.1
#=GS A0A1B6PGY1_SORBI/130-247    AC A0A1B6PGY1.1
#=GS A0A165E6D5_9BASI/69-172     AC A0A165E6D5.1
#=GS M4AIJ9_XIPMA/28-121         AC M4AIJ9.1
#=GS A0A164WJW9_DAUCA/1-76       AC A0A164WJW9.1
#=GS A0A0G1A037_9BACT/1204-1303  AC A0A0G1A037.1
#=GS R6Y4G7_9PORP/34-124         AC R6Y4G7.1
#=GS A0A0E0MQ19_ORYPU/79-170     AC A0A0E0MQ19.1
#=GS A0A0K9RL69_SPIOL/142-245    AC A0A0K9RL69.1
#=GS A0A0W7VKF3_9HYPO/69-172     AC A0A0W7VKF3.1
#=GS M4FGW9_BRARP/77-188         AC M4FGW9.1
#=GS F1RI33_PIG/31-124           AC F1RI33.2
#=GS D0NVK8_PHYIT/174-279        AC D0NVK8.1
#=GS A0A022R5I2_ERYGU/43-131     AC A0A022R5I2.1
#=GS A0A0D9Y1T8_9ORYZ/53-144     AC A0A0D9Y1T8.1
#=GS Q6YGT9_SOYBN/92-183         AC Q6YGT9.1
#=GS W4EHG7_9BACL/607-714        AC W4EHG7.1
#=GS A0A0T2L1E0_9MICO/37-133     AC A0A0T2L1E0.1
#=GS A0A100IUC2_ASPNG/33-122     AC A0A100IUC2.1
#=GS L8GZQ1_ACACA/123-213        AC L8GZQ1.1
#=GS C7PD12_CHIPD/35-116         AC C7PD12.1
#=GS A0A0G0E9G4_9BACT/39-176     AC A0A0G0E9G4.1
#=GS D5XD20_THEPJ/328-415        AC D5XD20.1
#=GS B7QNN1_IXOSC/1-79           AC B7QNN1.1
#=GS A0A0D9Y0R6_9ORYZ/1573-1681  AC A0A0D9Y0R6.1
#=GS M1W0K6_CLAP2/34-129         AC M1W0K6.1
#=GS H3NJL6_9LACT/48-200         AC H3NJL6.1
#=GS A0A0F8VEM4_9EURO/69-173     AC A0A0F8VEM4.1
#=GS A0A0G0T2K7_9BACT/2584-2670  AC A0A0G0T2K7.1
#=GS V4AW18_LOTGI/3-98           AC V4AW18.1
#=GS C9LVB0_SELS3/54-144         AC C9LVB0.1
#=GS F7V5R3_CLOSS/61-157         AC F7V5R3.1
#=GS A0A0C1DQ58_9FLAO/51-148     AC A0A0C1DQ58.1
#=GS K4CQZ0_SOLLC/47-135         AC K4CQZ0.1
#=GS A0A089ILP5_9BACL/38-136     AC A0A089ILP5.1
#=GS A0A090KXY3_STRRB/71-164     AC A0A090KXY3.1
#=GS R0GZI6_9BRAS/175-283        AC R0GZI6.1
#=GS A0A164T362_DAUCA/170-278    AC A0A164T362.1
#=GS M5XQD1_PRUPE/1-64           AC M5XQD1.1
#=GS B9IFB3_POPTR/180-288        AC B9IFB3.2
#=GS M2M8G7_BAUCO/30-117         AC M2M8G7.1
#=GS W2ZFP0_PHYPR/107-222        AC W2ZFP0.1
#=GS A0A0F8U0E9_9EURO/33-122     AC A0A0F8U0E9.1
#=GS A9RHZ5_PHYPA/1-86           AC A9RHZ5.1
#=GS A0A094GYC7_9PEZI/37-128     AC A0A094GYC7.1
#=GS W5GZ63_WHEAT/59-150         AC W5GZ63.1
#=GS A0A0F4ZM71_9PEZI/85-189     AC A0A0F4ZM71.1
#=GS A0A0B0PB97_GOSAR/502-593    AC A0A0B0PB97.1
#=GS C6J0B3_9BACL/40-141         AC C6J0B3.1
#=GS E3EDE7_PAEPS/42-139         AC E3EDE7.1
#=GS R7ZWR7_9BACT/53-154         AC R7ZWR7.1
#=GS A0A0S6X146_9SPHN/37-137     AC A0A0S6X146.1
#=GS A0A0D2WNR0_CAPO3/181-287    AC A0A0D2WNR0.1
#=GS A0A0G0FPR7_9BACT/1449-1542  AC A0A0G0FPR7.1
#=GS W3A3L4_PHYPR/61-158         AC W3A3L4.1
#=GS M0YYK8_HORVD/7-89           AC M0YYK8.1
#=GS A0A059APQ3_EUCGR/17-108     AC A0A059APQ3.1
#=GS A0A0Q7B751_9ACTN/43-144     AC A0A0Q7B751.1
#=GS B4F9L6_MAIZE/67-158         AC B4F9L6.1
#=GS A0A171KRP3_9BURK/63-162     AC A0A171KRP3.1
#=GS V4LZM4_EUTSA/74-186         AC V4LZM4.1
#=GS Q67WU6_ORYSJ/54-145         AC Q67WU6.1
#=GS A0A177HI05_9ACTN/59-164     AC A0A177HI05.1
#=GS A0A078E7R4_BRANA/145-248    AC A0A078E7R4.1
#=GS A0A0B2SQJ5_GLYSO/57-148     AC A0A0B2SQJ5.1
#=GS A0A0D2VBI2_GOSRA/171-279    AC A0A0D2VBI2.1
#=GS A0A0J0YB80_9SPHI/52-150     AC A0A0J0YB80.1
#=GS A0A0G1XAS5_9BACT/248-335    AC A0A0G1XAS5.1
#=GS A0A143PTA4_9BACT/37-142     AC A0A143PTA4.1
#=GS C6CZ00_PAESJ/476-588        AC C6CZ00.1
#=GS A0A0B4H5E4_9HYPO/35-122     AC A0A0B4H5E4.1
#=GS X6MHF4_RETFI/155-275        AC X6MHF4.1
#=GS H0V7G3_CAVPO/28-121         AC H0V7G3.1
#=GS A0A0D2U744_GOSRA/56-147     AC A0A0D2U744.1
#=GS A0A0D3HX62_9ORYZ/66-157     AC A0A0D3HX62.1
#=GS R7AVM1_9BACE/45-137         AC R7AVM1.1
#=GS A3UAG1_CROAH/19-115         AC A3UAG1.1
#=GS M1D3F2_SOLTU/70-182         AC M1D3F2.1
#=GS A0A061F141_THECC/127-214    AC A0A061F141.1
#=GS A0A0J8ERD4_BETVU/69-181     AC A0A0J8ERD4.1
#=GS E4N626_KITSK/94-193         AC E4N626.1
#=GS M1D308_SOLTU/64-176         AC M1D308.1
#=GS A0A067KT97_JATCU/69-181     AC A0A067KT97.1
#=GS A0A0E0QGR0_ORYRU/77-203     AC A0A0E0QGR0.1
#=GS G0MR95_CAEBE/23-118         AC G0MR95.1
#=GS K7VBV2_MAIZE/208-311        AC K7VBV2.1
#=GS A0A067L2R6_JATCU/49-136     AC A0A067L2R6.1
#=GS I0YIJ7_COCSC/115-223        AC I0YIJ7.1
#=GS G7JHG8_MEDTR/144-233        AC G7JHG8.1
#=GS A0A0B0NER7_GOSAR/56-147     AC A0A0B0NER7.1
#=GS A0A0E0BVP5_9ORYZ/526-620    AC A0A0E0BVP5.1
#=GS A0A0L9TIH2_PHAAN/149-252    AC A0A0L9TIH2.1
#=GS M1B548_SOLTU/44-136         AC M1B548.1
#=GS M1C0M6_SOLTU/54-141         AC M1C0M6.1
#=GS A0A0L9V8N3_PHAAN/54-145     AC A0A0L9V8N3.1
#=GS A0A074WAJ1_9PEZI/33-119     AC A0A074WAJ1.1
#=GS W2Y2P5_PHYPR/199-305        AC W2Y2P5.1
#=GS A0A014PKX0_9HYPO/34-122     AC A0A014PKX0.1
#=GS K4CWL7_SOLLC/70-182         AC K4CWL7.1
#=GS A0A0K9R7N1_SPIOL/220-323    AC A0A0K9R7N1.1
#=GS I0Z8X7_COCSC/56-152         AC I0Z8X7.1
#=GS W5KMZ9_ASTMX/28-121         AC W5KMZ9.1
#=GS A0A067G6I3_CITSI/54-145     AC A0A067G6I3.1
#=GS W5F070_WHEAT/4-74           AC W5F070.1
#=GS A0A0G0W6M6_9BACT/1734-1821  AC A0A0G0W6M6.1
#=GS K7MZ83_SOYBN/99-186         AC K7MZ83.1
#=GS A0A0B2Q0H9_GLYSO/47-134     AC A0A0B2Q0H9.1
#=GS L8EHR1_STRRM/73-178         AC L8EHR1.1
#=GS A0A095ZPY6_9CORY/77-233     AC A0A095ZPY6.1
#=GS S2Z3T7_9ACTN/76-211         AC S2Z3T7.1
#=GS I1HEM8_BRADI/63-176         AC I1HEM8.1
#=GS V7B3Z4_PHAVU/72-184         AC V7B3Z4.1
#=GS H3GLK9_PHYRM/2-93           AC H3GLK9.1
#=GS A0A061FY54_THECC/180-288    AC A0A061FY54.1
#=GS A0A132B3B4_9HELO/76-180     AC A0A132B3B4.1
#=GS A0A0J0XNG9_9TREE/46-139     AC A0A0J0XNG9.1
#=GS B1C470_9FIRM/84-177         AC B1C470.1
#=GS K4CFK5_SOLLC/42-140         AC K4CFK5.1
#=GS G2FUL4_9FIRM/252-348        AC G2FUL4.1
#=GS A0A0K9QLJ7_SPIOL/64-155     AC A0A0K9QLJ7.1
#=GS K3WND7_PYTUL/70-167         AC K3WND7.1
#=GS G3JRY3_CORMM/34-123         AC G3JRY3.1
#=GS A0A061E9P3_THECC/174-282    AC A0A061E9P3.1
#=GS A7S4Y2_NEMVE/1-81           AC A7S4Y2.1
#=GS W5F782_WHEAT/1-95           AC W5F782.1
#=GS A0A0E4HCL3_9BACL/750-847    AC A0A0E4HCL3.1
#=GS K9ERA6_9LACT/123-275        AC K9ERA6.1
#=GS R7P6R3_9BACT/29-137         AC R7P6R3.1
#=GS A0A0N8PSJ3_9CHLR/262-365    AC A0A0N8PSJ3.1
#=GS A0A0D2UTF0_CAPO3/31-114     AC A0A0D2UTF0.1
#=GS A0A0D3FFF3_9ORYZ/171-279    AC A0A0D3FFF3.1
#=GS F5LN13_9BACL/409-520        AC F5LN13.1
#=GS G0PMT0_CAEBE/25-112         AC G0PMT0.1
#=GS W2PI28_PHYPN/67-164         AC W2PI28.1
#=GS D4MXL2_ANAHA/65-175         AC D4MXL2.1
#=GS V4LRV6_EUTSA/44-134         AC V4LRV6.1
#=GS A0A0E0MNX4_ORYPU/828-936    AC A0A0E0MNX4.1
#=GS A0A0P7YMW9_9BACT/42-143     AC A0A0P7YMW9.1
#=GS A0A0G0KBG3_9BACT/51-137     AC A0A0G0KBG3.1
#=GS C6W3M9_DYAFD/37-133         AC C6W3M9.1
#=GS K3Z0Y1_SETIT/56-148         AC K3Z0Y1.1
#=GS A0A0G1RYW7_9BACT/1010-1097  AC A0A0G1RYW7.1
#=GS A0A067FF19_CITSI/61-152     AC A0A067FF19.1
#=GS A0A168H6A9_MUCCL/22-123     AC A0A168H6A9.1
#=GS A0A094D355_9PEZI/70-174     AC A0A094D355.1
#=GS A0A067BI35_SAPPC/162-272    AC A0A067BI35.1
#=GS A0A0J6WRW6_9FIRM/70-162     AC A0A0J6WRW6.1
#=GS A0A0Q9L400_9BACL/28-114     AC A0A0Q9L400.1
#=GS R5UR87_9BACE/257-354        AC R5UR87.1
#=GS A0A087GK61_ARAAL/48-155     AC A0A087GK61.1
#=GS E0CPG2_VITVI/58-149         AC E0CPG2.1
#=GS A0A0W8DCS9_PHYNI/24-117     AC A0A0W8DCS9.1
#=GS I9B344_9FIRM/34-127         AC I9B344.1
#=GS W2YAA9_PHYPR/201-306        AC W2YAA9.1
#=GS A0A0G0T2K7_9BACT/1310-1403  AC A0A0G0T2K7.1
#=GS A0A0X3S8G8_9ACTN/59-152     AC A0A0X3S8G8.1
#=GS A0A166HZH3_DAUCA/217-315    AC A0A166HZH3.1
#=GS A0A0N4U4A4_DRAME/42-133     AC A0A0N4U4A4.1
#=GS M1D307_SOLTU/64-176         AC M1D307.1
#=GS A0A0C2GEQ1_9BILA/39-132     AC A0A0C2GEQ1.1
#=GS A0A0G0GIP8_9BACT/37-124     AC A0A0G0GIP8.1
#=GS A0A0F9YDV3_9BACT/47-139     AC A0A0F9YDV3.1
#=GS A0A078DMD6_BRANA/60-148     AC A0A078DMD6.1
#=GS A0A023BW74_9FLAO/20-112     AC A0A023BW74.1
#=GS A0A150VJ56_9PEZI/30-117     AC A0A150VJ56.1
#=GS F7BZU8_XENTR/25-112         AC F7BZU8.1
#=GS B9XCR2_PEDPL/33-114         AC B9XCR2.1
#=GS A0A0E0AF47_9ORYZ/142-247    AC A0A0E0AF47.1
#=GS A1D8V4_NEOFI/34-123         AC A1D8V4.1
#=GS M1BDJ1_SOLTU/64-176         AC M1BDJ1.1
#=GS A0A177HP59_9ACTN/74-179     AC A0A177HP59.1
#=GS G4ULU9_NEUT9/37-123         AC G4ULU9.1
#=GS Q9NAM9_CAEEL/21-116         AC Q9NAM9.3
#=GS A0A0D2S0R0_GOSRA/71-183     AC A0A0D2S0R0.1
#=GS K3XFF3_SETIT/213-316        AC K3XFF3.1
#=GS A0A0A0LBQ8_CUCSA/4-66       AC A0A0A0LBQ8.1
#=GS Y2577_MYCTU/65-158          AC P9WL81.1
#=GS C7YXA6_NECH7/70-174         AC C7YXA6.1
#=GS D0P2U9_PHYIT/3-101          AC D0P2U9.1
#=GS C6LI97_9FIRM/64-158         AC C6LI97.1
#=GS W2YNS7_PHYPR/20-120         AC W2YNS7.1
#=GS A0A0D2VRX2_CAPO3/51-148     AC A0A0D2VRX2.1
#=GS A0A0X8RK63_9MICO/241-332    AC A0A0X8RK63.1
#=GS A0A0Q9X3T9_DROWI/2-94       AC A0A0Q9X3T9.1
#=GS K7K7T8_SOYBN/197-305        AC K7K7T8.1
#=GS B9H4H5_POPTR/58-149         AC B9H4H5.1
#=GS M1D1Z8_SOLTU/61-152         AC M1D1Z8.1
#=GS A0A074WCZ5_9PEZI/71-174     AC A0A074WCZ5.1
#=GS A0A0K9PYY3_ZOSMR/62-153     AC A0A0K9PYY3.1
#=GS D4KGZ1_9FIRM/59-151         AC D4KGZ1.1
#=GS A0A132HZW5_9BACT/179-263    AC A0A132HZW5.1
#=GS K4AX84_SOLLC/218-320        AC K4AX84.1
#=GS J2WIC6_9SPHN/41-138         AC J2WIC6.1
#=GS D2VUU5_NAEGR/23-125         AC D2VUU5.1
#=GS C1EDX9_MICCC/2-99           AC C1EDX9.1
#=GS A0A0G0SQU8_9BACT/43-128     AC A0A0G0SQU8.1
#=GS V4UHK9_9ROSI/54-145         AC V4UHK9.1
#=GS W1PXS5_AMBTC/43-130         AC W1PXS5.1
#=GS A0A0X8WRD1_9CYAN/52-142     AC A0A0X8WRD1.1
#=GS E4N983_KITSK/73-178         AC E4N983.1
#=GS B9GEG4_ORYSJ/57-151         AC B9GEG4.1
#=GS A9UQK5_MONBE/1029-1132      AC A9UQK5.1
#=GS Q6BZK1_DEBHA/35-123         AC Q6BZK1.2
#=GS A0A0E8M5F0_MYCTX/2-94       AC A0A0E8M5F0.1
#=GS W5BD08_WHEAT/134-225        AC W5BD08.1
#=GS A0A0G0Q5F1_9BACT/40-173     AC A0A0G0Q5F1.1
#=GS A0A0G1IG63_9BACT/643-729    AC A0A0G1IG63.1
#=GS D8LE49_ECTSI/164-279        AC D8LE49.1
#=GS A0A124FXE7_9BACT/36-163     AC A0A124FXE7.1
#=GS W5N433_LEPOC/31-124         AC W5N433.1
#=GS A0A016S2P7_9BILA/40-134     AC A0A016S2P7.1
#=GS R6HEG8_9FIRM/40-130         AC R6HEG8.1
#=GS A0A1B6PD27_SORBI/64-157     AC A0A1B6PD27.1
#=GS A0A0P0CGQ0_9FLAO/35-131     AC A0A0P0CGQ0.1
#=GS A0A067FW44_CITSI/169-277    AC A0A067FW44.1
#=GS A0A0G1NCH2_9BACT/61-154     AC A0A0G1NCH2.1
#=GS A3QB56_SHELP/44-136         AC A3QB56.1
#=GS A0A0S8JDJ4_9BACT/54-136     AC A0A0S8JDJ4.1
#=GS L0DEH2_SINAD/233-338        AC L0DEH2.1
#=GS I2GN31_9BACT/30-112         AC I2GN31.1
#=GS H3GZF7_PHYRM/102-200        AC H3GZF7.1
#=GS A2R120_ASPNC/33-122         AC A2R120.1
#=GS C5WSX6_SORBI/66-179         AC C5WSX6.2
#=GS V7BKC0_PHAVU/42-129         AC V7BKC0.1
#=GS A0A067LB19_JATCU/144-247    AC A0A067LB19.1
#=GS A0A059ACB2_EUCGR/220-322    AC A0A059ACB2.1
#=GS F6I1A3_VITVI/63-154         AC F6I1A3.1
#=GS F2CXH6_HORVD/143-249        AC F2CXH6.1
#=GS A0A061GHS9_THECC/63-154     AC A0A061GHS9.1
#=GS Q82CS1_STRAW/62-179         AC Q82CS1.1
#=GS A0A094GG52_9PEZI/39-130     AC A0A094GG52.1
#=GS K3WNF5_PYTUL/37-134         AC K3WNF5.1
#=GS D8RC38_SELML/65-175         AC D8RC38.1
#=GS A0A0B2R8A4_GLYSO/62-153     AC A0A0B2R8A4.1
#=GS V9FA21_PHYPR/107-222        AC V9FA21.1
#=GS A0A0D3HRH5_9ORYZ/55-142     AC A0A0D3HRH5.1
#=GS R5Y567_9BACE/165-248        AC R5Y567.1
#=GS G7JLE1_MEDTR/107-215        AC G7JLE1.1
#=GS R6RQM7_9CLOT/60-153         AC R6RQM7.1
#=GS A0A061GPZ6_THECC/62-153     AC A0A061GPZ6.1
#=GS A0A093XLE0_9PEZI/70-174     AC A0A093XLE0.1
#=GS D5PI27_9MYCO/64-157         AC D5PI27.1
#=GS Q10I09_ORYSJ/80-167         AC Q10I09.1
#=GS L0G2X8_ECHVK/48-149         AC L0G2X8.1
#=GS A0A0L8GU12_OCTBM/30-121     AC A0A0L8GU12.1
#=GS W5BV59_WHEAT/1-52           AC W5BV59.1
#=GS D8SSG3_SELML/38-128         AC D8SSG3.1
#=GS W9RU81_9ROSA/231-335        AC W9RU81.1
#=GS M0RCA8_RAT/1-85             AC M0RCA8.2
#=GS M7XX62_9BACT/27-112         AC M7XX62.1
#=GS D3EJ47_GEOS4/496-599        AC D3EJ47.1
#=GS A0A0G3M6M5_9FLAO/22-109     AC A0A0G3M6M5.1
#=GS A0A0S8J1K1_9BACT/59-137     AC A0A0S8J1K1.1
#=GS R7NUS7_9BACE/259-355        AC R7NUS7.1
#=GS D7WF92_9CORY/80-236         AC D7WF92.1
#=GS V4UHE3_9ROSI/61-152         AC V4UHE3.1
#=GS A0A0E0KLJ1_ORYPU/8-89       AC A0A0E0KLJ1.1
#=GS A0A059A5M9_EUCGR/165-273    AC A0A059A5M9.1
#=GS D0NUN2_PHYIT/69-166         AC D0NUN2.1
#=GS V5GDC5_BYSSN/32-119         AC V5GDC5.1
#=GS D8S9C8_SELML/141-244        AC D8S9C8.1
#=GS A0A0D2QZY8_GOSRA/58-149     AC A0A0D2QZY8.1
#=GS S0GI79_9PORP/28-117         AC S0GI79.1
#=GS A0A094AEQ9_9PEZI/37-128     AC A0A094AEQ9.1
#=GS A0A089KSU2_9BACL/36-134     AC A0A089KSU2.1
#=GS A0A0D2TMT7_GOSRA/61-152     AC A0A0D2TMT7.1
#=GS W4FUT3_9STRA/128-237        AC W4FUT3.1
#=GS Q4WHW5_ASPFU/1-87           AC Q4WHW5.1
#=GS M1D3F3_SOLTU/70-160         AC M1D3F3.1
#=GS W9SFG9_9ROSA/62-153         AC W9SFG9.1
#=GS A0A0E0KQ91_ORYPU/52-139     AC A0A0E0KQ91.1
#=GS F8EDW6_RUNSL/29-111         AC F8EDW6.1
#=GS A9RY38_PHYPA/172-281        AC A9RY38.1
#=GS S8CC20_9LAMI/59-150         AC S8CC20.1
#=GS A0A0N5A6D8_PARTI/70-166     AC A0A0N5A6D8.1
#=GS A0A078GHK5_BRANA/49-144     AC A0A078GHK5.1
#=GS R0FAA1_9BRAS/51-147         AC R0FAA1.1
#=GS A0A0D1Y2P3_9EURO/28-118     AC A0A0D1Y2P3.1
#=GS A0A1B6PIJ7_SORBI/177-295    AC A0A1B6PIJ7.1
#=GS A0A078CA09_BRANA/43-132     AC A0A078CA09.1
#=GS D3BRK3_POLPA/30-135         AC D3BRK3.1
#=GS M7YMW3_TRIUA/139-247        AC M7YMW3.1
#=GS A0A101HJ83_9BACT/599-684    AC A0A101HJ83.1
#=GS A0A0V8J4S6_9BACI/985-1091   AC A0A0V8J4S6.1
#=GS A0A0D9Y0R6_9ORYZ/2151-2259  AC A0A0D9Y0R6.1
#=GS G4YPG8_PHYSP/220-326        AC G4YPG8.1
#=GS K7VP77_MAIZE/208-311        AC K7VP77.1
#=GS A0A0D2B3E4_9EURO/95-198     AC A0A0D2B3E4.1
#=GS H3SML1_9BACL/213-323        AC H3SML1.1
#=GS A0A0A2U1L8_9BACL/228-325    AC A0A0A2U1L8.1
#=GS C1DNV5_AZOVD/1-93           AC C1DNV5.1
#=GS G1LQ26_AILME/35-128         AC G1LQ26.1
#=GS A0A089IP76_9BACL/1091-1190  AC A0A089IP76.1
#=GS G0MTX2_CAEBE/25-111         AC G0MTX2.1
#=GS A0A094ETP4_9PEZI/34-124     AC A0A094ETP4.1
#=GS M4BQC8_HYAAE/1-83           AC M4BQC8.1
#=GS R5PV60_9BACT/78-162         AC R5PV60.1
#=GS K1R7R6_CRAGI/36-130         AC K1R7R6.1
#=GS A0A0G0PVG5_9BACT/86-175     AC A0A0G0PVG5.1
#=GS A0A0I9Y4C8_9MYCO/70-163     AC A0A0I9Y4C8.1
#=GS C6W7F0_DYAFD/230-326        AC C6W7F0.1
#=GS A0A0D9W1C6_9ORYZ/13-95      AC A0A0D9W1C6.1
#=GS X0IW42_FUSOX/28-116         AC X0IW42.1
#=GS A0A0M8VFT9_9ACTN/50-146     AC A0A0M8VFT9.1
#=GS A0A0S6XLN1_9FUNG/70-174     AC A0A0S6XLN1.1
#=GS A0A0E0MQ20_ORYPU/60-151     AC A0A0E0MQ20.1
#=GS L7FGK7_9ACTN/75-180         AC L7FGK7.1
#=GS A0A0X3SJJ6_9ACTN/79-184     AC A0A0X3SJJ6.1
#=GS A0A127VA68_9SPHI/36-118     AC A0A127VA68.1
#=GS A0A078H0G8_BRANA/53-147     AC A0A078H0G8.1
#=GS A0A0B0HSA3_9BACL/125-235    AC A0A0B0HSA3.1
#=GS V7BZF5_PHAVU/76-187         AC V7BZF5.1
#=GS A0A067C7M8_SAPPC/69-168     AC A0A067C7M8.1
#=GS D7T8B0_VITVI/42-130         AC D7T8B0.1
#=GS A0A0D3CM49_BRAOL/71-183     AC A0A0D3CM49.1
#=GS I1IRL2_BRADI/181-290        AC I1IRL2.1
#=GS A0A117NKW2_9EURO/33-119     AC A0A117NKW2.1
#=GS A0A0J7P1V0_LASNI/24-115     AC A0A0J7P1V0.1
#=GS A0A0D3C9X7_BRAOL/144-247    AC A0A0D3C9X7.1
#=GS I1IRL3_BRADI/171-279        AC I1IRL3.1
#=GS D4JWC0_9FIRM/59-150         AC D4JWC0.1
#=GS A0A0D1CGM4_9SPHN/40-137     AC A0A0D1CGM4.1
#=GS D8SZI9_SELML/1-89           AC D8SZI9.1
#=GS A0A0J7ZI23_STRVR/80-185     AC A0A0J7ZI23.1
#=GS A0A0D3VIJ2_9BACL/317-425    AC A0A0D3VIJ2.1
#=GS A0A143PX72_9BACT/41-137     AC A0A143PX72.1
#=GS A0A0A2LV48_9FLAO/20-111     AC A0A0A2LV48.1
#=GS A0A101GTD9_9FIRM/225-322    AC A0A101GTD9.1
#=GS A0A095VRF3_9GAMM/231-335    AC A0A095VRF3.1
#=GS A0A0D2WTG5_CAPO3/21-115     AC A0A0D2WTG5.1
#=GS I1H4B9_BRADI/148-254        AC I1H4B9.1
#=GS H2VTL9_CAEJA/19-114         AC H2VTL9.2
#=GS K3WC55_PYTUL/148-255        AC K3WC55.1
#=GS M2NFJ9_BAUCO/77-180         AC M2NFJ9.1
#=GS T1IAC6_RHOPR/1-86           AC T1IAC6.1
#=GS W1NYA8_AMBTC/63-174         AC W1NYA8.1
#=GS G2EGN1_9FLAO/21-113         AC G2EGN1.1
#=GS W4H495_9STRA/232-325        AC W4H495.1
#=GS A0A0B8NPP7_9VIBR/56-142     AC A0A0B8NPP7.1
#=GS W2EUW4_9ACTN/48-142         AC W2EUW4.1
#=GS A0A087SD99_AUXPR/154-257    AC A0A087SD99.1
#=GS A0A087Y4G6_POEFO/47-140     AC A0A087Y4G6.2
#=GS T0RYE6_9STRA/25-107         AC T0RYE6.1
#=GS A0A0D3CTG9_BRAOL/49-136     AC A0A0D3CTG9.1
#=GS A0A101HNA3_9BACT/53-144     AC A0A101HNA3.1
#=GS A0A0Q5TNK1_9BACT/36-132     AC A0A0Q5TNK1.1
#=GS M0SPT3_MUSAM/121-212        AC M0SPT3.1
#=GS F5GUC7_CAEEL/1-76           AC F5GUC7.1
#=GS A0A067HAB4_CITSI/1-89       AC A0A067HAB4.1
#=GS B0DKQ4_LACBS/38-128         AC B0DKQ4.1
#=GS A0A101JTN9_9ACTN/54-148     AC A0A101JTN9.1
#=GS A0A0E0RKH3_ORYRU/63-149     AC A0A0E0RKH3.1
#=GS V4SWP9_9ROSI/92-179         AC V4SWP9.1
#=GS I1P8V7_ORYGL/171-279        AC I1P8V7.1
#=GS A0A0E0RJ36_ORYRU/173-281    AC A0A0E0RJ36.1
#=GS A0A0G0T2K7_9BACT/1907-2006  AC A0A0G0T2K7.1
#=GS A0A0C9XZ06_9AGAR/35-125     AC A0A0C9XZ06.1
#=GS A0A078EAC3_BRANA/176-284    AC A0A078EAC3.1
#=GS A0A0F7TFI3_9EURO/37-122     AC A0A0F7TFI3.1
#=GS A0A0N5B9X4_STREA/59-147     AC A0A0N5B9X4.1
#=GS F5LPT7_9BACL/46-157         AC F5LPT7.1
#=GS M0U5B2_MUSAM/73-185         AC M0U5B2.1
#=GS A0A0H1ASN6_9GAMM/46-143     AC A0A0H1ASN6.1
#=GS A0A0P5W7X5_9CRUS/35-129     AC A0A0P5W7X5.1
#=GS A0A0H3J3Z7_CLOPA/61-157     AC A0A0H3J3Z7.1
#=GS G7Y8H1_CLOSI/23-115         AC G7Y8H1.1
#=GS A0A0D2U9Q7_GOSRA/56-147     AC A0A0D2U9Q7.1
#=GS A0A0G0H1T0_9BACT/302-384    AC A0A0G0H1T0.1
#=GS B4GTD6_DROPE/42-143         AC B4GTD6.1
#=GS U5GV51_POPTR/218-320        AC U5GV51.1
#=GS A0A059DEL7_EUCGR/27-114     AC A0A059DEL7.1
#=GS A0A0A2TKX5_9BACI/36-136     AC A0A0A2TKX5.1
#=GS A0A0S7DNW0_9EURO/34-121     AC A0A0S7DNW0.1
#=GS M4F825_BRARP/53-147         AC M4F825.1
#=GS B8NXS3_ASPFN/68-171         AC B8NXS3.1
#=GS V9G2A3_PHYPR/63-160         AC V9G2A3.1
#=GS A0A0G1UA63_9BACT/1362-1449  AC A0A0G1UA63.1
#=GS A0A0L9U957_PHAAN/58-150     AC A0A0L9U957.1
#=GS U2HC80_9SPHI/46-141         AC U2HC80.1
#=GS A0A0G0FDE4_9BACT/308-396    AC A0A0G0FDE4.1
#=GS A0A0D3BDX7_BRAOL/61-152     AC A0A0D3BDX7.1
#=GS A0A0Q9L8K3_9BACL/26-123     AC A0A0Q9L8K3.1
#=GS F4F326_VERMA/57-160         AC F4F326.1
#=GS W1PQF6_AMBTC/170-278        AC W1PQF6.1
#=GS A0A0C3HH11_9PEZI/36-123     AC A0A0C3HH11.1
#=GS S0FT26_9FIRM/36-142         AC S0FT26.1
#=GS A0A0D9N0Z2_ASPFA/34-123     AC A0A0D9N0Z2.1
#=GS A0A059AN39_EUCGR/65-156     AC A0A059AN39.1
#=GS A0A061FSS3_THECC/836-939    AC A0A061FSS3.1
#=GS A0A0E0AT81_9ORYZ/78-204     AC A0A0E0AT81.1
#=GS A0A0E0BUF4_9ORYZ/120-228    AC A0A0E0BUF4.1
#=GS A0A136LZB8_9BACT/41-147     AC A0A136LZB8.1
#=GS A0A0D1E5L4_USTMA/34-120     AC A0A0D1E5L4.1
#=GS A0A139WTQ4_9CYAN/19-103     AC A0A139WTQ4.1
#=GS B6GAU9_9ACTN/243-339        AC B6GAU9.1
#=GS A0A0G0F0W1_9BACT/1560-1646  AC A0A0G0F0W1.1
#=GS W6UZE3_ECHGR/20-116         AC W6UZE3.1
#=GS V4LMA7_EUTSA/171-279        AC V4LMA7.1
#=GS D9XB13_STRVT/79-184         AC D9XB13.1
#=GS D8QZ38_SELML/204-301        AC D8QZ38.1
#=GS A0A067EE33_CITSI/17-108     AC A0A067EE33.1
#=GS A8LCL7_FRASN/43-142         AC A8LCL7.1
#=GS V9EDB5_PHYPR/90-188         AC V9EDB5.1
#=GS A0A0S8I906_9BACT/353-443    AC A0A0S8I906.1
#=GS A8XTN4_CAEBR/46-139         AC A8XTN4.2
#=GS M4E2A3_BRARP/64-175         AC M4E2A3.1
#=GS G7JSI6_MEDTR/216-318        AC G7JSI6.2
#=GS A0A194QMF5_PAPXU/33-124     AC A0A194QMF5.1
#=GS I1NSF8_ORYGL/206-309        AC I1NSF8.1
#=GS A0A117UNS3_9BACT/234-315    AC A0A117UNS3.1
#=GS A0A176WL59_MARPO/56-148     AC A0A176WL59.1
#=GS A0A0K0DU54_STRER/29-125     AC A0A0K0DU54.1
#=GS A0A059AD22_EUCGR/227-306    AC A0A059AD22.1
#=GS A0A078CM16_BRANA/66-157     AC A0A078CM16.1
#=GS A0A0S7WZX1_9BACT/155-247    AC A0A0S7WZX1.1
#=GS A0A067K8V7_JATCU/50-149     AC A0A067K8V7.1
#=GS M5XSX1_PRUPE/147-250        AC M5XSX1.1
#=GS A0A072U2E8_MEDTR/169-277    AC A0A072U2E8.1
#=GS S5VA43_STRC3/72-177         AC S5VA43.1
#=GS A0A0G1YX37_9BACT/125-225    AC A0A0G1YX37.1
#=GS L8GZ22_ACACA/77-167         AC L8GZ22.1
#=GS F6MIW5_WHEAT/63-176         AC F6MIW5.1
#=GS F2I6V2_AERUA/100-256        AC F2I6V2.1
#=GS A0A0F9ZH76_TRIHA/67-170     AC A0A0F9ZH76.1
#=GS H3H2X4_PHYRM/200-306        AC H3H2X4.1
#=GS A0A0D2WX61_CAPO3/24-117     AC A0A0D2WX61.1
#=GS A0A087SHZ1_AUXPR/76-202     AC A0A087SHZ1.1
#=GS A0A0D2SN18_GOSRA/60-151     AC A0A0D2SN18.1
#=GS E0IGC9_9BACL/37-139         AC E0IGC9.1
#=GS A0A0D9WSJ2_9ORYZ/54-145     AC A0A0D9WSJ2.1
#=GS I1JEF3_SOYBN/197-305        AC I1JEF3.1
#=GS M4DMM0_BRARP/163-260        AC M4DMM0.1
#=GS G5EE15_CAEEL/20-114         AC G5EE15.2
#=GS A0A0D9Z3X2_9ORYZ/171-279    AC A0A0D9Z3X2.1
#=GS A0A022R9B5_ERYGU/1-76       AC A0A022R9B5.1
#=GS A0A0B2K120_9FIRM/41-128     AC A0A0B2K120.1
#=GS K4CHD0_SOLLC/54-141         AC K4CHD0.1
#=GS T1KY42_TETUR/31-122         AC T1KY42.1
#=GS A0A0L0LK32_9BACT/67-151     AC A0A0L0LK32.1
#=GS C6PWC9_9CLOT/46-142         AC C6PWC9.1
#=GS A8HTI5_CHLRE/98-212         AC A8HTI5.1
#=GS R7ZWS2_9BACT/232-328        AC R7ZWS2.1
#=GS A0A0G0A3L3_TRIHA/34-121     AC A0A0G0A3L3.1
#=GS Q8LJ43_ORYSJ/57-148         AC Q8LJ43.1
#=GS T1JCQ8_STRMM/26-116         AC T1JCQ8.1
#=GS F0ZBD1_DICPU/25-123         AC F0ZBD1.1
#=GS A0A132PLU3_9MYCO/55-148     AC A0A132PLU3.1
#=GS W7TLQ2_9STRA/38-132         AC W7TLQ2.1
#=GS W5BZV7_WHEAT/1-92           AC W5BZV7.1
#=GS M0YS08_HORVD/47-135         AC M0YS08.1
#=GS I3VSI5_THESW/37-129         AC I3VSI5.1
#=GS A0A067FEB9_CITSI/61-152     AC A0A067FEB9.1
#=GS M0T7T2_MUSAM/47-137         AC M0T7T2.1
#=GS F6GX85_VITVI/217-318        AC F6GX85.1
#=GS A0A0S2KFW2_9GAMM/50-146     AC A0A0S2KFW2.1
#=GS I3C615_9FLAO/32-116         AC I3C615.1
#=GS A0A0F4JQ00_9ACTN/53-146     AC A0A0F4JQ00.1
#=GS A0A0W8DP46_PHYNI/70-169     AC A0A0W8DP46.1
#=GS A0A0D2RWZ1_GOSRA/46-133     AC A0A0D2RWZ1.1
#=GS R6MVX5_9CLOT/57-161         AC R6MVX5.1
#=GS A0A078EXK3_BRANA/71-183     AC A0A078EXK3.1
#=GS A0A0M0JRY9_9EUKA/27-193     AC A0A0M0JRY9.1
#=GS Q6CDW1_YARLI/30-118         AC Q6CDW1.1
#=GS A0A0E0LT87_ORYPU/78-203     AC A0A0E0LT87.1
#=GS A0A0J8F5H6_BETVU/198-306    AC A0A0J8F5H6.1
#=GS I1PCV2_ORYGL/80-167         AC I1PCV2.1
#=GS G0FJL2_AMYMS/55-148         AC G0FJL2.1
#=GS K1QWF8_CRAGI/9-100          AC K1QWF8.1
#=GS D3BTH8_POLPA/3-43           AC D3BTH8.1
#=GS V5F3S4_KALBG/78-166         AC V5F3S4.1
#=GS M0YS07_HORVD/1-76           AC M0YS07.1
#=GS A0A0B2BIS5_9ACTN/53-150     AC A0A0B2BIS5.1
#=GS A0A0G1QVM7_9BACT/2327-2416  AC A0A0G1QVM7.1
#=GS A0A0A0KNH8_CUCSA/143-246    AC A0A0A0KNH8.1
#=GS A0A059WI67_STRA9/53-146     AC A0A059WI67.1
#=GS A0A0F6QXR9_9CORY/31-126     AC A0A0F6QXR9.1
#=GS K3UU51_FUSPC/34-123         AC K3UU51.1
#=GS A0A0G0Z8A1_9BACT/39-130     AC A0A0G0Z8A1.1
#=GS W5DAB8_WHEAT/1-77           AC W5DAB8.1
#=GS F8EYE2_TRECH/227-324        AC F8EYE2.1
#=GS R0HKR9_9BRAS/51-138         AC R0HKR9.1
#=GS A0A061DYP5_THECC/62-153     AC A0A061DYP5.1
#=GS C0HG39_MAIZE/83-201         AC C0HG39.1
#=GS A0A067LCF7_JATCU/58-148     AC A0A067LCF7.1
#=GS A0A078HDF8_BRANA/1-81       AC A0A078HDF8.1
#=GS E8LGX2_9FIRM/40-130         AC E8LGX2.1
#=GS U5CRL6_AMBTC/49-159         AC U5CRL6.1
#=GS G5A0U1_PHYSP/70-166         AC G5A0U1.1
#=GS A0A016S3U6_9BILA/40-134     AC A0A016S3U6.1
#=GS A0A0M8VVX2_9ACTN/48-143     AC A0A0M8VVX2.1
#=GS D4ZJ13_SHEVD/52-136         AC D4ZJ13.1
#=GS B4D327_9BACT/666-749        AC B4D327.1
#=GS A0A0D2SNF0_GOSRA/56-147     AC A0A0D2SNF0.1
#=GS A0A0P8Y531_DROAN/40-144     AC A0A0P8Y531.1
#=GS A0A136NAV6_9BACT/24-107     AC A0A136NAV6.1
#=GS A0A0G0XM08_9BACT/862-953    AC A0A0G0XM08.1
#=GS A0A1B6QPM8_SORBI/192-300    AC A0A1B6QPM8.1
#=GS B2JSM5_PARP8/64-160         AC B2JSM5.1
#=GS A0A061DV71_THECC/72-184     AC A0A061DV71.1
#=GS A0A0G1L6I5_9BACT/1176-1269  AC A0A0G1L6I5.1
#=GS A0A094EQW6_9PEZI/70-174     AC A0A094EQW6.1
#=GS PPAF_SOYBN/54-145           AC Q09131.2
#=GS H3DJ87_TETNG/24-111         AC H3DJ87.1
#=GS T1FX50_HELRO/1-83           AC T1FX50.1
#=GS V7C5U3_PHAVU/169-277        AC V7C5U3.1
#=GS A0A0E0QTG5_ORYRU/186-294    AC A0A0E0QTG5.1
#=GS B4IDV2_DROSE/38-131         AC B4IDV2.1
#=GS F8L2E4_PARAV/26-114         AC F8L2E4.1
#=GS V7C809_PHAVU/169-277        AC V7C809.1
#=GS A0A139WIU9_TRICA/25-116     AC A0A139WIU9.1
#=GS A0A175YRY5_DAUCA/67-179     AC A0A175YRY5.1
#=GS A0A068S6G2_9FUNG/52-152     AC A0A068S6G2.1
#=GS V4SI19_9ROSI/59-150         AC V4SI19.1
#=GS V4A001_LOTGI/9-100          AC V4A001.1
#=GS A0A0G0Q3F7_9BACT/2188-2282  AC A0A0G0Q3F7.1
#=GS A0A0E0KFP2_ORYPU/80-167     AC A0A0E0KFP2.1
#=GS D7KB00_ARALL/50-147         AC D7KB00.1
#=GS M5VJZ9_PRUPE/69-159         AC M5VJZ9.1
#=GS F6HKJ9_VITVI/50-142         AC F6HKJ9.1
#=GS A0A0B4I044_9HYPO/26-116     AC A0A0B4I044.1
#=GS A8WMV5_CAEBR/20-115         AC A8WMV5.1
#=GS A0A0D2WUR4_CAPO3/24-118     AC A0A0D2WUR4.1
#=GS W9ZD20_9EURO/31-118         AC W9ZD20.1
#=GS A0A067F5F6_CITSI/43-130     AC A0A067F5F6.1
#=GS A0A0B0MPP5_GOSAR/47-139     AC A0A0B0MPP5.1
#=GS C8W6V2_DESAS/80-172         AC C8W6V2.1
#=GS H1Y8F4_9SPHI/43-139         AC H1Y8F4.1
#=GS A0A095A1Q2_SCHHA/6-97       AC A0A095A1Q2.1
#=GS R5BKC1_9FIRM/54-148         AC R5BKC1.1
#=GS A0A0K9PG31_ZOSMR/45-134     AC A0A0K9PG31.1
#=GS V4UBK6_9ROSI/75-166         AC V4UBK6.1
#=GS A0A151MLZ8_ALLMI/1-80       AC A0A151MLZ8.1
#=GS A0A0D2LWH6_9CHLO/192-295    AC A0A0D2LWH6.1
#=GS M0RXL0_MUSAM/79-191         AC M0RXL0.1
#=GS V4L6N3_EUTSA/145-248        AC V4L6N3.1
#=GS F2DH21_HORVD/59-150         AC F2DH21.1
#=GS A0A0G0JBY2_9BACT/33-130     AC A0A0G0JBY2.1
#=GS A3ZVA8_9PLAN/48-144         AC A3ZVA8.1
#=GS A0A0J1G1S6_9FIRM/45-140     AC A0A0J1G1S6.1
#=GS G0J3W0_CYCMS/24-109         AC G0J3W0.1
#=GS A0A067FSL1_CITSI/169-277    AC A0A067FSL1.1
#=GS A0A067FEW8_CITSI/76-188     AC A0A067FEW8.1
#=GS A0A0G0FEQ6_9BACT/39-136     AC A0A0G0FEQ6.1
#=GS A0A067BP13_SAPPC/20-119     AC A0A067BP13.1
#=GS V9E6M9_PHYPR/201-306        AC V9E6M9.1
#=GS A0A059ANY0_EUCGR/67-158     AC A0A059ANY0.1
#=GS A0A0B8N5X6_9NOCA/86-181     AC A0A0B8N5X6.1
#=GS A0A0D2USK7_CAPO3/36-148     AC A0A0D2USK7.1
#=GS A0A0D3C281_BRAOL/111-202    AC A0A0D3C281.1
#=GS PPA10_ARATH/59-150          AC Q9SIV9.1
#=GS A0A0M3J6E8_ANISI/47-138     AC A0A0M3J6E8.1
#=GS A0A0E0R4B6_ORYRU/193-282    AC A0A0E0R4B6.1
#=GS R7JG37_9PORP/234-319        AC R7JG37.1
#=GS A0A0D9VR71_9ORYZ/176-284    AC A0A0D9VR71.1
#=GS A0A162J1R6_9PEZI/69-173     AC A0A162J1R6.1
#=GS A0A0G1L5U2_9BACT/194-292    AC A0A0G1L5U2.1
#=GS V4UML7_9ROSI/61-152         AC V4UML7.1
#=GS R0HQV6_9BRAS/68-183         AC R0HQV6.1
#=GS A0A127W4D1_SPOPS/38-136     AC A0A127W4D1.1
#=GS D8SRM3_SELML/1-86           AC D8SRM3.1
#=GS A9RX47_PHYPA/49-140         AC A9RX47.1
#=GS A0A0S8IA81_9BACT/785-874    AC A0A0S8IA81.1
#=GS H6L8U4_SAPGL/21-113         AC H6L8U4.1
#=GS F4PIX4_DICFS/23-124         AC F4PIX4.1
#=GS F2IBC1_FLUTR/196-280        AC F2IBC1.1
#=GS D6YTX5_WADCW/23-112         AC D6YTX5.1
#=GS A0A0D9XP47_9ORYZ/219-308    AC A0A0D9XP47.1
#=GS W4G9J2_9STRA/26-122         AC W4G9J2.1
#=GS V4MQU8_EUTSA/50-147         AC V4MQU8.1
#=GS A0A059ANH4_EUCGR/60-152     AC A0A059ANH4.1
#=GS A0A0E0BVP6_9ORYZ/507-601    AC A0A0E0BVP6.1
#=GS A0A0N5BKC4_STREA/28-121     AC A0A0N5BKC4.1
#=GS K9XFY6_9CHRO/34-114         AC K9XFY6.1
#=GS A0A0E0RKH2_ORYRU/59-150     AC A0A0E0RKH2.1
#=GS A8JC41_CHLRE/234-347        AC A8JC41.1
#=GS I1N686_SOYBN/72-183         AC I1N686.2
#=GS G7JZ41_MEDTR/176-284        AC G7JZ41.2
#=GS A0A022R4J7_ERYGU/1-50       AC A0A022R4J7.1
#=GS D7LFK9_ARALL/62-178         AC D7LFK9.1
#=GS H3ES52_PRIPA/43-133         AC H3ES52.1
#=GS A0A0G1NC73_9BACT/1278-1361  AC A0A0G1NC73.1
#=GS E6U9D8_ETHHY/1152-1253      AC E6U9D8.1
#=GS A0A165ZZH5_DAUCA/64-159     AC A0A165ZZH5.1
#=GS L8YC21_TUPCH/1-86           AC L8YC21.1
#=GS A0A0G1UHA9_9BACT/44-136     AC A0A0G1UHA9.1
#=GS R4TAD1_AMYOR/78-190         AC R4TAD1.1
#=GS A0A0S4IKJ2_BODSA/99-193     AC A0A0S4IKJ2.1
#=GS A0A0D2V3K5_GOSRA/58-149     AC A0A0D2V3K5.1
#=GS A0A0J8C3I1_BETVU/52-139     AC A0A0J8C3I1.1
#=GS A9SYI5_PHYPA/61-172         AC A9SYI5.1
#=GS W5WEH6_9PSEU/85-199         AC W5WEH6.1
#=GS A0A194WWR0_9HELO/34-122     AC A0A194WWR0.1
#=GS A0A0D3B4K5_BRAOL/73-184     AC A0A0D3B4K5.1
#=GS A0A0G1TFT7_9BACT/128-218    AC A0A0G1TFT7.1
#=GS A0A0Q4BHI7_9EURY/522-603    AC A0A0Q4BHI7.1
#=GS I1KC33_SOYBN/180-288        AC I1KC33.1
#=GS PPA27_ARATH/168-276         AC Q5MAU8.1
#=GS E9DYC8_METAQ/69-171         AC E9DYC8.1
#=GS A1DFH4_NEOFI/1-75           AC A1DFH4.1
#=GS K0YFZ3_9CORY/51-142         AC K0YFZ3.1
#=GS G1NX75_MYOLU/32-124         AC G1NX75.1
#=GS A0A0D9XA44_9ORYZ/178-275    AC A0A0D9XA44.1
#=GS M3VZV2_FELCA/49-142         AC M3VZV2.1
#=GS H2VJ90_CAEJA/22-117         AC H2VJ90.2
#=GS W2PKA6_PHYPN/471-570        AC W2PKA6.1
#=GS I1LUX6_SOYBN/62-153         AC I1LUX6.2
#=GS D7CCD4_STRBB/75-180         AC D7CCD4.1
#=GS X0BGT0_FUSOX/69-173         AC X0BGT0.1
#=GS A0A168NYF9_MUCCL/58-156     AC A0A168NYF9.1
#=GS M0XED1_HORVD/1-78           AC M0XED1.1
#=GS G7XLN6_ASPKW/33-122         AC G7XLN6.1
#=GS A0A109FHE3_9BASI/46-138     AC A0A109FHE3.1
#=GS Q13K54_BURXL/69-165         AC Q13K54.1
#=GS A0A0E4HCL3_9BACL/237-348    AC A0A0E4HCL3.1
#=GS A0A078ERU9_BRANA/174-282    AC A0A078ERU9.1
#=GS A0A0H5S844_BRUMA/46-137     AC A0A0H5S844.1
#=GS B8B0P6_ORYSI/54-145         AC B8B0P6.1
#=GS A0A101IPU3_9BACT/469-550    AC A0A101IPU3.1
#=GS E9FC97_METRA/34-122         AC E9FC97.1
#=GS A0A094IIQ5_9PEZI/70-174     AC A0A094IIQ5.1
#=GS D1BXZ3_XYLCX/248-341        AC D1BXZ3.1
#=GS K4CBX5_SOLLC/193-301        AC K4CBX5.1
#=GS V9FFC9_PHYPR/189-294        AC V9FFC9.1
#=GS A0A0D3HW09_9ORYZ/120-228    AC A0A0D3HW09.1
#=GS C6VXE6_DYAFD/22-101         AC C6VXE6.1
#=GS A0A0D4C128_9MICC/87-193     AC A0A0D4C128.1
#=GS F6GX85_VITVI/877-978        AC F6GX85.1
#=GS I1L5N5_SOYBN/54-145         AC I1L5N5.1
#=GS Q97MJ1_CLOAB/52-147         AC Q97MJ1.1
#=GS M0W2V4_HORVD/99-207         AC M0W2V4.1
#=GS A0A124G8J0_9ACTN/90-195     AC A0A124G8J0.1
#=GS B0DKQ3_LACBS/33-123         AC B0DKQ3.1
#=GS I1KZ65_SOYBN/72-184         AC I1KZ65.1
#=GS U5GX45_POPTR/42-130         AC U5GX45.1
#=GS A0A136N2R4_9BACT/51-147     AC A0A136N2R4.1
#=GS A0A0D2IZA3_9EURO/71-174     AC A0A0D2IZA3.1
#=GS D3BNQ0_POLPA/27-123         AC D3BNQ0.1
#=GS W1S9H0_9SPHN/42-139         AC W1S9H0.1
#=GS A0A0D3HX62_9ORYZ/494-588    AC A0A0D3HX62.1
#=GS R7WN77_9NOCA/2-63           AC R7WN77.1
#=GS A0A0D2S7Q2_GOSRA/59-150     AC A0A0D2S7Q2.1
#=GS A0A0N5CQJ5_THECL/46-137     AC A0A0N5CQJ5.1
#=GS A0A0P1AXZ2_9STRA/196-302    AC A0A0P1AXZ2.1
#=GS K9ARZ4_9STAP/31-123         AC K9ARZ4.1
#=GS A0A161IF49_9MICO/236-327    AC A0A161IF49.1
#=GS R6VTJ8_9BACT/28-116         AC R6VTJ8.1
#=GS A0A101QVD4_9ACTN/74-179     AC A0A101QVD4.1
#=GS M0RRM7_MUSAM/186-273        AC M0RRM7.1
#=GS M4DBI3_BRARP/174-282        AC M4DBI3.1
#=GS A0A0G1TZ94_9BACT/47-139     AC A0A0G1TZ94.1
#=GS K7KG04_SOYBN/100-187        AC K7KG04.1
#=GS A0A0F5VZR7_9ACTN/78-183     AC A0A0F5VZR7.1
#=GS A3XIJ1_LEEBM/27-111         AC A3XIJ1.1
#=GS G4ZZW7_PHYSP/102-200        AC G4ZZW7.1
#=GS A0A0J8F9Z9_BETVU/1-75       AC A0A0J8F9Z9.1
#=GS B9GQJ5_POPTR/77-208         AC B9GQJ5.1
#=GS X4ZXJ6_9BACL/39-136         AC X4ZXJ6.1
#=GS A0A176TDE7_9FLAO/20-98      AC A0A176TDE7.1
#=GS B9HRI6_POPTR/80-171         AC B9HRI6.2
#=GS A0A0K9R1X5_SPIOL/167-275    AC A0A0K9R1X5.1
#=GS A0A0G0KVP8_9BACT/116-201    AC A0A0G0KVP8.1
#=GS A0A094BM97_9PEZI/70-174     AC A0A094BM97.1
#=GS K3WND6_PYTUL/79-180         AC K3WND6.1
#=GS M0Y7U2_HORVD/1-80           AC M0Y7U2.1
#=GS A0A0B2NYP2_GLYSO/56-143     AC A0A0B2NYP2.1
#=GS R6CHA7_9BACE/292-391        AC R6CHA7.1
#=GS A0A0E0BP05_9ORYZ/55-142     AC A0A0E0BP05.1
#=GS V7BUC2_PHAVU/53-145         AC V7BUC2.1
#=GS PPA15_ARATH/64-176          AC Q9SFU3.1
#=GS F8EGW1_RUNSL/226-322        AC F8EGW1.1
#=GS A0A0G1VMK7_9BACT/145-244    AC A0A0G1VMK7.1
#=GS A0A154BW98_9FIRM/39-134     AC A0A154BW98.1
#=GS A0A0G0N5F2_9BACT/42-142     AC A0A0G0N5F2.1
#=GS A0A151TRB6_CAJCA/180-289    AC A0A151TRB6.1
#=GS A9RAY2_PHYPA/183-292        AC A9RAY2.1
#=GS G1NNL7_MELGA/386-478        AC G1NNL7.2
#=GS W4P5J0_9BACE/45-136         AC W4P5J0.1
#=GS A0A0K9NPL3_ZOSMR/203-311    AC A0A0K9NPL3.1
#=GS I0YWD4_COCSC/1-89           AC I0YWD4.1
#=GS M0XW87_HORVD/1-101          AC M0XW87.1
#=GS J9QTH8_RIEAN/19-108         AC J9QTH8.1
#=GS A0A0K9R9M5_SPIOL/62-152     AC A0A0K9R9M5.1
#=GS A0A0E0QLL3_ORYRU/179-290    AC A0A0E0QLL3.1
#=GS A0A061FC25_THECC/60-151     AC A0A061FC25.1
#=GS K4A731_SETIT/61-174         AC K4A731.1
#=GS G2P3Y5_STRVO/61-154         AC G2P3Y5.1
#=GS A0A0B2R6G3_GLYSO/197-305    AC A0A0B2R6G3.1
#=GS S2YFP0_9ACTN/49-146         AC S2YFP0.1
#=GS A0A074YK33_9PEZI/72-174     AC A0A074YK33.1
#=GS A0A101SY62_9ACTN/73-178     AC A0A101SY62.1
#=GS A2XDX3_ORYSI/171-279        AC A2XDX3.1
#=GS E3NH32_CAERE/2-78           AC E3NH32.1
#=GS I0YNC3_COCSC/54-180         AC I0YNC3.1
#=GS D0MZH6_PHYIT/205-311        AC D0MZH6.1
#=GS V9FX12_PHYPR/61-158         AC V9FX12.1
#=GS A0A0W8C030_PHYNI/140-238    AC A0A0W8C030.1
#=GS W7SIZ8_9PSEU/70-182         AC W7SIZ8.1
#=GS F2CVE6_HORVD/145-250        AC F2CVE6.1
#=GS A0A127V886_9SPHI/30-128     AC A0A127V886.1
#=GS C6CS41_PAESJ/53-151         AC C6CS41.1
#=GS A0A151SR68_CAJCA/17-108     AC A0A151SR68.1
#=GS D4KGZ2_9FIRM/59-151         AC D4KGZ2.1
#=GS R6IAJ0_9FIRM/15-106         AC R6IAJ0.1
#=GS A0A068REN9_9FUNG/49-149     AC A0A068REN9.1
#=GS R6E1J7_9FIRM/13-104         AC R6E1J7.1
#=GS I1M3C5_SOYBN/63-154         AC I1M3C5.2
#=GS A0A0K8LA61_9EURO/70-173     AC A0A0K8LA61.1
#=GS F2LAI2_BURGS/58-154         AC F2LAI2.1
#=GS R5PVV2_9BACT/170-252        AC R5PVV2.1
#=GS A0A0Q9W8R8_DROVI/46-140     AC A0A0Q9W8R8.1
#=GS A0A0D3C9W7_BRAOL/169-278    AC A0A0D3C9W7.1
#=GS R5QTR3_9FIRM/254-345        AC R5QTR3.1
#=GS T0PQC7_9STRA/19-119         AC T0PQC7.1
#=GS V4LZ80_EUTSA/451-538        AC V4LZ80.1
#=GS K7LFF4_SOYBN/222-324        AC K7LFF4.1
#=GS L8HFR9_ACACA/118-213        AC L8HFR9.1
#=GS F3ZM30_9ACTN/88-193         AC F3ZM30.1
#=GS I1IG27_BRADI/57-151         AC I1IG27.1
#=GS A2WVM5_ORYSI/57-148         AC A2WVM5.1
#=GS A0A0S7XEZ0_9BACT/270-351    AC A0A0S7XEZ0.1
#=GS A0A078J8J0_BRANA/52-149     AC A0A078J8J0.1
#=GS D3B5R7_POLPA/17-115         AC D3B5R7.1
#=GS B9RWG8_RICCO/70-182         AC B9RWG8.1
#=GS A0A0L1J205_ASPNO/68-171     AC A0A0L1J205.1
#=GS A0A147JYP9_9EURY/70-156     AC A0A147JYP9.1
#=GS D8TBS5_SELML/63-154         AC D8TBS5.1
#=GS A0A183MU95_9TREM/3-58       AC A0A183MU95.1
#=GS K3YGQ2_SETIT/180-290        AC K3YGQ2.1
#=GS A0A059B316_EUCGR/76-187     AC A0A059B316.1
#=GS W1P0V8_AMBTC/53-144         AC W1P0V8.1
#=GS M5W3G9_PRUPE/70-160         AC M5W3G9.1
#=GS A0A067GU53_CITSI/1-89       AC A0A067GU53.1
#=GS Q8NLL9_CORGL/56-164         AC Q8NLL9.1
#=GS G3XWT2_ASPNA/33-122         AC G3XWT2.1
#=GS I1GVF8_BRADI/58-149         AC I1GVF8.1
#=GS A0A0G1X7B4_9BACT/35-117     AC A0A0G1X7B4.1
#=GS S0E9N1_GIBF5/69-173         AC S0E9N1.1
#=GS A0A0G1NZM8_9BACT/48-141     AC A0A0G1NZM8.1
#=GS V9G070_PHYPR/62-159         AC V9G070.1
#=GS A0A151TC63_CAJCA/38-129     AC A0A151TC63.1
#=GS A0A0E0M336_ORYPU/185-293    AC A0A0E0M336.1
#=GS A0A0A0MW17_PAPAN/1-86       AC A0A0A0MW17.1
#=GS A0A061E9T4_THECC/139-243    AC A0A061E9T4.1
#=GS A2SS91_METLZ/29-102         AC A2SS91.1
#=GS A0A0X3WXD8_9ACTN/84-189     AC A0A0X3WXD8.1
#=GS A0A094JLR1_9PEZI/70-174     AC A0A094JLR1.1
#=GS G6CKD1_DANPL/72-163         AC G6CKD1.1
#=GS W7TFF3_9STRA/21-127         AC W7TFF3.1
#=GS A0A0D2V971_GOSRA/216-319    AC A0A0D2V971.1
#=GS A0A0Q4RQN1_9BACL/47-151     AC A0A0Q4RQN1.1
#=GS A0A0J8C9Q6_BETVU/147-250    AC A0A0J8C9Q6.1
#=GS M0ULR5_HORVD/179-287        AC M0ULR5.1
#=GS A0A0C9VQW9_9HOMO/47-138     AC A0A0C9VQW9.1
#=GS R5FU03_9FIRM/4-111          AC R5FU03.1
#=GS B6TKL3_MAIZE/68-155         AC B6TKL3.1
#=GS D7SUZ1_VITVI/90-152         AC D7SUZ1.1
#=GS D8U202_VOLCA/218-340        AC D8U202.1
#=GS A0A194WXZ3_9HELO/31-116     AC A0A194WXZ3.1
#=GS A0A059A5M5_EUCGR/185-293    AC A0A059A5M5.1
#=GS D0NUG5_PHYIT/100-198        AC D0NUG5.1
#=GS B5HNH1_9ACTN/78-183         AC B5HNH1.1
#=GS R0I2P0_9BRAS/169-277        AC R0I2P0.1
#=GS F7BW71_CALJA/32-126         AC F7BW71.1
#=GS R7HAD7_9FIRM/92-188         AC R7HAD7.1
#=GS B9RAG4_RICCO/179-283        AC B9RAG4.1
#=GS A0A090ZBS0_PAEMA/1076-1175  AC A0A090ZBS0.1
#=GS A0A0N8P242_DROAN/40-134     AC A0A0N8P242.1
#=GS A0A0L0DJB6_THETB/136-226    AC A0A0L0DJB6.1
#=GS A0A0A8WX00_9BACI/986-1091   AC A0A0A8WX00.1
#=GS A0A0M8WP95_9NOCA/59-170     AC A0A0M8WP95.1
#=GS A0A0E3WHF2_9BACL/41-139     AC A0A0E3WHF2.1
#=GS C2GK23_9CORY/11-106         AC C2GK23.1
#=GS A0A101FRI0_9FIRM/11-86      AC A0A101FRI0.1
#=GS W4EQL2_9BACL/37-134         AC W4EQL2.1
#=GS W5WLW8_9PSEU/54-168         AC W5WLW8.1
#=GS A0A0N9IFP6_9PSEU/61-160     AC A0A0N9IFP6.1
#=GS M0S7P5_MUSAM/148-251        AC M0S7P5.1
#=GS A0A0J8CC87_BETVU/174-282    AC A0A0J8CC87.1
#=GS W2RBY6_PHYPN/189-294        AC W2RBY6.1
#=GS A0A142YMD3_9PLAN/63-159     AC A0A142YMD3.1
#=GS A0A0R3Q331_9BILA/46-144     AC A0A0R3Q331.1
#=GS A0A067EKZ0_CITSI/78-161     AC A0A067EKZ0.1
#=GS E3LNS3_CAERE/25-111         AC E3LNS3.1
#=GS J3N631_ORYBR/45-133         AC J3N631.1
#=GS R6L5C2_9FIRM/55-149         AC R6L5C2.1
#=GS U5C288_9BACT/40-145         AC U5C288.1
#=GS A0A133Q8C4_STALU/65-217     AC A0A133Q8C4.1
#=GS R0GJP9_9BRAS/171-279        AC R0GJP9.1
#=GS A0A0E0MCI8_ORYPU/57-144     AC A0A0E0MCI8.1
#=GS A0A1B6PEN8_SORBI/46-135     AC A0A1B6PEN8.1
#=GS A0A133SHH8_9FIRM/56-148     AC A0A133SHH8.1
#=GS J3LQD1_ORYBR/76-163         AC J3LQD1.1
#=GS A0A061PEK4_9BACL/253-338    AC A0A061PEK4.1
#=GS D3BQW1_POLPA/237-332        AC D3BQW1.1
#=GS V4WFY4_9ROSI/43-130         AC V4WFY4.1
#=GS A0A0P8Y4N1_DROAN/1-52       AC A0A0P8Y4N1.1
#=GS A0A0E0MNX7_ORYPU/828-936    AC A0A0E0MNX7.1
#=GS A0A194X9K6_9HELO/34-121     AC A0A194X9K6.1
#=GS A0A0Q9Y0P3_9BACI/481-586    AC A0A0Q9Y0P3.1
#=GS A2ZI40_ORYSI/53-140         AC A2ZI40.1
#=GS A0A094B561_9PEZI/34-124     AC A0A094B561.1
#=GS A0A0W8DPN0_PHYNI/67-164     AC A0A0W8DPN0.1
#=GS A0A0Q5NPG9_9BURK/52-149     AC A0A0Q5NPG9.1
#=GS E1ZT85_CHLVA/185-288        AC E1ZT85.1
#=GS W5G061_WHEAT/208-295        AC W5G061.1
#=GS A0A078CQM0_BRANA/73-184     AC A0A078CQM0.1
#=GS D7MHC1_ARALL/54-165         AC D7MHC1.1
#=GS Z4WYZ2_9PORP/64-159         AC Z4WYZ2.1
#=GS A9V1G0_MONBE/141-242        AC A9V1G0.1
#=GS W5EHZ5_WHEAT/52-144         AC W5EHZ5.1
#=GS L8G379_PSED2/35-126         AC L8G379.1
#=GS A0A0E0BVP7_9ORYZ/58-152     AC A0A0E0BVP7.1
#=GS A0A0D3VD52_9BACL/242-353    AC A0A0D3VD52.1
#=GS PPA5_ARATH/15-109           AC Q9C927.1
#=GS A0A0B9AEW7_BRELN/78-174     AC A0A0B9AEW7.1
#=GS M4B892_HYAAE/179-284        AC M4B892.1
#=GS E3NDP5_CAERE/20-115         AC E3NDP5.1
#=GS V6JFX1_STRRC/27-120         AC V6JFX1.1
#=GS C2GEW0_9CORY/28-113         AC C2GEW0.1
#=GS A0A0G0JA05_9BACT/503-598    AC A0A0G0JA05.1
#=GS A0A016WRB2_9BILA/17-102     AC A0A016WRB2.1
#=GS A0A136K919_9BACT/223-314    AC A0A136K919.1
#=GS W5F863_WHEAT/1-78           AC W5F863.1
#=GS A0A0E0BP02_9ORYZ/52-144     AC A0A0E0BP02.1
#=GS F5RGY2_METUF/30-115         AC F5RGY2.1
#=GS A0A0P1AE76_9STRA/252-357    AC A0A0P1AE76.1
#=GS A0A059B221_EUCGR/75-187     AC A0A059B221.1
#=GS A0A0C3I1V4_9PEZI/31-116     AC A0A0C3I1V4.1
#=GS A7SXA0_NEMVE/100-220        AC A7SXA0.1
#=GS A0A0B2XIK8_METRA/69-171     AC A0A0B2XIK8.1
#=GS B4GTD4_DROPE/11-101         AC B4GTD4.1
#=GS A0A061EU97_THECC/111-198    AC A0A061EU97.1
#=GS A0A067CXD4_SAPPC/195-286    AC A0A067CXD4.1
#=GS A0A0E4HFZ8_9BACL/1090-1189  AC A0A0E4HFZ8.1
#=GS A0A0X8FB41_9LACT/104-260    AC A0A0X8FB41.1
#=GS A0A067L7L1_JATCU/216-318    AC A0A067L7L1.1
#=GS L8H124_ACACA/143-245        AC L8H124.1
#=GS I1KXK7_SOYBN/173-281        AC I1KXK7.1
#=GS A0A0Q9CC69_9CELL/241-332    AC A0A0Q9CC69.1
#=GS A0A0A0K128_CUCSA/85-176     AC A0A0A0K128.1
#=GS A0A0Q5C8R1_9MICO/56-171     AC A0A0Q5C8R1.1
#=GS A0A1B6PIN9_SORBI/219-337    AC A0A1B6PIN9.1
#=GS A0A151F0R9_9EURY/906-992    AC A0A151F0R9.1
#=GS D8LSG1_ECTSI/215-307        AC D8LSG1.1
#=GS A0A0N5AGB1_9BILA/56-147     AC A0A0N5AGB1.1
#=GS A0A067GUF4_CITSI/216-319    AC A0A067GUF4.1
#=GS A0A0A2U1L8_9BACL/668-765    AC A0A0A2U1L8.1
#=GS K7W3V6_MAIZE/218-321        AC K7W3V6.1
#=GS A0A0E0R4B7_ORYRU/171-260    AC A0A0E0R4B7.1
#=GS R8VU84_9CLOT/55-155         AC R8VU84.1
#=GS D7MQ73_ARALL/172-280        AC D7MQ73.1
#=GS R9PH34_AGAAL/242-332        AC R9PH34.1
#=GS H2UJV6_TAKRU/32-125         AC H2UJV6.1
#=GS A0A0L9TR78_PHAAN/62-153     AC A0A0L9TR78.1
#=GS A0A0G0X5N6_9BACT/44-135     AC A0A0G0X5N6.1
#=GS K3YGM1_SETIT/147-252        AC K3YGM1.1
#=GS A0A0A2VA75_BEABA/73-174     AC A0A0A2VA75.1
#=GS A0A0D0PME8_KITGR/78-183     AC A0A0D0PME8.1
#=GS R0I1R1_9BRAS/64-176         AC R0I1R1.1
#=GS A0A0D9XWY6_9ORYZ/51-139     AC A0A0D9XWY6.1
#=GS R5G5U8_9FIRM/28-128         AC R5G5U8.1
#=GS Q176W6_AEDAE/34-125         AC Q176W6.1
#=GS M4D254_BRARP/49-144         AC M4D254.1
#=GS A0A078ERU4_BRANA/1-90       AC A0A078ERU4.1
#=GS W0F538_9BACT/38-135         AC W0F538.1
#=GS A0A0J8BNA5_BETVU/60-151     AC A0A0J8BNA5.1
#=GS A0A0G1PH06_9BACT/44-136     AC A0A0G1PH06.1
#=GS A0A0G0ZVR4_9BACT/1413-1499  AC A0A0G0ZVR4.1
#=GS A0A0A2IQY6_PENEN/33-122     AC A0A0A2IQY6.1
#=GS Q8A3Z4_BACTN/260-356        AC Q8A3Z4.1
#=GS A0A0W7WWI4_9ACTN/83-188     AC A0A0W7WWI4.1
#=GS A0A0K1PFK4_9DELT/31-113     AC A0A0K1PFK4.1
#=GS A0A072UZV1_MEDTR/129-237    AC A0A072UZV1.1
#=GS A0A172TGR6_9BACL/1073-1172  AC A0A172TGR6.1
#=GS D7FWJ2_ECTSI/62-167         AC D7FWJ2.1
#=GS A0A061DNA0_THECC/72-184     AC A0A061DNA0.1
#=GS A0A0M8TU07_9ACTN/73-178     AC A0A0M8TU07.1
#=GS D8SDQ9_SELML/163-271        AC D8SDQ9.1
#=GS A0A0W8BZI5_PHYNI/174-279    AC A0A0W8BZI5.1
#=GS A0A0K0FW23_9BILA/28-124     AC A0A0K0FW23.1
#=GS A0A151X6Z2_9HYME/25-116     AC A0A151X6Z2.1
#=GS A0A022QZB7_ERYGU/70-182     AC A0A022QZB7.1
#=GS I1K0B0_SOYBN/181-289        AC I1K0B0.2
#=GS A0A0G0VC85_9BACT/33-120     AC A0A0G0VC85.1
#=GS A0A102CZE7_9BACT/837-918    AC A0A102CZE7.1
#=GS K3WC56_PYTUL/152-259        AC K3WC56.1
#=GS R6NJZ3_9CLOT/14-104         AC R6NJZ3.1
#=GS A0A0D3HX61_9ORYZ/75-166     AC A0A0D3HX61.1
#=GS A0A0P0Y702_ORYSJ/52-144     AC A0A0P0Y702.1
#=GS E1TIH7_BURSG/54-150         AC E1TIH7.1
#=GS F4QBY0_DICFS/143-245        AC F4QBY0.1
#=GS A7C020_9GAMM/61-145         AC A7C020.1
#=GS C5YQC5_SORBI/176-284        AC C5YQC5.1
#=GS R7ZWF4_9BACT/30-115         AC R7ZWF4.1
#=GS I9LA22_9FIRM/2-76           AC I9LA22.1
#=GS A0A139TKV9_9FIRM/66-155     AC A0A139TKV9.1
#=GS Q6ZCX8_ORYSJ/78-204         AC Q6ZCX8.1
#=GS F5LDQ1_9BACL/1072-1171      AC F5LDQ1.1
#=GS Q2J4R2_FRASC/106-200        AC Q2J4R2.1
#=GS T1GWM5_MEGSC/170-258        AC T1GWM5.1
#=GS A0A0G0KGM9_9BACT/242-332    AC A0A0G0KGM9.1
#=GS A0A022R2W2_ERYGU/53-144     AC A0A022R2W2.1
#=GS A0A0S6WWM9_9SPHN/52-149     AC A0A0S6WWM9.1
#=GS A0A0G1R9M3_9BACT/271-357    AC A0A0G1R9M3.1
#=GS K3WC58_PYTUL/176-281        AC K3WC58.1
#=GS A0A140LJ99_MOUSE/32-107     AC A0A140LJ99.1
#=GS S5V3P4_STRC3/74-190         AC S5V3P4.1
#=GS A0A059BMV1_EUCGR/44-131     AC A0A059BMV1.1
#=GS B4JMN8_DROGR/1-89           AC B4JMN8.1
#=GS B2HNA0_MYCMM/63-157         AC B2HNA0.1
#=GS A0A0D6Z4J3_9BACI/986-1091   AC A0A0D6Z4J3.1
#=GS M5VLZ4_PRUPE/62-152         AC M5VLZ4.1
#=GS W9QMY5_9ROSA/51-138         AC W9QMY5.1
#=GS C6VTQ4_DYAFD/1497-1589      AC C6VTQ4.1
#=GS A0A0K0FUN1_9BILA/28-125     AC A0A0K0FUN1.1
#=GS K7K7T9_SOYBN/169-277        AC K7K7T9.1
#=GS A0A0B2QU42_GLYSO/166-274    AC A0A0B2QU42.1
#=GS A0A0L9TCH7_PHAAN/175-283    AC A0A0L9TCH7.1
#=GS D7AYU5_NOCDD/64-170         AC D7AYU5.1
#=GS V7C6D6_PHAVU/175-283        AC V7C6D6.1
#=GS I1R941_ORYGL/164-272        AC I1R941.1
#=GS A0A059CKY8_EUCGR/55-146     AC A0A059CKY8.1
#=GS A0A078CA05_BRANA/47-137     AC A0A078CA05.1
#=GS H3H2W3_PHYRM/67-164         AC H3H2W3.1
#=GS A0A183GY11_9BILA/46-137     AC A0A183GY11.1
#=GS H3GCK3_PHYRM/189-294        AC H3GCK3.1
#=GS A0A0B0N519_GOSAR/60-151     AC A0A0B0N519.1
#=GS A0A0L9UVB3_PHAAN/49-141     AC A0A0L9UVB3.1
#=GS L8GXY1_ACACA/14-124         AC L8GXY1.1
#=GS A0A067DW31_CITSI/86-198     AC A0A067DW31.1
#=GS A0A078IAH2_BRANA/54-148     AC A0A078IAH2.1
#=GS K1PZ22_CRAGI/27-124         AC K1PZ22.1
#=GS A0A0G0RF02_9BACT/1416-1503  AC A0A0G0RF02.1
#=GS A0A158R0D5_NIPBR/368-453    AC A0A158R0D5.1
#=GS A0A058Z1P2_9EUKA/353-450    AC A0A058Z1P2.1
#=GS A0A0E0MJN6_ORYPU/49-142     AC A0A0E0MJN6.1
#=GS A0A0G0EYN6_9BACT/303-397    AC A0A0G0EYN6.1
#=GS A0A0S7X1T8_9BACT/26-127     AC A0A0S7X1T8.1
#=GS A0A0B7NQ03_9FUNG/57-156     AC A0A0B7NQ03.1
#=GS A0A094CHX2_9PEZI/37-128     AC A0A094CHX2.1
#=GS A0A0G0Q3F7_9BACT/1772-1862  AC A0A0G0Q3F7.1
#=GS D7WDW6_9CORY/85-174         AC D7WDW6.1
#=GS D0MQE1_PHYIT/44-159         AC D0MQE1.1
#=GS A0A059BG82_EUCGR/175-283    AC A0A059BG82.1
#=GS A0A0G0KFU2_9BACT/393-486    AC A0A0G0KFU2.1
#=GS A0A0G0RF02_9BACT/1068-1165  AC A0A0G0RF02.1
#=GS W7MET3_GIBM7/69-173         AC W7MET3.1
#=GS E1Z2T8_CHLVA/30-145         AC E1Z2T8.1
#=GS R0F4G6_9BRAS/56-147         AC R0F4G6.1
#=GS B2RRA7_MOUSE/90-183         AC B2RRA7.1
#=GS K3Z4U0_SETIT/168-276        AC K3Z4U0.1
#=GS V9EIN1_PHYPR/63-160         AC V9EIN1.1
#=GS G2NQD5_STREK/48-143         AC G2NQD5.1
#=GS A0A0A1TP43_9HYPO/30-121     AC A0A0A1TP43.1
#=GS D0MY72_PHYIT/195-301        AC D0MY72.1
#=GS D7TS77_VITVI/55-166         AC D7TS77.1
#=GS E3MEM2_CAERE/22-117         AC E3MEM2.1
#=GS V7CE31_PHAVU/182-290        AC V7CE31.1
#=GS A0A094G2D6_9PEZI/70-174     AC A0A094G2D6.1
#=GS A0A0E0RDU4_ORYRU/52-144     AC A0A0E0RDU4.1
#=GS A0A087HB55_ARAAL/43-131     AC A0A087HB55.1
#=GS A0A0B2RRI3_GLYSO/181-289    AC A0A0B2RRI3.1
#=GS A0A0N4ZIJ6_PARTI/26-121     AC A0A0N4ZIJ6.1
#=GS M8AT23_TRIUA/1-81           AC M8AT23.1
#=GS A0A089JVC8_9BACL/346-457    AC A0A089JVC8.1
#=GS A0A0D2VG39_GOSRA/47-139     AC A0A0D2VG39.1
#=GS A0A0C3N8P4_PISTI/50-139     AC A0A0C3N8P4.1
#=GS A0A0G1NPV7_9BACT/177-271    AC A0A0G1NPV7.1
#=GS A0A0N5C003_STREA/28-121     AC A0A0N5C003.1
#=GS T1IAF1_RHOPR/25-116         AC T1IAF1.1
#=GS A0A0C9Y4A6_9AGAR/54-144     AC A0A0C9Y4A6.1
#=GS F7KVT4_9FIRM/689-796        AC F7KVT4.1
#=GS S2CYC9_9BACT/38-142         AC S2CYC9.1
#=GS K7JHQ3_NASVI/26-123         AC K7JHQ3.1
#=GS L8GV66_ACACA/1-82           AC L8GV66.1
#=GS A0A078CML9_BRANA/60-147     AC A0A078CML9.1
#=GS J3NBE7_ORYBR/49-136         AC J3NBE7.1
#=GS R5TX85_9CLOT/311-405        AC R5TX85.1
#=GS A0A067DKE7_CITSI/11-91      AC A0A067DKE7.1
#=GS A0A078IGA5_BRANA/66-157     AC A0A078IGA5.1
#=GS W6UJR3_9SPHI/33-131         AC W6UJR3.1
#=GS A0A0B2JZL6_9FIRM/53-146     AC A0A0B2JZL6.1
#=GS A0A078H7T4_BRANA/146-249    AC A0A078H7T4.1
#=GS A0A0M9Y7Z5_9ACTN/64-157     AC A0A0M9Y7Z5.1
#=GS A0A183F3S8_HELBK/2-60       AC A0A183F3S8.1
#=GS C6D1I1_PAESJ/45-147         AC C6D1I1.1
#=GS A0A0F4GTH6_9PEZI/1-74       AC A0A0F4GTH6.1
#=GS A0A0G0MX77_9BACT/45-133     AC A0A0G0MX77.1
#=GS D8RA20_SELML/204-301        AC D8RA20.1
#=GS A0A022S424_ERYGU/216-319    AC A0A022S424.1
#=GS A0A0E0Q0Q7_ORYRU/54-145     AC A0A0E0Q0Q7.1
#=GS D8SF22_SELML/1-86           AC D8SF22.1
#=GS A0A0G3HID1_9CORY/58-152     AC A0A0G3HID1.1
#=GS E4RXB1_LEAB4/24-120         AC E4RXB1.1
#=GS F3B8P0_9FIRM/71-165         AC F3B8P0.1
#=GS K3XHB2_SETIT/67-158         AC K3XHB2.1
#=GS A0A0G1VCX1_9BACT/157-240    AC A0A0G1VCX1.1
#=GS G7JA60_MEDTR/71-183         AC G7JA60.1
#=GS A0A1B6PDN0_SORBI/257-365    AC A0A1B6PDN0.1
#=GS K3Y6Q4_SETIT/112-199        AC K3Y6Q4.1
#=GS A0A094GZQ4_9PEZI/37-128     AC A0A094GZQ4.1
#=GS R7ZW56_9BACT/32-118         AC R7ZW56.1
#=GS A0A0D3DPK8_BRAOL/148-251    AC A0A0D3DPK8.1
#=GS I0YV31_COCSC/53-158         AC I0YV31.1
#=GS V4T9Z4_9ROSI/1-71           AC V4T9Z4.1
#=GS A0A0G1BBB1_9BACT/43-131     AC A0A0G1BBB1.1
#=GS F0ZXR4_DICPU/24-120         AC F0ZXR4.1
#=GS Q7MX70_PORGI/75-170         AC Q7MX70.1
#=GS A0A0D0FZA2_9SPHI/49-141     AC A0A0D0FZA2.1
#=GS A0A0K9NPI8_ZOSMR/185-289    AC A0A0K9NPI8.1
#=GS A0A0J6WX90_9FIRM/55-145     AC A0A0J6WX90.1
#=GS M4RVC4_9ALTE/43-156         AC M4RVC4.1
#=GS D8LBI4_ECTSI/69-169         AC D8LBI4.1
#=GS A0A093ZSN0_9PEZI/37-128     AC A0A093ZSN0.1
#=GS A6LC45_PARD8/276-373        AC A6LC45.1
#=GS R7CP86_9FIRM/44-135         AC R7CP86.1
#=GS R7ZV11_9BACT/32-119         AC R7ZV11.1
#=GS W3XIX8_9PEZI/31-122         AC W3XIX8.1
#=GS J3MYZ9_ORYBR/175-283        AC J3MYZ9.1
#=GS A0A0B2WSA1_9HYPO/35-121     AC A0A0B2WSA1.1
#=GS I1MU35_SOYBN/92-183         AC I1MU35.1
#=GS H3GZF8_PHYRM/102-200        AC H3GZF8.1
#=GS A0A142XDF5_9PLAN/46-134     AC A0A142XDF5.1
#=GS E9H0F5_DAPPU/38-132         AC E9H0F5.1
#=GS K4BXU9_SOLLC/163-271        AC K4BXU9.1
#=GS A0A0G1JVH7_9BACT/3024-3110  AC A0A0G1JVH7.1
#=GS A0A0M2Z0E9_9ACTN/71-176     AC A0A0M2Z0E9.1
#=GS A0A0D2VEF6_GOSRA/47-139     AC A0A0D2VEF6.1
#=GS A0A0G1R103_9BACT/199-284    AC A0A0G1R103.1
#=GS V9EYW7_PHYPR/198-304        AC V9EYW7.1
#=GS Q54NC3_DICDI/33-134         AC Q54NC3.1
#=GS K3WGC0_PYTUL/51-160         AC K3WGC0.1
#=GS F4Q454_DICFS/209-306        AC F4Q454.1
#=GS A0A0B8PKW6_9VIBR/48-131     AC A0A0B8PKW6.1
#=GS A0A0M8VPX6_9ACTN/985-1077   AC A0A0M8VPX6.1
#=GS E9ED37_METAQ/26-116         AC E9ED37.1
#=GS R4SYL9_AMYOR/56-161         AC R4SYL9.1
#=GS A0A0D2Y395_FUSO4/69-173     AC A0A0D2Y395.1
#=GS A0A0D3DLM4_BRAOL/77-188     AC A0A0D3DLM4.1
#=GS K4DC68_SOLLC/53-144         AC K4DC68.1
#=GS I1Q7H7_ORYGL/142-247        AC I1Q7H7.1
#=GS R5SI63_9BACE/27-138         AC R5SI63.1
#=GS D4IQB9_9BACT/30-126         AC D4IQB9.1
#=GS W2EQ43_9ACTN/31-124         AC W2EQ43.1
#=GS A0A0D4DK17_9ACTN/118-223    AC A0A0D4DK17.1
#=GS A0A0D9WUR1_9ORYZ/146-252    AC A0A0D9WUR1.1
#=GS A0A0B2SQ83_GLYSO/72-183     AC A0A0B2SQ83.1
#=GS A0A084VHC1_ANOSI/39-130     AC A0A084VHC1.1
#=GS M4EIB9_BRARP/49-136         AC M4EIB9.1
#=GS V4LS82_EUTSA/52-149         AC V4LS82.1
#=GS R6FWB2_9FIRM/1038-1144      AC R6FWB2.1
#=GS W9WZU9_9EURO/27-101         AC W9WZU9.1
#=GS K4IFM9_PSYTT/23-114         AC K4IFM9.1
#=GS D0MXF2_PHYIT/62-159         AC D0MXF2.1
#=GS A0A178AJV5_9PLEO/34-122     AC A0A178AJV5.1
#=GS A0A0U1KTL6_9FIRM/37-133     AC A0A0U1KTL6.1
#=GS A0A0R3NY95_DROPS/42-135     AC A0A0R3NY95.1
#=GS I0Z0Q6_COCSC/156-263        AC I0Z0Q6.1
#=GS N1S1R9_FUSC4/69-173         AC N1S1R9.1
#=GS A0A0J8CQ12_BETVU/70-181     AC A0A0J8CQ12.1
#=GS A0A0D9W4M1_9ORYZ/76-164     AC A0A0D9W4M1.1
#=GS A0A0M2VDF7_9GAMM/23-119     AC A0A0M2VDF7.1
#=GS M5X708_PRUPE/220-322        AC M5X708.1
#=GS M5XEB3_PRUPE/50-161         AC M5XEB3.1
#=GS H3GKX7_PHYRM/195-301        AC H3GKX7.1
#=GS B9HXL1_POPTR/143-246        AC B9HXL1.2
#=GS A0A154P6J4_9HYME/26-117     AC A0A154P6J4.1
#=GS A0A059BQK3_EUCGR/61-152     AC A0A059BQK3.1
#=GS V4SZR4_9ROSI/174-282        AC V4SZR4.1
#=GS A0A0G1JVH7_9BACT/2829-2916  AC A0A0G1JVH7.1
#=GS A0A0G0X3I9_9BACT/1390-1475  AC A0A0G0X3I9.1
#=GS A0A0M3IZS6_ANISI/3-86       AC A0A0M3IZS6.1
#=GS W1P2U4_AMBTC/52-145         AC W1P2U4.1
#=GS A0A0K0EPS5_STRER/28-121     AC A0A0K0EPS5.1
#=GS D7SGY6_VITVI/176-284        AC D7SGY6.1
#=GS A0A100YV09_9ACTN/987-1083   AC A0A100YV09.1
#=GS A0A072SIU6_9ACTN/48-143     AC A0A072SIU6.1
#=GS R0I977_9BRAS/50-147         AC R0I977.1
#=GS A0A069DEB4_9BACL/36-135     AC A0A069DEB4.1
#=GS B8B909_ORYSI/78-204         AC B8B909.1
#=GS K4CPW9_SOLLC/165-273        AC K4CPW9.1
#=GS D7U680_VITVI/65-177         AC D7U680.1
#=GS B9SXP8_RICCO/55-104         AC B9SXP8.1
#=GS M0ZWN5_SOLTU/60-151         AC M0ZWN5.1
#=GS A0A0E0QLL2_ORYRU/247-358    AC A0A0E0QLL2.1
#=GS A0A087H2B1_ARAAL/75-186     AC A0A087H2B1.1
#=GS A0A0Q8FBR5_9GAMM/46-141     AC A0A0Q8FBR5.1
#=GS A0A061EL35_THECC/68-179     AC A0A061EL35.1
#=GS A0A0W8CAC0_PHYNI/63-160     AC A0A0W8CAC0.1
#=GS A0A142XHK5_9PLAN/47-149     AC A0A142XHK5.1
#=GS B9RCW2_RICCO/141-244        AC B9RCW2.1
#=GS A0A0C3FKP0_9HOMO/46-137     AC A0A0C3FKP0.1
#=GS C6VYH5_DYAFD/27-107         AC C6VYH5.1
#=GS G4ZZW8_PHYSP/91-189         AC G4ZZW8.1
#=GS B8BDB2_ORYSI/186-294        AC B8BDB2.1
#=GS C0Q8W1_DESAH/50-147         AC C0Q8W1.1
#=GS M2XHJ6_GALSU/118-230        AC M2XHJ6.1
#=GS A0A0G0IBQ4_9BACT/715-802    AC A0A0G0IBQ4.1
#=GS C6XSI9_PEDHD/23-117         AC C6XSI9.1
#=GS W2Y9T1_PHYPR/70-169         AC W2Y9T1.1
#=GS A0A0D9ZKF7_9ORYZ/52-141     AC A0A0D9ZKF7.1
#=GS D3ALM4_9CLOT/479-573        AC D3ALM4.1
#=GS B4FA21_MAIZE/179-291        AC B4FA21.1
#=GS W2TWF9_NECAM/40-134         AC W2TWF9.1
#=GS M5XVP8_PRUPE/168-275        AC M5XVP8.1
#=GS E2SCW0_9ACTN/41-133         AC E2SCW0.1
#=GS A0A0D3EV42_9ORYZ/206-309    AC A0A0D3EV42.1
#=GS G7JLE0_MEDTR/184-292        AC G7JLE0.1
#=GS H1YE16_9SPHI/45-142         AC H1YE16.1
#=GS A0A078DKG6_BRANA/57-148     AC A0A078DKG6.1
#=GS A0A078G2U7_BRANA/43-130     AC A0A078G2U7.1
#=GS A0A0M8T8V0_9ACTN/80-186     AC A0A0M8T8V0.1
#=GS F2UK05_SALR5/155-257        AC F2UK05.1
#=GS R6J9M3_9FIRM/42-133         AC R6J9M3.1
#=GS A0A067FR60_CITSI/76-188     AC A0A067FR60.1
#=GS PPA25_ARATH/51-147          AC O23244.2
#=GS A0A0A2EW49_9PORP/53-149     AC A0A0A2EW49.1
#=GS A0A151UCZ6_CAJCA/168-276    AC A0A151UCZ6.1
#=GS A0A0G1TSN8_9BACT/44-135     AC A0A0G1TSN8.1
#=GS A0A132B8R0_9HELO/25-112     AC A0A132B8R0.1
#=GS M0SU42_MUSAM/169-277        AC M0SU42.1
#=GS W7TKC9_9STRA/38-161         AC W7TKC9.1
#=GS A0A0J8B5H2_BETVU/174-282    AC A0A0J8B5H2.1
#=GS A0A0K9RRU8_SPIOL/62-153     AC A0A0K9RRU8.1
#=GS A0A140LHD2_MOUSE/32-125     AC A0A140LHD2.1
#=GS A0A059DFE2_EUCGR/57-144     AC A0A059DFE2.1
#=GS A0A0S8IC74_9CHLR/93-170     AC A0A0S8IC74.1
#=GS A0A0D2R6A6_GOSRA/60-151     AC A0A0D2R6A6.1
#=GS A0A0G1X737_9BACT/393-488    AC A0A0G1X737.1
#=GS M5XDE4_PRUPE/58-150         AC M5XDE4.1
#=GS I1HSI5_BRADI/205-308        AC I1HSI5.1
#=GS F1MUZ7_BOVIN/32-125         AC F1MUZ7.2
#=GS A0A0G1XQJ1_9BACT/236-325    AC A0A0G1XQJ1.1
#=GS W5FCZ6_WHEAT/106-219        AC W5FCZ6.1
#=GS Q1NEE5_SPHSS/41-138         AC Q1NEE5.1
#=GS A0A164MYV6_9NOCA/80-174     AC A0A164MYV6.1
#=GS G0IVE7_CYCMS/28-115         AC G0IVE7.1
#=GS Q54TC4_DICDI/142-245        AC Q54TC4.1
#=GS A0A067KT19_JATCU/65-177     AC A0A067KT19.1
#=GS A0A0M9DVX9_9DELT/25-116     AC A0A0M9DVX9.1
#=GS A0A0L0N9Q0_9HYPO/34-122     AC A0A0L0N9Q0.1
#=GS R6XXU9_9BACT/27-116         AC R6XXU9.1
#=GS R5CRB4_9BACT/56-170         AC R5CRB4.1
#=GS A0A0G1MCI8_9BACT/43-139     AC A0A0G1MCI8.1
#=GS A0A136LVU3_9BACT/407-496    AC A0A136LVU3.1
#=GS C5C578_BEUC1/37-148         AC C5C578.1
#=GS D7U5K4_VITVI/64-155         AC D7U5K4.1
#=GS A0A087HND8_ARAAL/144-247    AC A0A087HND8.1
#=GS A0A0T5ZYB3_9BACT/155-244    AC A0A0T5ZYB3.1
#=GS A4APF5_MARSH/35-119         AC A4APF5.1
#=GS A0A087U155_9ARAC/28-119     AC A0A087U155.1
#=GS A0A0G0ZVR4_9BACT/979-1079   AC A0A0G0ZVR4.1
#=GS M0W8X3_HORVD/5-92           AC M0W8X3.1
#=GS F4W5K7_ACREC/217-308        AC F4W5K7.1
#=GS M4DT56_BRARP/145-248        AC M4DT56.1
#=GS A0A0D3DSL6_BRAOL/43-132     AC A0A0D3DSL6.1
#=GS A0A0D3FRC6_9ORYZ/63-176     AC A0A0D3FRC6.1
#=GS V7CA77_PHAVU/53-144         AC V7CA77.1
#=GS A0A0L0LNY6_9BACT/111-210    AC A0A0L0LNY6.1
#=GS A0A0L9TQ27_PHAAN/179-287    AC A0A0L9TQ27.1
#=GS M5WZ64_PRUPE/179-287        AC M5WZ64.1
#=GS M4D9A9_BRARP/57-148         AC M4D9A9.1
#=GS A0A0A0KH55_CUCSA/52-145     AC A0A0A0KH55.1
#=GS J3MYZ8_ORYBR/190-299        AC J3MYZ8.1
#=GS H2VZB8_CAEJA/24-108         AC H2VZB8.2
#=GS M0ULR6_HORVD/111-219        AC M0ULR6.1
#=GS A0A0D2S4L0_GOSRA/58-147     AC A0A0D2S4L0.1
#=GS W5FMA6_WHEAT/89-197         AC W5FMA6.1
#=GS A4DA60_ASPFU/34-123         AC A4DA60.1
#=GS R0F3I2_9BRAS/174-282        AC R0F3I2.1
#=GS A0A0G0F2C5_9BACT/40-174     AC A0A0G0F2C5.1
#=GS G7JHG7_MEDTR/144-247        AC G7JHG7.2
#=GS G0J149_CYCMS/229-325        AC G0J149.1
#=GS A0A0G0NI08_9BACT/3891-3980  AC A0A0G0NI08.1
#=GS A0A059ADK5_EUCGR/219-322    AC A0A059ADK5.1
#=GS K1VYK9_TRIAC/69-172         AC K1VYK9.1
#=GS A0A067H5X3_CITSI/101-204    AC A0A067H5X3.1
#=GS A0A022RK57_ERYGU/53-144     AC A0A022RK57.1
#=GS A0A0G0FDQ3_9BACT/308-396    AC A0A0G0FDQ3.1
#=GS W2PPR6_PHYPN/90-188         AC W2PPR6.1
#=GS F6HF85_VITVI/144-247        AC F6HF85.1
#=GS K9TA43_9CYAN/44-128         AC K9TA43.1
#=GS L9KWS0_TUPCH/172-299        AC L9KWS0.1
#=GS D8RFJ9_SELML/163-271        AC D8RFJ9.1
#=GS K4ZPF9_PAEAL/1079-1178      AC K4ZPF9.1
#=GS A0A0L9VA09_PHAAN/42-131     AC A0A0L9VA09.1
#=GS A0A0A0L9I1_CUCSA/65-176     AC A0A0A0L9I1.1
#=GS A0A0F7HJ36_9STAP/81-232     AC A0A0F7HJ36.1
#=GS A0A0D3AVP8_BRAOL/141-244    AC A0A0D3AVP8.1
#=GS A0A0A6QC18_9BURK/57-153     AC A0A0A6QC18.1
#=GS R7LEQ5_9BACT/56-170         AC R7LEQ5.1
#=GS W2RHX2_PHYPN/61-158         AC W2RHX2.1
#=GS A0A067K2B4_JATCU/56-147     AC A0A067K2B4.1
#=GS I1QQ84_ORYGL/186-294        AC I1QQ84.1
#=GS A9TQR8_PHYPA/243-346        AC A9TQR8.1
#=GS A0A093YH40_9PEZI/36-127     AC A0A093YH40.1
#=GS A0A0K9R6M9_SPIOL/42-129     AC A0A0K9R6M9.1
#=GS A0A0E0QTG6_ORYRU/175-283    AC A0A0E0QTG6.1
#=GS A0A0C1HFN9_9CHLA/26-113     AC A0A0C1HFN9.1
#=GS A0A101VUM2_9BACT/255-330    AC A0A101VUM2.1
#=GS Q54SB4_DICDI/25-121         AC Q54SB4.1
#=GS W5CFL4_WHEAT/1-77           AC W5CFL4.1
#=GS A0A0X3S725_9ACTN/42-143     AC A0A0X3S725.1
#=GS A7S4Y3_NEMVE/29-123         AC A7S4Y3.1
#=GS M7Z3U5_TRIUA/77-167         AC M7Z3U5.1
#=GS M7SUS8_EUTLA/18-98          AC M7SUS8.1
#=GS A0A0B0HYC1_9BACL/607-706    AC A0A0B0HYC1.1
#=GS M1CR75_SOLTU/168-276        AC M1CR75.1
#=GS K3WU61_PYTUL/165-281        AC K3WU61.1
#=GS I1MY91_SOYBN/94-206         AC I1MY91.2
#=GS Q8ES41_OCEIH/55-153         AC Q8ES41.1
#=GS A9V9Z9_MONBE/24-119         AC A9V9Z9.1
#=GS B9IL00_POPTR/63-154         AC B9IL00.1
#=GS B9I0D9_POPTR/42-130         AC B9I0D9.1
#=GS A0A162YLN6_9FLAO/1490-1582  AC A0A162YLN6.1
#=GS E6U9D4_ETHHY/981-1082       AC E6U9D4.1
#=GS A0A0R1N352_9LACO/987-1088   AC A0A0R1N352.1
#=GS V4NV26_EUTSA/15-109         AC V4NV26.1
#=GS A0A117DXS8_ASPNG/798-901    AC A0A117DXS8.1
#=GS A0A0B2PVH0_GLYSO/222-322    AC A0A0B2PVH0.1
#=GS A0A0K9NXK9_ZOSMR/62-153     AC A0A0K9NXK9.1
#=GS A0A094GRD8_9PEZI/34-124     AC A0A094GRD8.1
#=GS G9PC97_HYPAI/22-112         AC G9PC97.1
#=GS A0A014R1N7_9HYPO/35-122     AC A0A014R1N7.1
#=GS E6WSA1_PSEUU/46-141         AC E6WSA1.1
#=GS W5EN93_WHEAT/19-127         AC W5EN93.1
#=GS F4CA56_SPHS2/40-139         AC F4CA56.1
#=GS D7SNS9_VITVI/69-181         AC D7SNS9.1
#=GS A0A0A2U3Q8_9BACL/346-457    AC A0A0A2U3Q8.1
#=GS A0A0G1WED0_9BACT/279-366    AC A0A0G1WED0.1
#=GS A0A0A0KRS7_CUCSA/197-300    AC A0A0A0KRS7.1
#=GS K3Y5Z1_SETIT/167-275        AC K3Y5Z1.1
#=GS W9RXW9_9ROSA/60-152         AC W9RXW9.1
#=GS E1ZD44_CHLVA/59-156         AC E1ZD44.1
#=GS A0A151TF71_CAJCA/176-284    AC A0A151TF71.1
#=GS I1QQ83_ORYGL/213-324        AC I1QQ83.1
#=GS T0QEN4_9STRA/126-233        AC T0QEN4.1
#=GS A0A0G1BM77_9BACT/175-266    AC A0A0G1BM77.1
#=GS A0A0E0R4B8_ORYRU/56-143     AC A0A0E0R4B8.1
#=GS A0A127A1I5_9MICC/62-155     AC A0A127A1I5.1
#=GS Q55F77_DICDI/79-179         AC Q55F77.1
#=GS A0A136PQG1_9ACTN/49-151     AC A0A136PQG1.1
#=GS A0A0P1AUY5_9STRA/240-346    AC A0A0P1AUY5.1
#=GS W2YJU8_PHYPR/100-198        AC W2YJU8.1
#=GS A0A0M8V6W2_9ACTN/74-190     AC A0A0M8V6W2.1
#=GS A0A0D9XFE3_9ORYZ/198-307    AC A0A0D9XFE3.1
#=GS A0A0D2TFP9_GOSRA/97-209     AC A0A0D2TFP9.1
#=GS A9SXV5_PHYPA/51-140         AC A9SXV5.1
#=GS A0A0S7XVZ2_9COXI/885-982    AC A0A0S7XVZ2.1
#=GS A0A067FSN4_CITSI/169-277    AC A0A067FSN4.1
#=GS A0A0G0EPD7_9BACT/153-257    AC A0A0G0EPD7.1
#=GS A0A0D3HRH2_9ORYZ/52-144     AC A0A0D3HRH2.1
#=GS A0A078GH08_BRANA/71-183     AC A0A078GH08.1
#=GS V7CXH5_PHAVU/47-135         AC V7CXH5.1
#=GS I1IUC3_BRADI/48-137         AC I1IUC3.1
#=GS A0A0E0RKH6_ORYRU/59-153     AC A0A0E0RKH6.1
#=GS I1R877_ORYGL/61-152         AC I1R877.1
#=GS A0A0D3FVK7_9ORYZ/52-141     AC A0A0D3FVK7.1
#=GS A0A0K9PHR9_ZOSMR/89-180     AC A0A0K9PHR9.1
#=GS E8R110_ISOPI/281-364        AC E8R110.1
#=GS F4PLI1_DICFS/142-245        AC F4PLI1.1
#=GS A0A061DM70_THECC/72-184     AC A0A061DM70.1
#=GS V9E548_PHYPR/471-570        AC V9E548.1
#=GS L1IIC8_GUITH/48-173         AC L1IIC8.1
#=GS A0A0L0KMP4_9ACTN/74-179     AC A0A0L0KMP4.1
#=GS A0A078FZV2_BRANA/77-188     AC A0A078FZV2.1
#=GS A0A0D3AF73_BRAOL/77-188     AC A0A0D3AF73.1
#=GS A0A158R903_TAEAS/1-83       AC A0A158R903.1
#=GS A0A0D3HW08_9ORYZ/120-228    AC A0A0D3HW08.1
#=GS K0N4S3_DESTT/36-133         AC K0N4S3.1
#=GS A0A0D3E3C5_BRAOL/53-147     AC A0A0D3E3C5.1
#=GS A9TI15_PHYPA/58-148         AC A9TI15.1
#=GS A0A0G0PVC7_9BACT/249-339    AC A0A0G0PVC7.1
#=GS A0A059B2E2_EUCGR/76-187     AC A0A059B2E2.1
#=GS V7C1V6_PHAVU/76-187         AC V7C1V6.1
#=GS I1NS51_ORYGL/57-148         AC I1NS51.1
#=GS A5B1B3_VITVI/58-149         AC A5B1B3.1
#=GS M0Y7T9_HORVD/40-132         AC M0Y7T9.1
#=GS A0A0J8D3C8_BETVU/62-153     AC A0A0J8D3C8.1
#=GS W5P7J9_SHEEP/38-131         AC W5P7J9.1
#=GS Q2SG19_HAHCH/38-127         AC Q2SG19.1
#=GS W2UNE5_9FLAO/23-108         AC W2UNE5.1
#=GS A6GMQ1_9BURK/72-175         AC A6GMQ1.1
#=GS C5ACX1_BURGB/56-152         AC C5ACX1.1
#=GS A0A0C2J9F0_THEKT/1-97       AC A0A0C2J9F0.1
#=GS D8RM59_SELML/77-168         AC D8RM59.1
#=GS C1ECJ3_MICCC/28-128         AC C1ECJ3.1
#=GS A0A0E0BUF1_9ORYZ/164-272    AC A0A0E0BUF1.1
#=GS R7PB23_9BACT/10-113         AC R7PB23.1
#=GS K3Y7X5_SETIT/136-222        AC K3Y7X5.1
#=GS B9RP16_RICCO/54-145         AC B9RP16.1
#=GS A0A0D2QEW0_GOSRA/71-183     AC A0A0D2QEW0.1
#=GS H1CY34_9FIRM/44-136         AC H1CY34.1
#=GS H2MQS4_ORYLA/35-128         AC H2MQS4.1
#=GS A0A136MCR6_9BACT/26-104     AC A0A136MCR6.1
#=GS A0A0K9R972_SPIOL/67-179     AC A0A0K9R972.1
#=GS J9JN10_ACYPI/26-117         AC J9JN10.1
#=GS D2VFX2_NAEGR/23-130         AC D2VFX2.1
#=GS I0Z5F6_COCSC/40-128         AC I0Z5F6.1
#=GS E6U2K9_ETHHY/322-411        AC E6U2K9.1
#=GS D8T1V8_SELML/165-275        AC D8T1V8.1
#=GS A0A078H974_BRANA/174-282    AC A0A078H974.1
#=GS J3NFB2_ORYBR/24-103         AC J3NFB2.1
#=GS A0A0N1FZ24_9ACTN/79-184     AC A0A0N1FZ24.1
#=GS A0A0L7LVE1_9NEOP/32-106     AC A0A0L7LVE1.1
#=GS A0A087HDJ4_ARAAL/56-150     AC A0A087HDJ4.1
#=GS W1S8Z7_9SPHN/45-145         AC W1S8Z7.1
#=GS M0VMH5_HORVD/188-296        AC M0VMH5.1
#=GS I0L2U7_9ACTN/48-142         AC I0L2U7.1
#=GS A0A176VVN2_MARPO/147-250    AC A0A176VVN2.1
#=GS V4KCI4_EUTSA/172-280        AC V4KCI4.1
#=GS Q01RC9_SOLUE/487-572        AC Q01RC9.1
#=GS A0A0G3AMP4_9ACTN/74-179     AC A0A0G3AMP4.1
#=GS A0A067L4U3_JATCU/44-132     AC A0A067L4U3.1
#=GS A9SQV9_PHYPA/158-260        AC A9SQV9.1
#=GS V4PAR2_9CAUL/47-148         AC V4PAR2.1
#=GS R7K0L4_9CLOT/1215-1311      AC R7K0L4.1
#=GS V5IM44_NEUCR/19-108         AC V5IM44.1
#=GS F4Q0B9_DICFS/1-86           AC F4Q0B9.1
#=GS M5GFE0_DACPD/169-272        AC M5GFE0.1
#=GS I1LN19_SOYBN/47-159         AC I1LN19.2
#=GS A0A0C2GZK3_9BILA/40-134     AC A0A0C2GZK3.1
#=GS A0A078C969_BRANA/47-138     AC A0A078C969.1
#=GS B6QA84_TALMQ/74-178         AC B6QA84.1
#=GS A0A090VNG3_9FLAO/56-165     AC A0A090VNG3.1
#=GS W9SBY2_9ROSA/118-226        AC W9SBY2.1
#=GS A0A0L0LBH3_9BACT/113-213    AC A0A0L0LBH3.1
#=GS B4XB31_BRANA/60-151         AC B4XB31.1
#=GS A0A0X8FLE7_9LACT/64-225     AC A0A0X8FLE7.1
#=GS W2PH43_PHYPN/199-305        AC W2PH43.1
#=GS A0A0G1BXK6_9BACT/116-201    AC A0A0G1BXK6.1
#=GS V9GGY4_9BACL/1073-1172      AC V9GGY4.1
#=GS K4B3L8_SOLLC/17-108         AC K4B3L8.1
#=GS A0A0G0WMY8_9BACT/45-133     AC A0A0G0WMY8.1
#=GS A0A175YJ96_DAUCA/67-179     AC A0A175YJ96.1
#=GS A0A0D2C4B9_9EURO/27-117     AC A0A0D2C4B9.1
#=GS V4TTP7_9ROSI/76-188         AC V4TTP7.1
#=GS S8CEC9_9LAMI/103-207        AC S8CEC9.1
#=GS W5AQK6_WHEAT/143-248        AC W5AQK6.1
#=GS A0A0G1YPC3_9BACT/27-120     AC A0A0G1YPC3.1
#=GS A0A0F6YH76_9DELT/17-100     AC A0A0F6YH76.1
#=GS M5VPK4_PRUPE/62-153         AC M5VPK4.1
#=GS A0A0U3Q144_9ACTN/46-143     AC A0A0U3Q144.1
#=GS A0A0G0GFF0_9BACT/1437-1530  AC A0A0G0GFF0.1
#=GS E9DRE6_METAQ/35-122         AC E9DRE6.1
#=GS A0A0S7XLP1_9BACT/34-112     AC A0A0S7XLP1.1
#=GS A0A0B0PB97_GOSAR/60-151     AC A0A0B0PB97.1
#=GS W5FC70_WHEAT/173-281        AC W5FC70.1
#=GS A0A059A5X0_EUCGR/185-293    AC A0A059A5X0.1
#=GS K7TM89_MAIZE/45-132         AC K7TM89.1
#=GS A0A0A0KTR4_CUCSA/6-59       AC A0A0A0KTR4.1
#=GS A0A0B2BV75_9ACTN/32-125     AC A0A0B2BV75.1
#=GS D7LUB4_ARALL/51-138         AC D7LUB4.1
#=GS U1NZB2_ASCSU/44-135         AC U1NZB2.1
#=GS A0A094EEB1_9PEZI/555-641    AC A0A094EEB1.1
#=GS A0A0J8BHB8_BETVU/62-153     AC A0A0J8BHB8.1
#=GS V4P9G9_EUTSA/60-171         AC V4P9G9.1
#=GS A0A0N4V7Z2_ENTVE/3-87       AC A0A0N4V7Z2.1
#=GS A0A183CNU3_GLOPA/58-150     AC A0A183CNU3.1
#=GS A0A0D2P9T7_GOSRA/97-209     AC A0A0D2P9T7.1
#=GS A0A0P0W5I6_ORYSJ/8-89       AC A0A0P0W5I6.1
#=GS E1SU92_FERBD/227-315        AC E1SU92.1
#=GS A0A0D3VHW7_9BACL/37-137     AC A0A0D3VHW7.1
#=GS B9GRH6_POPTR/79-170         AC B9GRH6.2
#=GS F8EB32_RUNSL/33-129         AC F8EB32.1
#=GS A0A162AG32_DAUCA/50-138     AC A0A162AG32.1
#=GS A0A087SMN3_AUXPR/149-252    AC A0A087SMN3.1
#=GS Q2S0Z7_SALRD/59-160         AC Q2S0Z7.1
#=GS W2QXA7_PHYPN/201-306        AC W2QXA7.1
#=GS E9ESD2_METRA/35-122         AC E9ESD2.1
#=GS A0A0G0Z6D4_9BACT/456-553    AC A0A0G0Z6D4.1
#=GS A0A0G0IST0_9BACT/92-180     AC A0A0G0IST0.1
#=GS A0A0L1J6D3_ASPNO/34-122     AC A0A0L1J6D3.1
#=GS G0T427_SOYBN/79-166         AC G0T427.1
#=GS E9DXE4_METAQ/34-122         AC E9DXE4.1
#=GS A0A0G0Z6D4_9BACT/675-762    AC A0A0G0Z6D4.1
#=GS A0A0L0DJ10_THETB/63-162     AC A0A0L0DJ10.1
#=GS A0A0X3S990_9ACTN/48-143     AC A0A0X3S990.1
#=GS I1I2K5_BRADI/78-204         AC I1I2K5.1
#=GS F0ZUP3_DICPU/137-242        AC F0ZUP3.1
#=GS A9V737_MONBE/109-206        AC A9V737.1
#=GS A0A0G1WG51_9BACT/37-124     AC A0A0G1WG51.1
#=GS A0A066Z754_9ACTN/105-210    AC A0A066Z754.1
#=GS A0A0D3GJ68_9ORYZ/80-171     AC A0A0D3GJ68.1
#=GS M0XR82_HORVD/9-55           AC M0XR82.1
#=GS S2JBI5_MUCC1/58-156         AC S2JBI5.1
#=GS K3YGX2_SETIT/84-205         AC K3YGX2.1
#=GS G4ZC61_PHYSP/40-134         AC G4ZC61.1
#=GS A0A078HHJ6_BRANA/141-244    AC A0A078HHJ6.1
#=GS X0BTW5_FUSOX/28-116         AC X0BTW5.1
#=GS G8UKJ6_TANFA/52-148         AC G8UKJ6.1
#=GS M5VTV2_PRUPE/65-155         AC M5VTV2.1
#=GS A0A0E0RDU7_ORYRU/55-142     AC A0A0E0RDU7.1
#=GS H0DFX4_9STAP/65-217         AC H0DFX4.1
#=GS A0A0P9AX66_DROAN/40-134     AC A0A0P9AX66.1
#=GS A0A0X3SCB0_9ACTN/58-151     AC A0A0X3SCB0.1
#=GS A0A022LVM7_9MICO/55-170     AC A0A022LVM7.1
#=GS A0A0C5XG27_NOCSI/58-155     AC A0A0C5XG27.1
#=GS F4PFX3_BATDJ/210-307        AC F4PFX3.1
#=GS A0A0G0ZVR4_9BACT/1279-1368  AC A0A0G0ZVR4.1
#=GS A0A0V1LZP8_9BILA/3-70       AC A0A0V1LZP8.1
#=GS U5G9A8_POPTR/62-153         AC U5G9A8.1
#=GS A0A013VKL7_9SPHN/43-143     AC A0A013VKL7.1
#=GS V4LEY0_EUTSA/60-131         AC V4LEY0.1
#=GS A0A136KIH7_9BACT/1916-2002  AC A0A136KIH7.1
#=GS A0A090LJA9_STRRB/56-152     AC A0A090LJA9.1
#=GS D7KQL0_ARALL/146-248        AC D7KQL0.1
#=GS D7SV33_VITVI/62-153         AC D7SV33.1
#=GS X0JSB6_FUSOX/69-173         AC X0JSB6.1
#=GS M4BU77_HYAAE/69-166         AC M4BU77.1
#=GS A0A0A2KMS1_PENIT/33-119     AC A0A0A2KMS1.1
#=GS A0A0C2AJA3_9ACTN/48-143     AC A0A0C2AJA3.1
#=GS A0A087SN35_AUXPR/77-189     AC A0A087SN35.1
#=GS L7FIU4_9ACTN/50-146         AC L7FIU4.1
#=GS M0YKM9_HORVD/54-145         AC M0YKM9.1
#=GS K6DVA5_9BACI/50-147         AC K6DVA5.1
#=GS C9KLF9_9FIRM/64-156         AC C9KLF9.1
#=GS Q8A5V0_BACTN/46-137         AC Q8A5V0.1
#=GS K3YGQ6_SETIT/176-286        AC K3YGQ6.1
#=GS A0A0Q7UQU7_9MICO/241-332    AC A0A0Q7UQU7.1
#=GS A0A078ISA4_BRANA/141-244    AC A0A078ISA4.1
#=GS A0A0B0PIH5_GOSAR/184-292    AC A0A0B0PIH5.1
#=GS A0A0E0M337_ORYPU/181-289    AC A0A0E0M337.1
#=GS A0A078FHD3_BRANA/54-145     AC A0A078FHD3.1
#=GS A0A067EEW5_CITSI/1-89       AC A0A067EEW5.1
#=GS A0A0C1G3B3_9FLAO/23-111     AC A0A0C1G3B3.1
#=GS W1PPI1_AMBTC/66-177         AC W1PPI1.1
#=GS Q19553_CAEEL/24-110         AC Q19553.1
#=GS A0A0P0XNW6_ORYSJ/111-219    AC A0A0P0XNW6.1
#=GS A0A0D0DLT5_9HOMO/48-139     AC A0A0D0DLT5.1
#=GS R7CES4_9FIRM/256-345        AC R7CES4.1
#=GS A0A094G6X4_9PEZI/37-128     AC A0A094G6X4.1
#=GS Q15XS6_PSEA6/45-158         AC Q15XS6.1
#=GS W2YK73_PHYPR/95-193         AC W2YK73.1
#=GS V4LLF9_EUTSA/53-144         AC V4LLF9.1
#=GS D3B0Y9_POLPA/395-507        AC D3B0Y9.1
#=GS D9V440_9ACTN/44-137         AC D9V440.1
#=GS A0A0D2T2L9_GOSRA/71-183     AC A0A0D2T2L9.1
#=GS B4FFA5_MAIZE/168-276        AC B4FFA5.1
#=GS A0A0G0KDK3_9BACT/46-130     AC A0A0G0KDK3.1
#=GS X6LTL4_RETFI/23-119         AC X6LTL4.1
#=GS A0A0G1GB54_9BACT/43-128     AC A0A0G1GB54.1
#=GS A0A061ELY4_THECC/68-179     AC A0A061ELY4.1
#=GS Q6C4F6_YARLI/37-127         AC Q6C4F6.1
#=GS M4D9B1_BRARP/1-89           AC M4D9B1.1
#=GS B4FR72_MAIZE/55-145         AC B4FR72.1
#=GS W2PEK5_PHYPN/58-155         AC W2PEK5.1
#=GS A0A068Y0U3_ECHMU/20-116     AC A0A068Y0U3.1
#=GS B4L6S0_DROMO/45-139         AC B4L6S0.1
#=GS A0A0Q4IQZ1_9SPHN/41-138     AC A0A0Q4IQZ1.1
#=GS A0A0E0NRJ3_ORYRU/172-280    AC A0A0E0NRJ3.1
#=GS A0A183SQL3_SCHSO/1-73       AC A0A183SQL3.1
#=GS A0A0U1M5S7_9EURO/69-173     AC A0A0U1M5S7.1
#=GS A0A0F9YNR2_9BACT/122-224    AC A0A0F9YNR2.1
#=GS A0A0J8D479_BETVU/62-152     AC A0A0J8D479.1
#=GS K9EBA4_9LACT/244-345        AC K9EBA4.1
#=GS ACP7_DANRE/31-124           AC A5D6U8.1
#=GS C0P5E1_MAIZE/63-157         AC C0P5E1.1
#=GS A0A072TZQ6_MEDTR/70-182     AC A0A072TZQ6.1
#=GS F2TXS7_SALR5/40-134         AC F2TXS7.1
#=GS A0A024UCE4_9STRA/56-150     AC A0A024UCE4.1
#=GS A0A0S8I906_9BACT/159-239    AC A0A0S8I906.1
#=GS F9FAU2_FUSOF/69-173         AC F9FAU2.1
#=GS A0A096RPJ4_MAIZE/144-249    AC A0A096RPJ4.1
#=GS B4NC52_DROWI/1-87           AC B4NC52.2
#=GS D2PXT6_KRIFD/38-139         AC D2PXT6.1
#=GS G3R6I6_GORGO/32-125         AC G3R6I6.1
#=GS A0A0E0P8T6_ORYRU/52-141     AC A0A0E0P8T6.1
#=GS A0A0B2SHG1_GLYSO/50-162     AC A0A0B2SHG1.1
#=GS E2AEF0_CAMFO/207-298        AC E2AEF0.1
#=GS I1LZT0_SOYBN/60-151         AC I1LZT0.1
#=GS A0A0F7NAF6_9ACTN/77-180     AC A0A0F7NAF6.1
#=GS U4KA86_9VIBR/25-161         AC U4KA86.1
#=GS A0A0G1PJR8_9BACT/992-1077   AC A0A0G1PJR8.1
#=GS A0A162MFU4_9BACL/43-142     AC A0A162MFU4.1
#=GS A0A0D3E307_BRAOL/60-151     AC A0A0D3E307.1
#=GS A0A0N4ZTX4_PARTI/70-166     AC A0A0N4ZTX4.2
#=GS K7MW57_SOYBN/72-183         AC K7MW57.1
#=GS G9YRX4_9FIRM/57-152         AC G9YRX4.1
#=GS K1LUL2_9BACT/26-111         AC K1LUL2.1
#=GS PPA13_ARATH/69-185          AC O48840.2
#=GS A0A0S8I906_9BACT/254-338    AC A0A0S8I906.1
#=GS A0A0D3HX63_9ORYZ/66-157     AC A0A0D3HX63.1
#=GS A0A0D3FRC8_9ORYZ/63-176     AC A0A0D3FRC8.1
#=GS A0A059DG30_EUCGR/1-75       AC A0A059DG30.1
#=GS E6U629_ETHHY/57-152         AC E6U629.1
#=GS G0T433_SOYBN/54-145         AC G0T433.1
#=GS M2LE39_BAUCO/32-121         AC M2LE39.1
#=GS G4YN62_PHYSP/202-307        AC G4YN62.1
#=GS A0A0G0C3I1_9BACT/39-110     AC A0A0G0C3I1.1
#=GS D8T2Y4_SELML/65-175         AC D8T2Y4.1
#=GS A0A0D2X4M8_CAPO3/29-120     AC A0A0D2X4M8.1
#=GS A0A0G1U4P6_9BACT/212-303    AC A0A0G1U4P6.1
#=GS K3Y6N9_SETIT/116-203        AC K3Y6N9.1
#=GS M7ZLD8_TRIUA/238-329        AC M7ZLD8.1
#=GS A0A0K8LRC2_9EURO/34-121     AC A0A0K8LRC2.1
#=GS W4FYC6_9STRA/32-126         AC W4FYC6.1
#=GS K7KSQ9_SOYBN/64-155         AC K7KSQ9.1
#=GS W5AVB1_WHEAT/134-225        AC W5AVB1.1
#=GS PPA1_ARATH/170-278          AC Q9LMX4.1
#=GS G5AM94_HETGA/28-121         AC G5AM94.1
#=GS A0A1B6Q6L4_SORBI/263-366    AC A0A1B6Q6L4.1
#=GS W4FFI7_9STRA/85-182         AC W4FFI7.1
#=GS A0A023BUL7_9FLAO/1488-1580  AC A0A023BUL7.1
#=GS A0A078J8H5_BRANA/52-149     AC A0A078J8H5.1
#=GS G4UJZ4_NEUT9/19-108         AC G4UJZ4.1
#=GS A9SPI2_PHYPA/73-185         AC A9SPI2.1
#=GS A0A0G0QVI9_9BACT/333-437    AC A0A0G0QVI9.1
#=GS V4KNZ0_EUTSA/141-244        AC V4KNZ0.1
#=GS A0A090LFJ7_STRRB/14-102     AC A0A090LFJ7.1
#=GS I9LFI1_9FIRM/40-136         AC I9LFI1.1
#=GS A0A078DRB3_BRANA/61-152     AC A0A078DRB3.1
#=GS X6LYF8_RETFI/207-314        AC X6LYF8.1
#=GS A0A0B2S0V7_GLYSO/1-80       AC A0A0B2S0V7.1
#=GS K7U2Y4_MAIZE/83-201         AC K7U2Y4.1
#=GS Q6MAY9_PARUW/66-153         AC Q6MAY9.1
#=GS B9HXJ3_POPTR/171-279        AC B9HXJ3.1
#=GS A0A086PDE1_SPHHM/44-140     AC A0A086PDE1.1
#=GS B4FLK0_MAIZE/62-153         AC B4FLK0.1
#=GS A0A0F0HZ57_9PSEU/55-148     AC A0A0F0HZ57.1
#=GS K3WAJ5_PYTUL/124-229        AC K3WAJ5.1
#=GS A0A0J8CGM6_BETVU/48-135     AC A0A0J8CGM6.1
#=GS A0A0G1P2H7_9BACT/22-115     AC A0A0G1P2H7.1
#=GS G0VPP7_MEGEL/56-148         AC G0VPP7.1
#=GS A0A067DML7_CITSI/50-162     AC A0A067DML7.1
#=GS W5FUA8_WHEAT/170-278        AC W5FUA8.1
#=GS A0A0R4ISU4_DANRE/1-80       AC A0A0R4ISU4.1
#=GS Q0IUK0_ORYSJ/56-144         AC Q0IUK0.2
#=GS W2QD59_PHYPN/107-222        AC W2QD59.1
#=GS C7ZLA6_NECH7/33-122         AC C7ZLA6.1
#=GS A0A0G1M7G3_9BACT/189-283    AC A0A0G1M7G3.1
#=GS I7KZ36_METBM/30-107         AC I7KZ36.1
#=GS A0A0E0KLJ2_ORYPU/66-179     AC A0A0E0KLJ2.1
#=GS A0A0G0T2K7_9BACT/2010-2102  AC A0A0G0T2K7.1
#=GS W5GIM1_WHEAT/1-59           AC W5GIM1.1
#=GS A0A117J3G2_9FIRM/29-126     AC A0A117J3G2.1
#=GS A0A0G1TL63_9BACT/791-882    AC A0A0G1TL63.1
#=GS Q5AR94_EMENI/75-178         AC Q5AR94.1
#=GS F4R0X8_BREDI/1-49           AC F4R0X8.1
#=GS R0H2Y3_9BRAS/142-245        AC R0H2Y3.1
#=GS A0A0D2U9F6_CAPO3/156-258    AC A0A0D2U9F6.1
#=GS D4IMW3_9BACT/30-116         AC D4IMW3.1
#=GS A0A0F8CE97_LARCR/28-121     AC A0A0F8CE97.1
#=GS A0A151TC63_CAJCA/240-331    AC A0A151TC63.1
#=GS A0A0L9TAX5_PHAAN/77-189     AC A0A0L9TAX5.1
#=GS A0A078CLR2_BRANA/47-137     AC A0A078CLR2.1
#=GS C2GEV8_9CORY/31-115         AC C2GEV8.1
#=GS C5YRS3_SORBI/85-178         AC C5YRS3.1
#=GS A0A0E0BFD6_9ORYZ/171-259    AC A0A0E0BFD6.1
#=GS A0A151TR98_CAJCA/179-288    AC A0A151TR98.1
#=GS A0A0B4HRT8_9HYPO/4-82       AC A0A0B4HRT8.1
#=GS A0A0R0DT45_9GAMM/47-142     AC A0A0R0DT45.1
#=GS A0A0G1WZ53_9BACT/6-89       AC A0A0G1WZ53.1
#=GS A0A059AEB9_EUCGR/220-322    AC A0A059AEB9.1
#=GS G4YVZ5_PHYSP/189-294        AC G4YVZ5.1
#=GS A0A0F0H5K9_NOCAE/76-186     AC A0A0F0H5K9.1
#=GS G0L8C4_ZOBGA/35-129         AC G0L8C4.1
#=GS A0A0K0FFV4_9BILA/22-115     AC A0A0K0FFV4.1
#=GS A0A136N322_9BACT/33-129     AC A0A136N322.1
#=GS A6LZS6_CLOB8/52-184         AC A6LZS6.1
#=GS D7KQJ3_ARALL/170-278        AC D7KQJ3.1
#=GS A0A0D3DSM0_BRAOL/47-134     AC A0A0D3DSM0.1
#=GS A0A151RBJ2_CAJCA/52-143     AC A0A151RBJ2.1
#=GS E1ZJI7_CHLVA/323-426        AC E1ZJI7.1
#=GS B4R7N5_DROSI/38-141         AC B4R7N5.1
#=GS A0A162XPG6_9FLAO/21-112     AC A0A162XPG6.1
#=GS Q7PUN5_ANOGA/32-123         AC Q7PUN5.5
#=GS A0A0G2AYM8_9BACT/413-505    AC A0A0G2AYM8.1
#=GS PPA20_ARATH/44-133          AC Q9LXI7.1
#=GS R5DB92_9FIRM/73-172         AC R5DB92.1
#=GS A0A162HC29_9DELT/120-204    AC A0A162HC29.1
#=GS A0A067G4K3_CITSI/169-277    AC A0A067G4K3.1
#=GS A0A0C3GGU4_9PEZI/71-175     AC A0A0C3GGU4.1
#=GS K7TEL4_MAIZE/49-136         AC K7TEL4.1
#=GS A0A067G4J9_CITSI/169-277    AC A0A067G4J9.1
#=GS A0A151U229_CAJCA/1-76       AC A0A151U229.1
#=GS A0A081PAP6_9BACL/341-452    AC A0A081PAP6.1
#=GS A0A0S2W5B4_9FIRM/57-157     AC A0A0S2W5B4.1
#=GS A0A059D6I5_EUCGR/75-174     AC A0A059D6I5.1
#=GS A0A142ELT7_9BACT/43-144     AC A0A142ELT7.1
#=GS A0A0G1X2Q2_9BACT/465-566    AC A0A0G1X2Q2.1
#=GS A0A059AW24_EUCGR/64-176     AC A0A059AW24.1
#=GS A0A0G0LCU5_9BACT/46-130     AC A0A0G0LCU5.1
#=GS A0A135LQ40_PENPA/21-107     AC A0A135LQ40.1
#=GS E2BHF9_HARSA/24-115         AC E2BHF9.1
#=GS A0A067G3U9_CITSI/169-277    AC A0A067G3U9.1
#=GS L1JKZ8_GUITH/72-177         AC L1JKZ8.1
#=GS A0A0U5JEZ4_9CHLA/27-117     AC A0A0U5JEZ4.1
#=GS A0A158R0D5_NIPBR/18-104     AC A0A158R0D5.1
#=GS D3EI91_GEOS4/1090-1189      AC D3EI91.1
#=GS F9FEU4_FUSOF/69-176         AC F9FEU4.1
#=GS E1ZL81_CHLVA/71-190         AC E1ZL81.1
#=GS A0A0K9QIW9_SPIOL/52-144     AC A0A0K9QIW9.1
#=GS F1A3B9_DICPU/38-138         AC F1A3B9.1
#=GS A0A096T6R8_MAIZE/174-282    AC A0A096T6R8.1
#=GS A0A0R0D6C7_9GAMM/48-143     AC A0A0R0D6C7.1
#=GS A0A016WRS5_9BILA/1-72       AC A0A016WRS5.1
#=GS K4BNF1_SOLLC/144-247        AC K4BNF1.1
#=GS A7HH21_ANADF/21-105         AC A7HH21.1
#=GS J9EXG6_WUCBA/1-78           AC J9EXG6.1
#=GS A0A067DW36_CITSI/1-102      AC A0A067DW36.1
#=GS A0A0D3BDY9_BRAOL/57-148     AC A0A0D3BDY9.1
#=GS A0A0R3NYJ1_DROPS/42-136     AC A0A0R3NYJ1.1
#=GS M0XR83_HORVD/69-172         AC M0XR83.1
#=GS A0A0V1R1R7_9FLAO/28-112     AC A0A0V1R1R7.1
#=GS V4LZ80_EUTSA/47-134         AC V4LZ80.1
#=GS A0A166EBS0_DAUCA/144-233    AC A0A166EBS0.1
#=GS A0A0D9V6T2_9ORYZ/129-227    AC A0A0D9V6T2.1
#=GS K3WU68_PYTUL/211-316        AC K3WU68.1
#=GS F9FIR6_FUSOF/50-138         AC F9FIR6.1
#=GS G2R6B6_THITE/71-174         AC G2R6B6.1
#=GS I2GJT4_9BACT/25-124         AC I2GJT4.1
#=GS PPA18_ARATH/47-134          AC Q9LJU7.1
#=GS A0A0N0MNC9_9ACTN/67-160     AC A0A0N0MNC9.1
#=GS M0R045_HUMAN/32-125         AC M0R045.1
#=GS A0A074VP15_9PEZI/33-119     AC A0A074VP15.1
#=GS A9V0H8_MONBE/27-124         AC A9V0H8.1
#=GS A0A078JHQ7_BRANA/43-130     AC A0A078JHQ7.1
#=GS A0A0G0Q3F7_9BACT/1675-1768  AC A0A0G0Q3F7.1
#=GS G9MJT6_HYPVG/22-112         AC G9MJT6.1
#=GS W5CCZ7_WHEAT/1-89           AC W5CCZ7.1
#=GS A0A0G1J8N6_9BACT/562-660    AC A0A0G1J8N6.1
#=GS A0A0N4WF48_HAEPC/40-134     AC A0A0N4WF48.1
#=GS A0A0X3SER1_9ACTN/56-148     AC A0A0X3SER1.1
#=GS W5H8B8_WHEAT/55-146         AC W5H8B8.1
#=GS A0A0D2TT47_GOSRA/216-324    AC A0A0D2TT47.1
#=GS W1SJF4_9BACI/40-146         AC W1SJF4.1
#=GS A0A0N4Z3J1_PARTI/70-166     AC A0A0N4Z3J1.1
#=GS W9RVL4_9ROSA/184-293        AC W9RVL4.1
#=GS A0A0F9YZC8_9BACT/80-178     AC A0A0F9YZC8.1
#=GS B8BMN6_ORYSI/168-276        AC B8BMN6.1
#=GS A0A0B4XR11_9GAMM/1135-1228  AC A0A0B4XR11.1
#=GS A0A0P0XPV5_ORYSJ/202-313    AC A0A0P0XPV5.1
#=GS A0A087GUG5_ARAAL/139-242    AC A0A087GUG5.1
#=GS Q2RJB5_MOOTA/40-136         AC Q2RJB5.1
#=GS A0A0C1YJK1_9BURK/49-146     AC A0A0C1YJK1.1
#=GS R6TEC2_9FIRM/57-155         AC R6TEC2.1
#=GS H3GKX6_PHYRM/195-301        AC H3GKX6.1
#=GS A2Z2W2_ORYSI/192-303        AC A2Z2W2.1
#=GS V5G6U6_BYSSN/33-122         AC V5G6U6.1
#=GS W9SPY4_9ROSA/175-278        AC W9SPY4.1
#=GS W5EC45_WHEAT/201-302        AC W5EC45.1
#=GS W7TJW3_9STRA/235-393        AC W7TJW3.1
#=GS A0A0G1N0N2_9BACT/41-134     AC A0A0G1N0N2.1
#=GS F0SF10_PSESL/42-120         AC F0SF10.1
#=GS R6DFU6_9BACE/222-319        AC R6DFU6.1
#=GS A0A072VJR0_MEDTR/46-133     AC A0A072VJR0.1
#=GS B5HM86_9ACTN/74-179         AC B5HM86.1
#=GS R0HIF4_9BRAS/142-245        AC R0HIF4.1
#=GS K9F863_PEND2/35-121         AC K9F863.1
#=GS M0TB85_MUSAM/56-147         AC M0TB85.1
#=GS A0A0G0Q3F7_9BACT/1075-1170  AC A0A0G0Q3F7.1
#=GS A0A0E0P3W7_ORYRU/8-89       AC A0A0E0P3W7.1
#=GS R6E592_9FIRM/54-143         AC R6E592.1
#=GS D6M4I0_STRSH/88-193         AC D6M4I0.1
#=GS I3K264_ORENI/31-124         AC I3K264.1
#=GS A0A0E0B508_9ORYZ/192-303    AC A0A0E0B508.1
#=GS PPA19_ARATH/54-134          AC Q9LX83.1
#=GS A0A101H023_9BACT/42-166     AC A0A101H023.1
#=GS A0A0Q0VIE8_9EURY/32-115     AC A0A0Q0VIE8.1
#=GS A0A067DJ00_CITSI/86-198     AC A0A067DJ00.1
#=GS A0A078DLD4_BRANA/54-143     AC A0A078DLD4.1
#=GS A0A0G0T2K7_9BACT/2210-2307  AC A0A0G0T2K7.1
#=GS Q2S7R2_HAHCH/27-112         AC Q2S7R2.1
#=GS G3T978_LOXAF/15-108         AC G3T978.1
#=GS A0A175YK32_DAUCA/69-180     AC A0A175YK32.1
#=GS A0A0Q9L8K3_9BACL/131-216    AC A0A0Q9L8K3.1
#=GS M0RTN7_MUSAM/179-287        AC M0RTN7.1
#=GS F6GSV7_VITVI/176-269        AC F6GSV7.1
#=GS A0A152A1C3_9MYCE/25-125     AC A0A152A1C3.1
#=GS V7CK97_PHAVU/149-252        AC V7CK97.1
#=GS A0A0B2QG63_GLYSO/3-51       AC A0A0B2QG63.1
#=GS A0A087GXC4_ARAAL/49-136     AC A0A087GXC4.1
#=GS W5FEJ7_WHEAT/1-76           AC W5FEJ7.1
#=GS A0A0P7A371_9FLAO/51-160     AC A0A0P7A371.1
#=GS I2EY97_EMTOG/35-116         AC I2EY97.1
#=GS A0A167J0B9_9BASI/69-172     AC A0A167J0B9.1
#=GS W5E137_WHEAT/19-127         AC W5E137.1
#=GS M0TDV4_MUSAM/60-151         AC M0TDV4.1
#=GS G9NP31_HYPAI/69-172         AC G9NP31.1
#=GS A6P1K6_9FIRM/1122-1220      AC A6P1K6.1
#=GS A0A0E0LGA3_ORYPU/143-248    AC A0A0E0LGA3.1
#=GS A0A0B2Q0A4_GLYSO/92-183     AC A0A0B2Q0A4.1
#=GS A0A0B7H0P3_9FLAO/50-145     AC A0A0B7H0P3.1
#=GS A0A136JSX0_9BACT/189-275    AC A0A136JSX0.1
#=GS M9MCX2_PSEA3/33-119         AC M9MCX2.1
#=GS M0WKF7_HORVD/24-108         AC M0WKF7.1
#=GS Q55F12_DICDI/265-365        AC Q55F12.1
#=GS D8R9Z8_SELML/197-298        AC D8R9Z8.1
#=GS A0A0B0NZ10_GOSAR/71-183     AC A0A0B0NZ10.1
#=GS A0A0L9UTK3_PHAAN/169-277    AC A0A0L9UTK3.1
#=GS A0A0G1XM28_9BACT/308-392    AC A0A0G1XM28.1
#=GS A0A151GPZ6_9HYPO/19-101     AC A0A151GPZ6.1
#=GS A0A0D2U748_GOSRA/56-147     AC A0A0D2U748.1
#=GS A0A0F8UYX3_9EURO/39-125     AC A0A0F8UYX3.1
#=GS J3LLD8_ORYBR/174-282        AC J3LLD8.1
#=GS A0A0G0Q9C9_9BACT/34-119     AC A0A0G0Q9C9.1
#=GS R5HYU8_9BACT/43-141         AC R5HYU8.1
#=GS A0A0T2L1M6_9MICO/49-146     AC A0A0T2L1M6.1
#=GS D2R593_PIRSD/54-151         AC D2R593.1
#=GS G3JI50_CORMM/34-124         AC G3JI50.1
#=GS B3PE63_CELJU/39-142         AC B3PE63.1
#=GS W1NS96_AMBTC/165-268        AC W1NS96.1
#=GS A0A0Q9QBN9_9GAMM/63-156     AC A0A0Q9QBN9.1
#=GS A0A0N1NSL9_9ACTN/76-181     AC A0A0N1NSL9.1
#=GS A0A0D2UQJ7_GOSRA/61-152     AC A0A0D2UQJ7.1
#=GS E0VLI0_PEDHC/18-111         AC E0VLI0.1
#=GS U5FYS2_POPTR/172-280        AC U5FYS2.1
#=GS A0A022QQR8_ERYGU/147-250    AC A0A022QQR8.1
#=GS J3MI39_ORYBR/1-92           AC J3MI39.1
#=GS C6W736_DYAFD/37-134         AC C6W736.1
#=GS A0A0E0RKH5_ORYRU/66-169     AC A0A0E0RKH5.1
#=GS K4A9F0_SETIT/82-169         AC K4A9F0.1
#=GS E6U966_ETHHY/1003-1104      AC E6U966.1
#=GS A0A136GVL8_9GAMM/35-135     AC A0A136GVL8.1
#=GS G9YKC2_9FIRM/1-74           AC G9YKC2.1
#=GS I1G1Y3_AMPQE/154-256        AC I1G1Y3.1
#=GS A0A0G1Y7Y8_9BACT/42-137     AC A0A0G1Y7Y8.1
#=GS L8FYA7_PSED2/29-104         AC L8FYA7.1
#=GS F2UE49_SALR5/70-162         AC F2UE49.1
#=GS A0A0D9MP06_ASPFA/68-171     AC A0A0D9MP06.1
#=GS M4FCX6_BRARP/59-150         AC M4FCX6.1
#=GS R6DMY4_9FIRM/691-807        AC R6DMY4.1
#=GS A0A067FCE4_CITSI/1-75       AC A0A067FCE4.1
#=GS S7Z876_PENO1/35-121         AC S7Z876.1
#=GS A0A0D3BDY7_BRAOL/60-151     AC A0A0D3BDY7.1
#=GS N6WMQ7_9EURY/36-120         AC N6WMQ7.1
#=GS I1NAM1_SOYBN/48-136         AC I1NAM1.1
#=GS A0A0Q9WJU0_DROVI/46-140     AC A0A0Q9WJU0.1
#=GS A0A0Q0ZFB4_9SPHI/35-153     AC A0A0Q0ZFB4.1
#=GS B9RED8_RICCO/172-280        AC B9RED8.1
#=GS A0A0S4J0B2_BODSA/162-257    AC A0A0S4J0B2.1
#=GS W9QW82_9ROSA/68-176         AC W9QW82.1
#=GS A0A072UZJ4_MEDTR/180-288    AC A0A072UZJ4.1
#=GS D0NUG6_PHYIT/1-83           AC D0NUG6.1
#=GS H3SFV3_9BACL/1076-1174      AC H3SFV3.1
#=GS E6ZZR1_SPORE/35-121         AC E6ZZR1.1
#=GS A0A0A0KGX7_CUCSA/169-277    AC A0A0A0KGX7.1
#=GS A0A0C2B9W2_9ACTN/48-143     AC A0A0C2B9W2.1
#=GS A0A0Q2UDS4_MYCGO/59-152     AC A0A0Q2UDS4.1
#=GS U5N093_CLOSA/53-184         AC U5N093.1
#=GS F5XIC4_MICPN/37-130         AC F5XIC4.1
#=GS A9T525_PHYPA/74-185         AC A9T525.1
#=GS R8VTD3_9CLOT/46-132         AC R8VTD3.1
#=GS B9RWG6_RICCO/92-204         AC B9RWG6.1
#=GS A0A0Q9XEZ5_DROMO/45-139     AC A0A0Q9XEZ5.1
#=GS A0A094I8E7_9PEZI/35-126     AC A0A094I8E7.1
#=GS D7LB06_ARALL/46-133         AC D7LB06.1
#=GS R5TSN0_9FIRM/58-150         AC R5TSN0.1
#=GS A0A0W8CEX6_PHYNI/61-158     AC A0A0W8CEX6.1
#=GS A0A0D9X687_9ORYZ/191-320    AC A0A0D9X687.1
#=GS U6PFH0_HAECO/1-72           AC U6PFH0.1
#=GS Q0D196_ASPTN/34-121         AC Q0D196.1
#=GS B9SRV4_RICCO/52-139         AC B9SRV4.1
#=GS F6HCG3_VITVI/64-155         AC F6HCG3.1
#=GS G0J158_CYCMS/31-116         AC G0J158.1
#=GS A0A0G1Q0N3_9BACT/29-131     AC A0A0G1Q0N3.1
#=GS V4LVF1_EUTSA/43-130         AC V4LVF1.1
#=GS A0A084A305_9GAMM/1295-1387  AC A0A084A305.1
#=GS A0A0N4Z850_PARTI/85-181     AC A0A0N4Z850.1
#=GS PPA22_ARATH/47-134          AC Q8S340.1
#=GS A0A0M8TGT8_9ACTN/77-182     AC A0A0M8TGT8.1
#=GS A0A0P0D591_9FLAO/33-115     AC A0A0P0D591.1
#=GS W4FCL3_9STRA/162-271        AC W4FCL3.1
#=GS H2NYR2_PONAB/32-125         AC H2NYR2.1
#=GS A0A022MBQ8_9ACTN/79-184     AC A0A022MBQ8.1
#=GS A0A059B329_EUCGR/75-187     AC A0A059B329.1
#=GS W5HKQ5_WHEAT/55-146         AC W5HKQ5.1
#=GS S8C0W9_9LAMI/51-142         AC S8C0W9.1
#=GS A0A151RJ06_CAJCA/48-135     AC A0A151RJ06.1
#=GS PPA23_ARATH/65-176          AC Q6TPH1.2
#=GS S8EHR2_9LAMI/59-171         AC S8EHR2.1
#=GS M1D309_SOLTU/64-176         AC M1D309.1
#=GS A0A074ZHQ9_9TREM/23-115     AC A0A074ZHQ9.1
#=GS M0U3A4_MUSAM/51-141         AC M0U3A4.1
#=GS E2RE14_CANLF/29-122         AC E2RE14.1
#=GS A0A136N5I3_9BACT/229-320    AC A0A136N5I3.1
#=GS A0A0R3T710_HYMNN/1-83       AC A0A0R3T710.1
#=GS R5V6E3_9FIRM/61-152         AC R5V6E3.1
#=GS A0A151TM13_CAJCA/69-172     AC A0A151TM13.1
#=GS R9A9E9_WALI9/10-112         AC R9A9E9.1
#=GS A0A176VMK3_MARPO/163-292    AC A0A176VMK3.1
#=GS I1IH79_BRADI/173-281        AC I1IH79.1
#=GS H3BDL2_LATCH/28-122         AC H3BDL2.1
#=GS M4EZR3_BRARP/53-144         AC M4EZR3.1
#=GS A0A0W8BYF2_PHYNI/61-158     AC A0A0W8BYF2.1
#=GS A0A061EK97_THECC/69-181     AC A0A061EK97.1
#=GS A0A0W8C026_PHYNI/68-166     AC A0A0W8C026.1
#=GS A0A0Q7Z771_9SPHN/25-121     AC A0A0Q7Z771.1
#=GS W4YU07_STRPU/47-140         AC W4YU07.1
#=GS Q558S4_DICDI/64-211         AC Q558S4.1
#=GS A0A0A0LBF2_CUCSA/44-137     AC A0A0A0LBF2.1
#=GS A0A067CE68_SAPPC/26-108     AC A0A067CE68.1
#=GS Q0IMD7_ORYSJ/167-275        AC Q0IMD7.1
#=GS A0A0S3FPY2_9FLAO/20-109     AC A0A0S3FPY2.1
#=GS M0ZSX2_SOLTU/145-248        AC M0ZSX2.1
#=GS A0A0E0BFE2_9ORYZ/81-168     AC A0A0E0BFE2.1
#=GS A0A0D9QV89_CHLSB/36-129     AC A0A0D9QV89.1
#=GS A0A087G927_ARAAL/65-177     AC A0A087G927.1
#=GS D7LUB5_ARALL/48-135         AC D7LUB5.1
#=GS A0A0B2PZN6_GLYSO/59-145     AC A0A0B2PZN6.1
#=GS W9SFG9_9ROSA/469-541        AC W9SFG9.1
#=GS W7YGM9_9BACL/505-616        AC W7YGM9.1
#=GS M1LNG2_9CLOT/52-184         AC M1LNG2.1
#=GS PPA24_ARATH/172-280         AC Q8H1R2.1
#=GS A0A0U2YT78_9BACL/77-172     AC A0A0U2YT78.1
#=GS A0A067CHC5_SAPPC/146-256    AC A0A067CHC5.1
#=GS A0A0G1UL21_9BACT/44-131     AC A0A0G1UL21.1
#=GS A0A162K7R7_CORDF/1-75       AC A0A162K7R7.1
#=GS R5TR15_9CLOT/229-323        AC R5TR15.1
#=GS M0SR51_MUSAM/60-151         AC M0SR51.1
#=GS V7D128_PHAVU/94-181         AC V7D128.1
#=GS A0A0M8NXN6_9EURO/33-119     AC A0A0M8NXN6.1
#=GS D5XE18_THEPJ/323-410        AC D5XE18.1
#=GS B8M199_TALSN/71-175         AC B8M199.1
#=GS A0A087GS48_ARAAL/55-146     AC A0A087GS48.1
#=GS R5FVZ9_9FIRM/889-1006       AC R5FVZ9.1
#=GS A0A0L0LAW7_9BACT/59-143     AC A0A0L0LAW7.1
#=GS A0A176KZE7_9ACTN/79-184     AC A0A176KZE7.1
#=GS A0A101JTV9_9ACTN/39-135     AC A0A101JTV9.1
#=GS J7LI96_NOCAA/41-129         AC J7LI96.1
#=GS A0A0D3DL36_BRAOL/58-149     AC A0A0D3DL36.1
#=GS W2XYA7_PHYPR/1-82           AC W2XYA7.1
#=GS A0A085WI26_9DELT/49-127     AC A0A085WI26.1
#=GS A0A0L8QUY1_9ACTN/88-193     AC A0A0L8QUY1.1
#=GS R6T9X5_9STAP/248-348        AC R6T9X5.1
#=GS W6U250_9SPHI/53-152         AC W6U250.1
#=GS D0P2U5_PHYIT/68-166         AC D0P2U5.1
#=GS F2CQQ2_HORVD/59-150         AC F2CQQ2.1
#=GS A0A072V0S0_MEDTR/190-295    AC A0A072V0S0.1
#=GS A2XT61_ORYSI/52-141         AC A2XT61.1
#=GS G7L619_MEDTR/47-133         AC G7L619.2
#=GS D8RM71_SELML/77-168         AC D8RM71.1
#=GS A0A136LXW8_9BACT/44-137     AC A0A136LXW8.1
#=GS A0A0K9QM98_SPIOL/35-122     AC A0A0K9QM98.1
#=GS A0A142XIX6_9PLAN/53-148     AC A0A142XIX6.1
#=GS A0A0C3HPX8_9PEZI/16-102     AC A0A0C3HPX8.1
#=GS W2R392_PHYPN/20-120         AC W2R392.1
#=GS W6NBU1_HAECO/20-106         AC W6NBU1.1
#=GS A0A0G0LHK6_9BACT/97-181     AC A0A0G0LHK6.1
#=GS A9V290_MONBE/158-252        AC A9V290.1
#=GS I0YPZ7_COCSC/69-190         AC I0YPZ7.1
#=GS A0A1B6QE87_SORBI/223-331    AC A0A1B6QE87.1
#=GS A0A0S8KTH6_9BACT/64-145     AC A0A0S8KTH6.1
#=GS W7TUY9_9STRA/38-132         AC W7TUY9.1
#=GS A0A0D9XP49_9ORYZ/191-280    AC A0A0D9XP49.1
#=GS A0A067DUY1_CITSI/86-198     AC A0A067DUY1.1
#=GS G0T428_SOYBN/52-144         AC G0T428.1
#=GS A0A136KRQ3_9BACT/25-117     AC A0A136KRQ3.1
#=GS K3Z4N2_SETIT/170-278        AC K3Z4N2.1
#=GS A0A0B2NYX3_GLYSO/38-126     AC A0A0B2NYX3.1
#=GS G0MR96_CAEBE/22-117         AC G0MR96.1
#=GS N9WEZ7_9SPHN/51-147         AC N9WEZ7.1
#=GS M1CGZ9_SOLTU/1-93           AC M1CGZ9.1
#=GS A0A166ICU1_DAUCA/2-79       AC A0A166ICU1.1
#=GS T0NU96_CAMFR/32-125         AC T0NU96.1
#=GS A0A0S7DST7_9EURO/50-138     AC A0A0S7DST7.1
#=GS G7JFF6_MEDTR/55-146         AC G7JFF6.1
#=GS K4BVH1_SOLLC/60-151         AC K4BVH1.1
#=GS U5C492_9BACT/32-128         AC U5C492.1
#=GS S0EED1_GIBF5/74-176         AC S0EED1.1
#=GS I5C765_9BACT/22-127         AC I5C765.1
#=GS G7PXI5_MACFA/32-125         AC G7PXI5.1
#=GS A0A0M8N1P0_9HYPO/1-78       AC A0A0M8N1P0.1
#=GS A0A0S7E1Z5_9EURO/69-173     AC A0A0S7E1Z5.1
#=GS A0A060R9K5_9BACT/32-131     AC A0A060R9K5.1
#=GS I1C3N2_RHIO9/1-97           AC I1C3N2.1
#=GS R0GVM9_9BRAS/145-248        AC R0GVM9.1
#=GS R7D516_9FIRM/55-149         AC R7D516.1
#=GS R5G4L7_9FIRM/1086-1183      AC R5G4L7.1
#=GS I1HS75_BRADI/60-151         AC I1HS75.1
#=GS W5FUP6_WHEAT/122-231        AC W5FUP6.1
#=GS A0A0B0NGU4_GOSAR/141-245    AC A0A0B0NGU4.1
#=GS A0A0G1V523_9BACT/44-136     AC A0A0G1V523.1
#=GS A0A151T1M0_CAJCA/1-76       AC A0A151T1M0.1
#=GS B0S2T7_FINM2/49-170         AC B0S2T7.1
#=GS Q7S852_NEUCR/37-123         AC Q7S852.1
#=GS F4Q2Y4_DICFS/63-155         AC F4Q2Y4.1
#=GS W5C231_WHEAT/47-96          AC W5C231.1
#=GS PPA26_ARATH/54-145          AC Q949Y3.1
#=GS H2JLW5_STRHJ/74-179         AC H2JLW5.1
#=GS A0A0J8EUF0_BETVU/44-131     AC A0A0J8EUF0.1
#=GS Q5GZX0_XANOR/14-120         AC Q5GZX0.1
#=GS K3X7B1_PYTUL/198-303        AC K3X7B1.1
#=GS V7B9L1_PHAVU/49-138         AC V7B9L1.1
#=GS R6XEN0_9FIRM/36-138         AC R6XEN0.1
#=GS A0A0E0JPV1_ORYPU/206-309    AC A0A0E0JPV1.1
#=GS A0A0G0IA75_9BACT/1145-1245  AC A0A0G0IA75.1
#=GS Q2QXM4_ORYSJ/55-142         AC Q2QXM4.2
#=GS A0A166AIB9_DAUCA/52-141     AC A0A166AIB9.1
#=GS Q0RB83_FRAAA/29-123         AC Q0RB83.1
#=GS A0A067DMM2_CITSI/86-198     AC A0A067DMM2.1
#=GS D4IWR1_BUTFI/1120-1216      AC D4IWR1.1
#=GS D1PWN8_9BACT/159-243        AC D1PWN8.1
#=GS A0A0G0IC78_9BACT/830-945    AC A0A0G0IC78.1
#=GS A0A067RQT9_ZOONE/26-117     AC A0A067RQT9.1
#=GS V5FXX8_BYSSN/72-175         AC V5FXX8.1
#=GS J3MG77_ORYBR/55-146         AC J3MG77.1
#=GS A0A067F5L0_CITSI/43-130     AC A0A067F5L0.1
#=GS D3BNV5_POLPA/26-122         AC D3BNV5.1
#=GS V4VFD2_9ROSI/169-277        AC V4VFD2.1
#=GS A0A061FDT9_THECC/58-149     AC A0A061FDT9.1
#=GS K3XFF1_SETIT/213-316        AC K3XFF1.1
#=GS A0A0B2QW33_GLYSO/56-150     AC A0A0B2QW33.1
#=GS A1C5K8_ASPCL/69-173         AC A1C5K8.1
#=GS R5NYR9_9BACT/165-252        AC R5NYR9.1
#=GS A0A0Q6Y074_9MICO/61-157     AC A0A0Q6Y074.1
#=GS A0A0G0EPY6_9BACT/1412-1509  AC A0A0G0EPY6.1
#=GS K1VCE8_TRIAC/65-157         AC K1VCE8.1
#=GS A0A0N5BA91_STREA/28-125     AC A0A0N5BA91.1
#=GS A0A0N9UTU7_SPHMC/57-153     AC A0A0N9UTU7.1
#=GS A0A0J8C572_BETVU/169-277    AC A0A0J8C572.1
#=GS K7KSQ8_SOYBN/64-155         AC K7KSQ8.1
#=GS G1T0Z9_RABIT/35-128         AC G1T0Z9.1
#=GS M4CRV6_BRARP/43-132         AC M4CRV6.1
#=GS A0A168C0A1_CORDF/71-172     AC A0A168C0A1.1
#=GS A0A0L0C031_LUCCU/782-876    AC A0A0L0C031.1
#=GS R6VHZ9_9BACT/30-128         AC R6VHZ9.1
#=GS C8W6U0_DESAS/47-139         AC C8W6U0.1
#=GS A0A0B2RDB8_GLYSO/54-145     AC A0A0B2RDB8.1
#=GS Q4KU02_MEDTR/55-146         AC Q4KU02.1
#=GS A0A0N4ZK86_PARTI/25-119     AC A0A0N4ZK86.1
#=GS W4PPN0_9BACE/30-121         AC W4PPN0.1
#=GS S7X4I5_9FLAO/811-890        AC S7X4I5.1
#=GS I9SDG9_9BACE/30-122         AC I9SDG9.1
#=GS A0A117LTL7_9BACT/42-131     AC A0A117LTL7.1
#=GS M5VVK4_PRUPE/161-273        AC M5VVK4.1
#=GS A0A0D9ZFS9_9ORYZ/63-176     AC A0A0D9ZFS9.1
#=GS A0A0B2NWG3_GLYSO/79-166     AC A0A0B2NWG3.1
#=GS F6HKK0_VITVI/48-134         AC F6HKK0.1
#=GS A0A0B0NI29_GOSAR/57-144     AC A0A0B0NI29.1
#=GS W2YQB1_PHYPR/1-82           AC W2YQB1.1
#=GS A0A0L9TDY1_PHAAN/1-76       AC A0A0L9TDY1.1
#=GS A3HZ41_9BACT/32-128         AC A3HZ41.1
#=GS I0GRV6_SELRL/39-128         AC I0GRV6.1
#=GS A0A0K9Q156_ZOSMR/4-99       AC A0A0K9Q156.1
#=GS L8GGG9_ACACA/27-120         AC L8GGG9.1
#=GS V4TY65_9ROSI/43-130         AC V4TY65.1
#=GS A0A0W7VSG8_9HYPO/22-112     AC A0A0W7VSG8.1
#=GS A0A0D9YFQ5_9ORYZ/57-148     AC A0A0D9YFQ5.1
#=GS A0A0G0MX77_9BACT/329-417    AC A0A0G0MX77.1
#=GS A0A089ICS5_9BACL/241-351    AC A0A089ICS5.1
#=GS B9I3R0_POPTR/186-294        AC B9I3R0.2
#=GS A0A078FJI0_BRANA/49-136     AC A0A078FJI0.1
#=GS K7MRU1_SOYBN/173-281        AC K7MRU1.1
#=GS A0A093XQ33_9PEZI/70-174     AC A0A093XQ33.1
#=GS G4ZMQ7_PHYSP/50-165         AC G4ZMQ7.1
#=GS B8B930_ORYSI/177-288        AC B8B930.1
#=GS G7MAH7_9CLOT/52-184         AC G7MAH7.1
#=GS B1B9M3_CLOBO/53-137         AC B1B9M3.1
#=GS A0A0L0DAM6_THETB/132-227    AC A0A0L0DAM6.1
#=GS A0A0E0M6L2_ORYPU/151-257    AC A0A0E0M6L2.1
#=GS G0VMY2_MEGEL/28-123         AC G0VMY2.1
#=GS W9RCP7_9ROSA/148-251        AC W9RCP7.1
#=GS Q5L7X1_BACFN/259-353        AC Q5L7X1.1
#=GS B9DKH5_STACT/75-227         AC B9DKH5.1
#=GS T0SAU2_9STRA/162-272        AC T0SAU2.1
#=GS C5X792_SORBI/144-249        AC C5X792.1
#=GS A0A152A6R2_9MYCE/1-118      AC A0A152A6R2.1
#=GS A0A0Q5T497_9BACT/228-324    AC A0A0Q5T497.1
#=GS A0A067KYN6_JATCU/169-277    AC A0A067KYN6.1
#=GS A0A0C3H7G2_9PEZI/1-88       AC A0A0C3H7G2.1
#=GS A0A016S2Q0_9BILA/40-134     AC A0A016S2Q0.1
#=GS A0A0D2QTF8_GOSRA/69-181     AC A0A0D2QTF8.1
#=GS C5YHP9_SORBI/177-295        AC C5YHP9.1
#=GS W5DSL3_WHEAT/172-285        AC W5DSL3.1
#=GS I1I2K6_BRADI/78-204         AC I1I2K6.1
#=GS B5DL04_DROPS/42-135         AC B5DL04.2
#=GS A0A0W8C0A6_PHYNI/95-193     AC A0A0W8C0A6.1
#=GS A0A0J8C921_BETVU/53-145     AC A0A0J8C921.1
#=GS A0A101NH64_9ACTN/73-178     AC A0A101NH64.1
#=GS K7UD79_MAIZE/30-117         AC K7UD79.1
#=GS V7AEV3_PHAVU/1-77           AC V7AEV3.1
#=GS A0A094F5E5_9PEZI/35-126     AC A0A094F5E5.1
#=GS A0A078HHZ8_BRANA/169-278    AC A0A078HHZ8.1
#=GS A0A0D2PZ78_GOSRA/70-161     AC A0A0D2PZ78.1
#=GS A0A0G4IMQ6_PLABS/125-232    AC A0A0G4IMQ6.1
#=GS M5WPE3_PRUPE/44-131         AC M5WPE3.1
#=GS A0A0D9XP52_9ORYZ/56-143     AC A0A0D9XP52.1
#=GS A0A078GJQ4_BRANA/60-151     AC A0A078GJQ4.1
#=GS G2IPZ7_9SPHN/44-140         AC G2IPZ7.1
#=GS A0A016V9N2_9BILA/21-106     AC A0A016V9N2.1
#=GS M5G7A8_DACPD/34-125         AC M5G7A8.1
#=GS A0A0W8C2W9_PHYNI/198-304    AC A0A0W8C2W9.1
#=GS A0A0K0E1G1_STRER/14-102     AC A0A0K0E1G1.1
#=GS A0A093YXR7_9PEZI/36-127     AC A0A093YXR7.1
#=GS W5FT55_WHEAT/1-95           AC W5FT55.1
#=GS A6EKR3_9SPHI/41-139         AC A6EKR3.1
#=GS C0XQQ7_9CORY/51-139         AC C0XQQ7.1
#=GS V7AD31_PHAVU/54-145         AC V7AD31.1
#=GS A0A0M8WEB1_9ACTN/77-182     AC A0A0M8WEB1.1
#=GS J3MUP7_ORYBR/128-244        AC J3MUP7.1
#=GS A0A0B2SPL3_GLYSO/72-174     AC A0A0B2SPL3.1
#=GS A0A059D7S0_EUCGR/142-244    AC A0A059D7S0.1
#=GS S8AR30_PENO1/67-171         AC S8AR30.1
#=GS C5YRR5_SORBI/67-157         AC C5YRR5.1
#=GS A0A0G1J6I5_9BACT/79-172     AC A0A0G1J6I5.1
#=GS W7Z8J0_9BACL/393-503        AC W7Z8J0.1
#=GS A0A0R3XBX0_HYDTA/20-96      AC A0A0R3XBX0.1
#=GS B9R821_RICCO/60-151         AC B9R821.1
#=GS U7Q4W9_SPOS1/34-119         AC U7Q4W9.1
#=GS A0A0M3J0X8_ANISI/1-87       AC A0A0M3J0X8.1
#=GS A0A024FT75_9STRA/1069-1175  AC A0A024FT75.1
#=GS A0A0G0RF02_9BACT/1175-1260  AC A0A0G0RF02.1
#=GS A0A0B2SRS7_GLYSO/168-276    AC A0A0B2SRS7.1
#=GS R6NIJ9_9CLOT/42-126         AC R6NIJ9.1
#=GS C5YWL2_SORBI/62-156         AC C5YWL2.1
#=GS A0A0K8JH14_9FIRM/23-115     AC A0A0K8JH14.1
#=GS A0A022RBX4_ERYGU/58-149     AC A0A022RBX4.1
#=GS A0A151SQL0_CAJCA/64-175     AC A0A151SQL0.1
#=GS A0A162L636_9PEZI/39-128     AC A0A162L636.1
#=GS A0A142LFV1_9RHOB/30-143     AC A0A142LFV1.1
#=GS H9GI46_ANOCA/29-117         AC H9GI46.1
#=GS A0A0L0C031_LUCCU/403-493    AC A0A0L0C031.1
#=GS M5W8W6_PRUPE/49-136         AC M5W8W6.1
#=GS L8H0Q3_ACACA/147-249        AC L8H0Q3.1
#=GS R5W6W1_9BACE/45-137         AC R5W6W1.1
#=GS A0A0G0DVI7_9BACT/19-105     AC A0A0G0DVI7.1
#=GS A0A0D9XWY5_9ORYZ/54-149     AC A0A0D9XWY5.1
#=GS A0A167JUQ1_9HYPO/73-174     AC A0A167JUQ1.1
#=GS A0A0G0IC78_9BACT/273-374    AC A0A0G0IC78.1
#=GS A0A0K1Q8B7_9DELT/12-82      AC A0A0K1Q8B7.1
#=GS I1G3V7_AMPQE/30-121         AC I1G3V7.1
#=GS A0A094BTB4_9PEZI/583-673    AC A0A094BTB4.1
#=GS A0A0D2QJD5_GOSRA/61-152     AC A0A0D2QJD5.1
#=GS N1PDD9_DOTSN/35-121         AC N1PDD9.1
#=GS A0A0A3IDC1_9BACI/37-135     AC A0A0A3IDC1.1
#=GS A7T4Y9_NEMVE/2-95           AC A7T4Y9.1
#=GS A0A0D9ZFS7_9ORYZ/63-176     AC A0A0D9ZFS7.1
#=GS A1D0I1_NEOFI/69-173         AC A1D0I1.1
#=GS A0A0B0PGL6_GOSAR/525-616    AC A0A0B0PGL6.1
#=GS A0A094BW79_9PEZI/70-174     AC A0A094BW79.1
#=GS E6NU63_JATCU/62-153         AC E6NU63.1
#=GS W7LTK1_GIBM7/28-116         AC W7LTK1.1
#=GS A6DND5_9BACT/19-111         AC A6DND5.1
#=GS V7CA52_PHAVU/60-151         AC V7CA52.1
#=GS B8BJ49_ORYSI/141-230        AC B8BJ49.1
#=GS A0A0B8NWN3_9VIBR/540-628    AC A0A0B8NWN3.1
#=GS A0A0W0GK24_9CHLR/38-130     AC A0A0W0GK24.1
#=GS A0A0F2TCC9_9ACTN/62-155     AC A0A0F2TCC9.1
#=GS A0A0F7CN91_9ACTN/50-152     AC A0A0F7CN91.1
#=GS A0A0J8FIF3_BETVU/70-181     AC A0A0J8FIF3.1
#=GS J5JZ65_BEAB2/73-174         AC J5JZ65.1
#=GS A0A0M2LUP4_9MICO/244-335    AC A0A0M2LUP4.1
#=GS A0A0D9YG69_9ORYZ/206-309    AC A0A0D9YG69.1
#=GS A0A171KRI0_9BURK/1111-1205  AC A0A171KRI0.1
#=GS D3BTA9_POLPA/135-238        AC D3BTA9.1
#=GS B9IJI1_POPTR/69-181         AC B9IJI1.1
#=GS D7M101_ARALL/60-151         AC D7M101.1
#=GS A0A0D3FRC7_9ORYZ/8-89       AC A0A0D3FRC7.1
#=GS A0A087SNF3_AUXPR/77-178     AC A0A087SNF3.1
#=GS W5EEV4_WHEAT/174-282        AC W5EEV4.1
#=GS A0A0E0MNX5_ORYPU/881-989    AC A0A0E0MNX5.1
#=GS F0Z8P6_DICPU/176-291        AC F0Z8P6.1
#=GS W5G4V8_WHEAT/167-275        AC W5G4V8.1
#=GS M4ECP0_BRARP/139-242        AC M4ECP0.1
#=GS A0A0N1NDA0_9ACTN/80-185     AC A0A0N1NDA0.1
#=GS A0A136MS17_9BACT/37-116     AC A0A136MS17.1
#=GS A0A0C5XKW4_NOCSI/40-135     AC A0A0C5XKW4.1
#=GS I1R876_ORYGL/57-151         AC I1R876.1
#=GS B9SAE7_RICCO/42-137         AC B9SAE7.1
#=GS C6T9R4_SOYBN/70-159         AC C6T9R4.1
#=GS R6PYW3_9CLOT/47-142         AC R6PYW3.1
#=GS A9FKC4_SORC5/30-113         AC A9FKC4.1
#=GS A0A0K9RDF3_SPIOL/62-153     AC A0A0K9RDF3.1
#=GS K0CG74_ALCDB/71-171         AC K0CG74.1
#=GS A0A0C3HKY7_9PEZI/35-124     AC A0A0C3HKY7.1
#=GS W2ZJ12_PHYPR/189-294        AC W2ZJ12.1
#=GS A0A0D3DXH6_BRAOL/173-280    AC A0A0D3DXH6.1
#=GS A0A151SRK1_CAJCA/171-279    AC A0A151SRK1.1
#=GS A0A167W6U0_9PEZI/132-218    AC A0A167W6U0.1
#=GS A0A087STP1_AUXPR/149-254    AC A0A087STP1.1
#=GS Q0RN12_FRAAA/34-128         AC Q0RN12.1
#=GS A0A0M0J690_9EUKA/21-116     AC A0A0M0J690.1
#=GS W0F1M2_9BACT/49-131         AC W0F1M2.1
#=GS A0A0G0Q3F7_9BACT/1975-2071  AC A0A0G0Q3F7.1
#=GS A0A094J6Z3_9PEZI/555-641    AC A0A094J6Z3.1
#=GS A0A0G1B2L0_9BACT/471-572    AC A0A0G1B2L0.1
#=GS G0IXD9_CYCMS/1-82           AC G0IXD9.1
#=GS S0G254_9DELT/38-135         AC S0G254.1
#=GS A0A0D2UU09_GOSRA/108-219    AC A0A0D2UU09.1
#=GS M3BLY4_STRMB/64-169         AC M3BLY4.1
#=GS G2RGK6_THITE/27-117         AC G2RGK6.1
#=GS K7KG05_SOYBN/49-137         AC K7KG05.1
#=GS A0A0C2LUG1_9CYAN/20-104     AC A0A0C2LUG1.1
#=GS W5J5R2_ANODA/34-125         AC W5J5R2.1
#=GS R6SY00_9BACE/27-115         AC R6SY00.1
#=GS A0A0L1IW73_ASPNO/133-220    AC A0A0L1IW73.1
#=GS B8BMN5_ORYSI/160-268        AC B8BMN5.1
#=GS A0A078D6J2_BRANA/70-181     AC A0A078D6J2.1
#=GS G3NRK8_GASAC/27-120         AC G3NRK8.1
#=GS A0A0G0IBQ4_9BACT/1261-1351  AC A0A0G0IBQ4.1
#=GS A9S778_PHYPA/147-250        AC A9S778.1
#=GS R5HVM2_9FIRM/55-151         AC R5HVM2.1
#=GS I3IRG3_9BACT/30-116         AC I3IRG3.1
#=GS A0A0A1TS26_9HYPO/30-120     AC A0A0A1TS26.1
#=GS L1L035_9ACTN/80-185         AC L1L035.1
#=GS A0A168QBF4_9BACL/340-447    AC A0A168QBF4.1
#=GS M7ZN35_TRIUA/7-89           AC M7ZN35.1
#=GS W4UYD8_9BACE/46-137         AC W4UYD8.1
#=GS A0A0Q0ZDH1_9SPHI/46-144     AC A0A0Q0ZDH1.1
#=GS R6NKZ8_9CLOT/42-131         AC R6NKZ8.1
#=GS A0A150UZT7_9PEZI/74-176     AC A0A150UZT7.1
#=GS A0A063BZM0_9HYPO/30-117     AC A0A063BZM0.1
#=GS A0A078I3K3_BRANA/77-188     AC A0A078I3K3.1
#=GS A5GAH4_GEOUR/35-130         AC A5GAH4.1
#=GS A0A078EM74_BRANA/57-148     AC A0A078EM74.1
#=GS A0A0K8JGT4_9FIRM/59-156     AC A0A0K8JGT4.1
#=GS A0A117I4Y7_9MYCO/55-148     AC A0A117I4Y7.1
#=GS A0A074Z6I9_9TREM/37-129     AC A0A074Z6I9.1
#=GS Q2QN73_ORYSJ/166-274        AC Q2QN73.1
#=GS A0A0G3HIE4_9CORY/84-162     AC A0A0G3HIE4.1
#=GS A0A142YKZ8_9PLAN/237-347    AC A0A142YKZ8.1
#=GS A0A0N5A1P6_PARTI/14-102     AC A0A0N5A1P6.1
#=GS Q8P863_XANCP/50-145         AC Q8P863.1
#=GS A0A0N4ZK86_PARTI/547-642    AC A0A0N4ZK86.1
#=GS I1Q416_ORYGL/54-145         AC I1Q416.1
#=GS A0A078ENH6_BRANA/17-108     AC A0A078ENH6.1
#=GS Q16FY3_AEDAE/997-1090       AC Q16FY3.1
#=GS A0A0E0BVP6_9ORYZ/58-149     AC A0A0E0BVP6.1
#=GS A0A0J8BJZ6_BETVU/65-156     AC A0A0J8BJZ6.1
#=GS M7ZG61_TRIUA/228-336        AC M7ZG61.1
#=GS A0A074VTA2_9PEZI/71-174     AC A0A074VTA2.1
#=GS C7PWR5_CATAD/71-164         AC C7PWR5.1
#=GS R5QC02_9FIRM/45-140         AC R5QC02.1
#=GS A0A072TFW4_MEDTR/61-152     AC A0A072TFW4.1
#=GS I1FBY6_AMPQE/159-260        AC I1FBY6.1
#=GS D1CIU3_THET1/239-328        AC D1CIU3.1
#=GS A0A061EHE8_THECC/172-281    AC A0A061EHE8.1
#=GS R7EVD7_9FIRM/700-815        AC R7EVD7.1
#=GS A0A0K9PIF5_ZOSMR/114-217    AC A0A0K9PIF5.1
#=GS A0A067P4C9_9HOMO/36-123     AC A0A067P4C9.1
#=GS A0A0D2R8H7_GOSRA/73-185     AC A0A0D2R8H7.1
#=GS A0A0B2VIU9_TOXCA/42-133     AC A0A0B2VIU9.1
#=GS A0A158Q835_9BILA/50-141     AC A0A158Q835.1
#=GS A0A0Q9U649_9BACL/37-125     AC A0A0Q9U649.1
#=GS A0A183FZW8_HELBK/440-525    AC A0A183FZW8.1
#=GS F4L3L8_HALH1/34-129         AC F4L3L8.1
#=GS B4FRV6_MAIZE/66-154         AC B4FRV6.1
#=GS B9T7B6_RICCO/49-142         AC B9T7B6.1
#=GS A0A183FZW8_HELBK/34-140     AC A0A183FZW8.1
#=GS W2YJH6_PHYPR/90-188         AC W2YJH6.1
#=GS A0A061FJT8_THECC/252-355    AC A0A061FJT8.1
#=GS A0A0G1STQ6_9BACT/41-134     AC A0A0G1STQ6.1
#=GS A0A068RF20_9FUNG/33-133     AC A0A068RF20.1
#=GS A7SDQ0_NEMVE/1-80           AC A7SDQ0.1
#=GS A0A101NKU7_9ACTN/74-179     AC A0A101NKU7.1
#=GS A0A033UKA5_STAAU/70-222     AC A0A033UKA5.1
#=GS A0A0A1UUZ8_9HYPO/26-116     AC A0A0A1UUZ8.1
#=GS S3ZPA5_9ACTN/85-190         AC S3ZPA5.1
#=GS H2FLJ4_CAEEL/47-140         AC H2FLJ4.1
#=GS A0A0E0QGQ8_ORYRU/77-203     AC A0A0E0QGQ8.1
#=GS V9EDA1_PHYPR/100-198        AC V9EDA1.1
#=GS A0A0G0RHU6_9BACT/133-232    AC A0A0G0RHU6.1
#=GS A0A0K9QTC1_SPIOL/151-260    AC A0A0K9QTC1.1
#=GS A0A0E0N379_ORYRU/57-148     AC A0A0E0N379.1
#=GS A0A0R4IZ62_DANRE/31-124     AC A0A0R4IZ62.1
#=GS R6JE32_9CLOT/55-151         AC R6JE32.1
#=GS A0A0G1GQU9_9BACT/188-276    AC A0A0G1GQU9.1
#=GS J3LXL2_ORYBR/50-137         AC J3LXL2.1
#=GS Q2UII9_ASPOR/34-123         AC Q2UII9.1
#=GS Q8S2H5_ORYSJ/206-309        AC Q8S2H5.1
#=GS H1BIF9_9FIRM/1070-1176      AC H1BIF9.1
#=GS A0A0D2TZM9_GOSRA/118-205    AC A0A0D2TZM9.1
#=GS F7VZS1_SORMK/35-124         AC F7VZS1.1
#=GS A0A0P4UDB9_ROSNE/37-126     AC A0A0P4UDB9.1
#=GS M5XYD6_PRUPE/50-161         AC M5XYD6.1
#=GS A0A0D3H2H3_9ORYZ/244-355    AC A0A0D3H2H3.1
#=GS A0A067EP55_CITSI/1-95       AC A0A067EP55.1
#=GS I0HFE0_ACTM4/42-137         AC I0HFE0.1
#=GS A0A096US54_WHEAT/235-343    AC A0A096US54.1
#=GS A0A0D2PM84_GOSRA/1-81       AC A0A0D2PM84.1
#=GS A0A0C9U5R2_PAXIN/1-79       AC A0A0C9U5R2.1
#=GS A0A067K7B9_JATCU/177-285    AC A0A067K7B9.1
#=GS I1IH78_BRADI/176-284        AC I1IH78.1
#=GS A0A151Z8J6_9MYCE/213-315    AC A0A151Z8J6.1
#=GS A0A0M9E5Y5_9DELT/25-115     AC A0A0M9E5Y5.1
#=GS F2U2E4_SALR5/74-176         AC F2U2E4.1
#=GS A1CGH8_ASPCL/32-118         AC A1CGH8.1
#=GS A0A150XF56_9BACT/30-114     AC A0A150XF56.1
#=GS A0A0C9YWB9_9HOMO/50-141     AC A0A0C9YWB9.1
#=GS W1PBU4_AMBTC/213-315        AC W1PBU4.1
#=GS A7SZW4_NEMVE/173-273        AC A7SZW4.1
#=GS E2ZE76_9FIRM/68-159         AC E2ZE76.1
#=GS A0A0G1TL63_9BACT/565-652    AC A0A0G1TL63.1
#=GS A0A024TDL7_9STRA/129-242    AC A0A024TDL7.1
#=GS R5Q656_9BURK/56-200         AC R5Q656.1
#=GS V9GGX9_9BACL/14-111         AC V9GGX9.1
#=GS A0A0D3A632_BRAOL/173-281    AC A0A0D3A632.1
#=GS V7ADX8_PHAVU/127-230        AC V7ADX8.1
#=GS A0A0G0CKN9_9BACT/3301-3393  AC A0A0G0CKN9.1
#=GS A0A151Z7Z6_9MYCE/136-240    AC A0A151Z7Z6.1
#=GS G5H7L9_9BACT/30-137         AC G5H7L9.1
#=GS A0A0C1W668_9ACTN/53-146     AC A0A0C1W668.1
#=GS S8CPA3_9LAMI/170-273        AC S8CPA3.1
#=GS A0A0B0P9A4_GOSAR/58-149     AC A0A0B0P9A4.1
#=GS J3L4M2_ORYBR/59-150         AC J3L4M2.1
#=GS A0A0E0QTG4_ORYRU/205-316    AC A0A0E0QTG4.1
#=GS I1QH65_ORYGL/78-204         AC I1QH65.1
#=GS C9Z464_STRSW/85-190         AC C9Z464.1
#=GS A0A0A2DXQ0_9PORP/67-162     AC A0A0A2DXQ0.1
#=GS D7LQH9_ARALL/142-245        AC D7LQH9.1
#=GS A0A067D0N8_SAPPC/27-121     AC A0A067D0N8.1
#=GS F9Z4Z5_ODOSD/226-308        AC F9Z4Z5.1
#=GS A0A022QD15_ERYGU/118-211    AC A0A022QD15.1
#=GS M0ZS21_SOLTU/47-135         AC M0ZS21.1
#=GS R4K5T7_CLOPA/350-474        AC R4K5T7.1
#=GS G0J1L0_CYCMS/41-142         AC G0J1L0.1
#=GS G2GE39_9ACTN/54-173         AC G2GE39.1
#=GS A1ZX61_9BACT/24-119         AC A1ZX61.1
#=GS A0A0L9U961_PHAAN/1-86       AC A0A0L9U961.1
#=GS A0A074YPN2_9PEZI/33-119     AC A0A074YPN2.1
#=GS X5KTF5_9MYCO/53-146         AC X5KTF5.1
#=GS A0A0G0LMW0_9BACT/746-830    AC A0A0G0LMW0.1
#=GS F4A079_MAHA5/50-159         AC F4A079.1
#=GS K3WC61_PYTUL/193-298        AC K3WC61.1
#=GS A0A166GFF2_DAUCA/798-889    AC A0A166GFF2.1
#=GS X2JB52_DROME/38-142         AC X2JB52.1
A0A0E0NXB3_ORYRU/68-155                ....................................................PQQVHISL.....AG.-...-....EK..................HM..RVTFV..T...D...............................D..................N.........S..VPS.......................VVDYG.TE.....A.GT.....................................Y..T.ST........S.Q..G.E......ST....S.YSY.........................................................................LMYS.S..GKIH.HVVIG....P.......L..NDNT.VYY.......Y..RC...............GGH...G-.................................---.PE..FQFKT...........................................
W9RDX2_9ROSA/140-231                   ....................................................PQQVHITQ.....AD.Y...D....GR..................AV..IISWV..T...P...............................D..................A.........P..GSN.......................KVQYG.TA.....E.KR.....................................Y..E.FT........A.E..G.T......VS....N.YTF.........................................................................YQYK.S..GYIH.HCLVD....G.......L..EYDT.KYY.......Y..KL...............GSG...D-.................................-SA.RE..FWFET...........................................
R6RV41_9FIRM/92-190                    ...................................................y-EQVALTP.....GK.-...D....AT..................EL..NFGWY..S...L...............................T..................K.........-..ETP.......................MVRLL.DS.....T.GK.....................................E..I.KT........F.D..G.TqnidkaET....V.IEN.........................................................................GSSV.T..LYPN.KVTVT....G.......L..DENT.SYK.......Y..QY...............YCD...G-.................................KWS.DA..ID---ystks......................................
A0A094CKQ9_9PEZI/36-127                ...................................................n-SQIRLAY.....AG.-...-....DT..................GM..FVSWN..T...F...............................D..................H.........L..SNP.......................TVHYG.LS.....P.DA.....................................L..T.ET........A.S..S.E......VS....-.I-T.........................................................................YPTS.L..TYNN.HVKLT....G.......L..KPDT.LYY.......Y..LP...............GDL..lKA................................tDTS.VP..FSFKT...........................................
A0A0G0MMG9_9BACT/308-392               .................................................isg-----IQV.....TD.I...T....TT..................SA..RVIWT..T...N...............................E..................P.........-..ANS.......................VVSYG.TT.....S.AY.....................................S..N.TV........S.Q..G.S......FV....T.---.........................................................................----.-..--AH.SLLLT....G.......L..TQST.RYH.......F..QV...............LSV...DSsl.............................nqAFS.SD..QTFVT...........................................
W5TIM5_9NOCA/115-208                   ..................................................va--GVHLQY.....GA.D...A....AR..................EV..VVSWH..T...T...............................T..................A.........V..RNP.......................MVRFG.TP.....T.AG.....................................F..G.TT........V.E..A.Q......TR....T.YRD........................................................................aASGT.E..VRVH.HARLT....G.......L..TPDA.EYV.......Y..AA...............GHD...G-.................................-AS.P-..-----elgtlrt....................................
A0A151EQZ9_9EURY/29-112                ......................................sqiiigpypqnpef--------.....--.-...-....-D..................SI..TIIWE..T...N...............................I..................S.........T..TNN.......................SVHYG.LT.....Q.DC.....................................E..Q.KK........-.-..-.-......--....-.---.........................................................................YNNI.S..GNFH.TVELN....G.......L..ISST.KYF.......Y..KV...............VSD...H-.................................IES.SI..YSFYT...........................................
PPA12_ARATH/60-150                     ....................................................PQQVHVTQ.....GN.H...E....GN..................GV..IISWV..T...P...............................V..................K.........P..GSK.......................TVQYW.CE.....N.EK.....................................S..R.KQ........A.E..A.T......VN....T.YRF.........................................................................FNYT.S..GYIH.HCLID....D.......L..EFDT.KYY.......Y..EI...............GSG...K-.................................-WS.RR..FWF--f..........................................
B9H0V4_POPTR/81-172                    ....................................................PQQVHITQ.....GD.H...V....GK..................GV..IVSWV..T...A...............................D..................E.........S..GSN.......................TVIYW.SE.....S.SK.....................................Q..K.KE........A.E..G.K......TY....T.YKF.........................................................................YNYT.S..GYIH.HCIIR....N.......L..EFNT.KYY.......Y..VV...............GVG...N-.................................-TT.RQ..FWF--it.........................................
A0A0B2PWM0_GLYSO/70-159                ....................................................PQQVHISL.....AG.-...-....DK..................HM..RVTWI..T...D...............................D..................K.........H..SPS.......................YVEYG.TL.....P.GR.....................................Y..D.SI........A.E..G.E......CT....S.YNY.........................................................................LLYS.S..GKIH.HAVIG....P.......L..EDNT.VYF.......Y..RC...............GGK...G-.................................---.--..-----pefelktpp..................................
A0A0C3I260_9PEZI/70-174                ...........................................tnnvnvial--------.....-S.Y...V....PQ..................GI..NIHYQ..T...P...............................F..................G........lG..EDP.......................SVNWG.SS.....A.DS.....................................L..G.KK........A.T..G.Y......SH....T.YDRtppc................................................................smisaVTQC.S..QFFH.EVQIT....G.......L..HPST.TYY.......Y..QI...............PAA...NG................................tTAS.EV..LSFTT...........................................
E1ZMF3_CHLVA/157-259                   ....................................................PMQGHLSL.....TG.-...K....PG..................EV..KVQWV..T...R...............................D..................A.........-..GSP.......................AVRWG.TR.....S.GA.....................................H..E.WS........A.A..G.D......SL....T.YTRadmcg..............................................................apanasGWVD.P..GWLH.GAVMA....G.......L..QPST.TYF.......Y..QY...............GDE...EL.................................GWS.GE..ESF--vs.........................................
A0A0N5BA92_STREA/28-125                ...................................................h-EQVHLSL.....AK.-...N....PR..................TM..VVQWT..T...F...............................Y..................Dls.....rnH..RKP.......................MVRYG.TI.....K.SY.....................................T..I.RI........K.S..G.H......TK....K.LVEs.......................................................................eNANI.T..RYFH.TVYLK....N.......L..YYDK.KYY.......Y..KV...............GDG...K-.................................TWS.KK..FYFRT...........................................
A0A0W8CCA0_PHYNI/68-165                ....................................................PQQIHLAF.....AG.A...K...vGT..................AM..TVSWA..T...F...............................E..................D.........V..SDS.......................SVWVG.SS.....E.DS.....................................L..E.LV........D.T..P.V.....sSD....S.YYS.........................................................................DDEY.N..LFHH.HATIT....G.......L..KPRT.KYF.......Y..KV...............GSR...GDe...............................kYTS.DV..SLFI-t..........................................
A0A0G0NI08_9BACT/3986-4084             ............................................itdivatp--------.....--.-...A....DK..................AA..TITWN..T...N...............................K..................D.........-..SDS.......................IVTYS.KS.....S.NF.....................................N..G.FN........AiV..G.T......VT....P.VGD.........................................................................ASTT.D..VFTH.EVSIT....G.......L..DSGS.TFY.......Y..KV...............SST...DS.................................---.--..-----sgnesvddnngvyytfrt.........................
A0A078K1E6_BRANA/54-148                ....................................................PEQVHITQ.....GD.H...N....GR..................GM..IISWV..T...P...............................I..................N........dD..GSN.......................VVQYW.VA.....D.GDe...................................sT..K.KS........A.E..A.S......TS....T.YRY.........................................................................YDYA.S..GFLH.HATIK....K.......L..EYST.KYF.......Y..EL...............GTG...R-.................................-ST.RR..FSFTT...........................................
A8X727_CAEBR/21-107                    ....................................................PDQVHLSF.....TG.-...D....MT..................EM..AVVWN..T...F...............................A..................E.........-..ASQ.......................DVYYK.KI.....G.IG.....................................A..S.ST........A.K..G.S......SE....A.WI-.........................................................................YGGI.T..RYRH.KATMT....G.......L..DYFS.EYE.......Y..TI...............ASR...T-.................................---.--..FS---fktls......................................
A0A0G1SHL0_9BACT/47-139                .................................................pkn---LK--I.....SN.L...N....AT..................TF..SVSWT..T...D...............................T..................P.........-..LTG.......................LTKYS.QD.....P.AK.....................................I..V.TP........A.G..D.V......RD....Q.IS-.........................................................................GTSQ.S..YNSH.TVNVS....G.......L..AAST.TYY.......F..LI...............VSG...SGt..............................ydD--.--..-----ngkpfsvrt..................................
A0A100YU31_9FIRM/56-148                ..................................................as--HVRQII.....TR.D...S....MT..................SR..TIMWQ..S...D...............................F..................S.........E..EPA.......................LVEYR.VK.....G.SD....................................gD..V.FQ........Q.Q..A.T......NE....A.FN-.........................................................................DDDT.T..TYVH.SALLQ....D.......L..TPGT.TYE.......Y..RV...............GYG...E-.................................KRT.EW..QEFQT...........................................
K6U261_9CLOT/48-152                    ....................................................PDHIALSW.....TD.D...P....TT..................TQ..TITWR..T...I...............................S..................T.........D..KKS.......................NLQYR.IK.....G.SS.....................................T..W.TT........A.S..N.I.....tPT....K.LTSstg...................................................................naaIATG.T..ENIY.SKTIT....G.......L..TPGT.TYE.......Y..QIvg...........idAND...KS.................................NAS.SI..STFKT...........................................
A0A0G1R9M3_9BACT/179-267               .............................................paistvv-------I.....SE.I...T....LN..................SA..IVSWT..T...S...............................T..................I.........-..TTS.......................VVKYG.KT.....L.DY.....................................D..K.E-........V.E..D.K......SS....-.---.........................................................................---G.L..TTVH.TALLK....N.......L..ETGT.KYH.......L..QV..............hG-T...DDag.............................naLLS.DD..YSFST...........................................
A0A0E0MJN8_ORYPU/44-131                ....................................................PQQVHISA.....VG.-...-....SD..................KM..RVTWI..T...D...............................D..................D.........-..APA.......................TVEYG.TV.....S.GE.....................................Y..P.FS........A.A..G.N......TT....T.YSY.........................................................................ILYN.S..GNIH.DAVVG....P.......L..KPST.TYY.......Y..RC...............SND...T-.................................--S.RE..LSFRT...........................................
B9RWM5_RICCO/68-179                    ....................................................PEQIALAL.....SS.-...-....ST..................SM..WVSWV..T...G...............................Naqigsn......vvpldpG.........S..VAS.......................EVWYG.KE.....S.GK.....................................Y..T.SK........K.K..G.N......ST....V.YSQlyp..................................................................feglVNYT.S..GIIH.HVIID....G.......L..EPGT.KYY.......Y..KC...............GDS...SI................................pAMS.EE..YFFQT...........................................
K7IM68_NASVI/29-120                    ....................................................PEAVHIAY.....GE.-...D....IH..................DI..VVTWS..T...R...............................Q..................D.........T..QES.......................IVEYG.IN.....G.YA.....................................L..T.AY........G.N..S.T......LF....V.DGG.........................................................................PKKH.R..QYIH.RVWLK....N.......L..TPNS.KYV.......Y..HC...............GSG...L-.................................GWS.DV..FYFNT...........................................
W2QC13_PHYPN/174-279                   ....................................................PKHGHLSL.....TD.-...D....ET..................AM..AILFN..S...G...............................S..................S.........-..KTP.......................MVKYG.EN.....P.QD.....................................L..K.FH........A.T..G.T......TT....T.YGAddlchep...........................................................anvlgqrAFRD.P..GFMH.TVIMT....D.......L..KPDT.YYY.......Y..QY...............GHE...GH.................................ALS.HV..RRFK-s..........................................
A0A0R3NYA0_DROPS/42-143                ....................................................PEQVHLAF.....GE.R...T....AS..................EM..VVTWS..T...R...............................S..................Lp.......pD..TAS.......................VVEYG.LI.....V.AGqa................................psrL..N.QR........A.Q..G.T......AT....R.FVDg.......................................................................gRKHS.T..QFIH.RVTLS....Q.......L..EANS.SYA.......Y..HC...............GSA...L-.................................GWS.AV..YQFRT...........................................
W3WV72_9PEZI/34-123                    ...............................................pvqkr-----IAI.....QG.-...-....PG..................SV..SIGWN..T...F...............................Q..................E.........L..DQP.......................CVQYG.TS.....E.TN.....................................L..T.SL........A.C..S.T......SS....V.T--.........................................................................YPTS.R..TYSN.AVVLE....D.......L..TPAT.TYY.......Y..QI...............VST...NS.................................---.TV..DHF--fsprt......................................
G0RRS8_HYPJQ/66-169                    .........................................snnvnvisvsy--------.....--.-...I....PN..................GI..NIHYQ..T...P...............................F..................G........lG..EAP.......................SVVWG.TS.....A.SD.....................................L..S.NT........A.T..G.K......TV....T.YGRtppc.................................................................slaaTTQC.S..EFFH.DVQIS....N.......L..KSGA.TYF.......Y..RI...............PAA...NG................................tTAS.DI..LSFKT...........................................
A0A0E0QGQ9_ORYRU/77-203                ....................................................PEQIALAA.....SS.-...D....AT..................SV..WVSWV..T...G...............................Eaqvgsh......ltpldpS.........T..VRS.......................EVWYS.ER.....P.SPtaaaa..........................gdvsghY..P.HV........A.R..G.K......AE....V.YSQlyp..................................................................ypglLNYT.S..GAIH.HVRLR....G.......L..RPAT.RYY.......Y..RC...............GDS...SVrg.............................gaGLS.GE..LSFET...........................................
R5CVL7_9FIRM/1065-1160                 .................................................pyg---LMFNA.....LN.D...A....AH..................GK..SMTWM..S...N...............................A.................iK.........A..QDQ.......................YIRYR.VS.....G.TE.....................................D..W.TTv......aA.K..A.T......LR....T.FTK.........................................................................GSNS.A..VNVN.SITLS....S.......L..TPGT.AYE.......Y..QI...............GGG...E-.................................AWS.EV..ATFKT...........................................
Q7UIH3_RHOBA/36-128                    ....................................................PAQWRVIW.....TA.D...P....AT..................KA..TISWS..T...K...............................E..................A.........G..SSH.......................SVRFR.VK.....D.SD.....................................D..R.LA........E.Q.lA.E......SG....R.YT-.........................................................................GGEF.E..SYYH.HARLT....D.......L..QPGT.AYE.......V..QM...............VSD...A-.................................NES.PV..FYFVT...........................................
C3Z3N2_BRAFL/38-129                    ....................................................PQQVHLSY.....AG.-...S....AS..................EM..MVTWS..T...A...............................N..................K.........-..TDS.......................VVEYG.EG.....G.--.....................................L..V.KT........A.R..G.S......SV....E.FEDg.......................................................................gDEHR.V..QYIH.RVTLT....G.......L..TPGH.TYM.......Y..HC...............GSM...EG.................................GWS.DL..FVFT-a..........................................
A0A0F5VT18_9ACTN/75-180                ....................................................PFGRHLAF.....GA.D...P....RT..................EL..TVSWQ..V...P...............................V..................A.........V..KKP.......................FLRIG.AH.....P.WD.....................................L..S.RK........I.E..A.E......VR....T.LYTpag...................................................................vgaSGDH.T..QYYV.HAELS....R.......L..KPGR.TYY.......Y..GV...............GHQ...G-.................................---.--..-----fdpaephllgtlgtftt..........................
I4YJ71_WALMC/18-112                    ................................................tyqq----RLAY.....AG.-...-....DD..................GV..NIAFN..T...K...............................G..................Nn......tlH..STP.......................TVFYG.TS.....K.DD.....................................L..T.MQ........A.Q..G.L......SS....I.Y--.........................................................................-QTS.L..STTH.KVKLR....N.......L..NPDT.RYF.......Y..QT...............CLD..iNNe...............................cPRS.DV..LSFKT...........................................
K4CBN7_SOLLC/53-144                    ....................................................PQQVHITQ.....GD.Y...D....GE..................AV..IISWV..T...A...............................D..................E.........P..GSS.......................EVRYG.LS.....E.GK.....................................Y..D.VT........V.E..G.T......LN....N.YTF.........................................................................YKYE.S..GYIH.QCLVT....G.......L..QYDT.KYY.......Y..EI...............GKG...D-.................................-SA.RN..FWF--et.........................................
A0A022PSB9_ERYGU/44-136                ....................................................PTQVHISL.....AG.-...-....PK..................HM..RITWV..T...T...............................D..................K.........H..SPS.......................TVEYG.TS.....S.NN.....................................Y..T.SK........A.E..G.E......TT....S.YTY.........................................................................LLYS.S..GKIH.HTVIG....P.......L..EDNT.IYF.......Y..RC...............GGQ...G-.................................---.--..-----pqfqlktppsqf...............................
C5YDS8_SORBI/167-275                   ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVSWT..S...G...............................Y..................Di.......nE..AYP.......................FVEWG.IK.....W.SP.....................................A..V.RT........A.A..G.T......V-....T.FDRdsicg..............................................................eparsvGWRD.P..GFIH.TAFLT....D.......L..WPNK.EYY.......Y..KI...............GHMl.pDGn...............................vVWG.KL..SSFK-a..........................................
A0A0E0BFE0_9ORYZ/171-260               ....................................................PQQVHISM.....VG.-...-....EK..................NM..RISWV..T...D...............................D..................L.........N..APS.......................VVEYG.TS.....P.GK.....................................Y..T.AS........A.T..G.D......HT....T.YRY.........................................................................FLYK.S..GAIH.HATIG....P.......L..EAST.TYH.......Y..RC...............GKA...GD.................................---.--..-----eftlrtpp...................................
A0A072U6M0_MEDTR/71-182                ....................................................PEQIALAI.....SS.-...-....PT..................SM..WISWI..T...G...............................Ksqigln......vtpldpA.........S..IGS.......................EVWYG.KK.....S.GK.....................................Y..T.NV........G.K..G.D......SL....V.YSQlyp..................................................................feglLNYT.S..GIIH.HVKLE....G.......L..EPGT.RYY.......Y..KC...............GDS...SI................................pAMS.QE..NYFET...........................................
A0A059LGY9_9CHLO/122-225               ....................................................PTGVHLLA.....GR.-...S....PR..................SV..LVQWT..T...F...............................N..................P.........-..GSP.......................QVWFG.TS.....P.DR.....................................L..Q.WS........A.P..A.S......SD....T.YTPatlcg..............................................................grasneGWLE.P..GYLH.TADML....N.......L..PKAT.DIF.......Y..QV...............GDA..vTG.................................VKS.RV..YSF--fs.........................................
S2D0A0_9BACT/27-112                    ....................................................PHAFYLTW.....TE.D...P....TS..................SM..DVDWH..T...D...............................S..................S.........-..EPL.......................NLYLR.RK.....G.TA.....................................D..W.RS........L.V..S.A......VL....P.---.........................................................................YPFS.E..RHVH.RVAVR....G.......L..RPDT.AYE.......L..RF...............VEN...G-.................................---.TV..YYFKT...........................................
G0T1L1_RHOT2/45-137                    ....................................................PLQHRLAF.....AG.-...-....PT..................GM..TVSWS..T...F...............................N..................Q.........L..SNP.......................QVFYG.TD.....P.SN.....................................L..D.QQ........A.S..S.S......ES....T.T--.........................................................................YPTS.R..TYNN.HVKLT....G.......L..KPGT.KYY.......Y..KV...............SYT...NAp..............................aaAYR.PT..YSFTT...........................................
M4EDL4_BRARP/145-248                   ....................................................PEQIHLAF.....ED.-...K....VN..................RM..QVTFV..A...G...............................D..................G.........-..EER.......................FVRYG.EA.....E.DA.....................................L..A.NS........A.A..A.R......GI....R.YERehmcna.............................................................panstvGWRD.P..GWIF.HTVMK....N.......L..NGGV.RYY.......Y..QV...............GSD...SK.................................GWS.EI..HSF--ia.........................................
A0A061FD96_THECC/58-152                ....................................................PQQVHITQ.....GD.A...D....GR..................GV..IISWI..T...P...............................D..................E.........P..GSN.......................TVLYW.SE.....N.SK.....................................H..K.NR........A.D..G.T......FV....R.YKF.........................................................................FNYT.S..GYIH.HCTIN....K.......L..EGET.T--.......-..--...............---...--.................................---.--..-----pfkpythryyvpyesshstsp......................
A0A067FD35_CITSI/54-141                ....................................................PQQVHISL.....AA.-...-....KD..................YI..RVSWI..T...D...............................D..................K.........E..AES.......................VVEYG.KL.....P.GR.....................................Y..N.TV........A.T..G.E......HT....S.YQF.........................................................................FFYK.S..GKIH.HVKIG....P.......L..EPAT.TYY.......Y..RC...............GGR...G-.................................---.PE..FSFK-m..........................................
V4MHN2_EUTSA/172-280                   ................................................pvyp----RLAL.....TK.-...N....WD..................EM..TVTWT..S...G...............................Y..................N.........I..NEAv.....................pFIEWS.SK.....G.LP.....................................S..R.RS........P.A..G.T......I-....T.FNRnsmcg..............................................................dpargvGWRD.P..GFFH.TAFLK....E.......L..WPNR.EYT.......Y..RL...............GHEl.vNGs...............................tIWS.KN..YTFV-s..........................................
I1FMC5_AMPQE/150-251                   ....................................................PLQPHLAL.....TN.-...D....PT..................TL..LLTWS..T...R...............................D..................S.........-..HEP.......................KVKFW.QN.....M.TT.....................................Y..I.RI........E.A..A.T......SN....K.YTSkdmcg..............................................................ppattvGYID.P..GMLH.TAKLS....G.......L..TPGQ.EYN.......Y..QF...............GDD..pE-.................................-WS.QV..FSFR-m..........................................
W7DEN0_9LIST/222-319                   ....................................................PSKIAVTF.....FG.N...T....QT..................QK..GFTWH..T...K...............................L..................D.........-..AKS.......................DLQYV.KT.....V.GS.....................................A..V.PS........F.A..G.A......QL....V.TGKse.....................................................................anDVAI.G..GFSH.QVTAK....Y.......L..DPGT.TYW.......Y..RV...............GDE...AR................................dKWS.EP..AQFTT...........................................
A0A0B2PNE9_GLYSO/168-276               ................................................pvyp----RLAQ.....GK.-...T....WD..................EI..TVTWT..S...G...............................Y..................Gi.......sD..AEP.......................FVEWG.PK.....G.GN.....................................L..V.KS........P.A..G.T......LT....-.FDHntmcg..............................................................apartvGWRD.P..GYIH.TSFLK....E.......L..WPNQ.EYK.......Y..KL...............GHRl.fNGt...............................iIWS.QE..YQFK-a..........................................
A0A0L9V9D4_PHAAN/54-145                ....................................................PQQVHITQ.....GD.L...V....GR..................GI..IVSWV..T...M...............................D..................E.........P..GSS.......................AVRYW.SE.....N.SG.....................................K..K.KI........A.E..G.K......IV....T.YRF.........................................................................FNYS.S..GFIH.HTTIR....H.......L..EYNT.KYY.......Y..EV...............GLG...N-.................................-TT.RQ..FWFVT...........................................
K7LFF7_SOYBN/72-174                    ................................................plyg----HISS.....ID.S...T....GT..................SM..RLTWV..S...G...............................D..................K.........-..EPQ.......................QIQYG.NG.....K.TV.....................................T..S.AV........T.T..F.S......QD....-.--Dmcsstl............................................................pspakdfGWHD.P..GYIH.SALMT....G.......L..KPSS.TFS.......Y..RY...............GSG...SV.................................GWS.EE..IKFST...........................................
B9H015_POPTR/71-182                    ....................................................PEQISLAI.....SS.-...-....PT..................SM..WVSWV..T...G...............................Eaqigsd......vipldpA.........S..VAS.......................EVWYG.KE.....S.GK.....................................Y..A.SR........G.K..G.N......ST....V.YTQlyp..................................................................feglSNYT.S..GIIH.HVRID....G.......L..EPET.KYF.......Y..KC...............GDS...SI................................pAMS.EE..HVFET...........................................
A0A0M3RE16_9BACI/985-1090              .................................................ikn---ILSNP.....TG.D...P....YK..................TK..SFTWM..S...S...............................P..................L........tE..AGA.......................MVKFA.RK.....Q.DYerk...............................gedA..F.ET........A.T..G.T......SS....-.--Sqvfs................................................................geldiKKNG.I..VRVN.EVKLS....K.......L..QQDT.TYV.......Y..QV...............GDG...E-.................................NWS.PI..EEFTT...........................................
A0A0M2J7B2_9ACTN/74-179                ....................................................PFGRHLAY.....GS.D...P....RT..................EI..TVSWQ..V...P...............................V..................V.........V..DKP.......................FIRIG.AS.....P.WD.....................................L..S.RK........I.S..A.E......VR....T.LYTpag...................................................................vgaSADH.Y..QYYL.HAKLT....N.......L..RPGK.TYY.......Y..GV...............GHA...G-.................................---.--..-----fdpaerhllgtlgtftt..........................
A0A0F0L9T2_9MICO/242-333               ....................................................PTRVILTP.....TE.Q...P....AI..................SQ..SFSWL..A...G...............................D..................A........sH..TVG.......................QVEIA.PA.....V.GG.....................................D..T.RT........V.D..A.Y......DA....G.V--.........................................................................VNGN.P..NKHF.SATVT....N.......L..TPAT.AYR.......Y..RV...............GLP...G-.................................SWS.DW..FEFRT...........................................
R7CGS9_9FIRM/55-149                    ..................................................ft--KVSLTP.....GA.-...D....DT..................QL..NFAWY..S...E...............................Kg................dS.........D..ATP.......................VVHFG.TD.....K.DN.....................................L..E.-T........F.E..G.T......AG....D.VDQs.......................................................................lTGDK.A..YEYN.HVTVT....G.......L..EPNT.TYY.......Y..TV...............EKN...G-.................................EQT.EV..SEYKT...........................................
K4R292_9ACTN/76-181                    ....................................................PFGRHLAF.....GA.D...P....RT..................QM..RISWQ..V...P...............................A..................A.........V..KKP.......................YVRIG.AR.....P.DE.....................................L..G.RK........V.E..A.E......IR....D.LHTpgv...................................................................egvRLAL.E..QYYV.HAALD....D.......L..LPGT.TYY.......Y..GV...............GHD...GFdpa...........................sapHRA.TV..ASFRT...........................................
A0A016V8J0_9BILA/17-103                ....................................................PEQVHLAF.....HG.-...N....FS..................VM..NVVWT..T...F...............................E..................S.........-..DTS.......................TVHYG.TS.....P.SN.....................................M..P.FS........V.S..G.S......QK....A.WR-.........................................................................TGSI.T..RYSH.RALMI....N.......L..LPST.TYW.......Y..RI...............GSR...--.................................---.--..-----ifqfktma...................................
A0A168LPI5_9BACL/89-188                ...................................................v-NKITVTF.....NG.D...T....TT..................SK..GFTWY..S...K...............................V..................T........dS..VYG.......................DLQVV.EM.....K.EG.....................................S..Q.ID........F.T..S.S......QN....F.VARss.....................................................................iaKNSP.T..ELMY.KAEAT....S.......L..KPDT.AYY.......F..RI...............GNEl.lN-.................................SWS.DV..GTFRT...........................................
V4RIF8_9ROSI/78-189                    ....................................................PEQIALAI.....SS.-...-....PT..................SM..WVSWV..S...G...............................Daqigsn......vtpldpS.........T..VAS.......................DVWYG.KQ.....S.GK.....................................Y..T.SK........R.G..G.N......AT....V.YSQlyp..................................................................fkglLNYT.S..GIIH.HVKID....G.......L..DPGT.KYY.......Y..KC...............GDS...KI................................pAMS.AE..HVFET...........................................
H3GZF9_PHYRM/91-189                    ....................................................PQQFHLAF.....AG.E...E...aGT..................GM..AISWT..T...F...............................A..................L.........D..SDP.......................TLWLG.RS.....E.TK.....................................L..K.VVs......sA.K..I.E......TK....S.YYK.........................................................................DKDY.E..LYSY.HAVVS....G.......L..KPNK.EYF.......Y..KV...............GNA...DNk...............................lFQS.GV..SSFTT...........................................
A0A0D3HW06_9ORYZ/173-281               ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Si.......kE..AIP.......................FVEWG.HK.....G.GN.....................................Q..M.LS........P.A..G.T......L-....T.FSRnsmcg..............................................................spartvGWRD.P..GYIH.TSFLK....E.......L..WPDS.LYT.......Y..RL...............GHRl.lDGt...............................hIWS.KS..YSFR-a..........................................
M1AIC8_SOLTU/168-276                   ................................................pvyp----RLAQ.....GK.-...T....WN..................EM..TVTWT..S...G...............................Y..................Gi.......nE..AEP.......................FVEWG.PK.....G.GQ.....................................Q..G.HS........P.A..G.T......L-....T.FDRssmcg..............................................................apartvGWRD.P..GFIH.TSFLK....E.......L..WPNT.MYT.......Y..KL...............GHRf.lNGt...............................yMWN.QM..HQFK-s..........................................
A0A0G0KPF3_9BACT/133-231               ............................................tlsspsvq--------.....-R.-...N....ST..................NA..TITWT..T...N...............................E..................P.........-..TQG.......................QVYYN.TL.....P.LV.....................................F..N.EA........T.G..P.R......QQ....P.YVSga.....................................................................ysTDNG.G..LISH.SITIV....N.......L..QPNT.TYH.......F..LT...............RAV...DNvg.............................nmSMT.WP..SSFT-t..........................................
A0A0G0T2K7_9BACT/2313-2412             ...............................................vsnvs-----ATV.....--.-...A....TT..................TI..TITWQ..T...T...............................N..................Qag....splA..GDS.......................YVIYD.FN.....S.NF.....................................I..N.SQ........E.Q..G.S......AT....-.---.........................................................................---T.S..ASNH.SVTLT....N.......L..EPGQ.TYY.......Y..KV...............RTT...AAnggvt......................tqsvnpATQ.NT..YSFQT...........................................
A0A0D3CI07_BRAOL/43-130                ....................................................PEQVHISL.....AG.-...-....DK..................HM..RVSWV..T...N...............................D..................K.........S..SPS.......................FVEYG.TS.....P.GK.....................................Y..S.FL........G.Q..G.E......ST....S.YSY.........................................................................IFYR.S..GKIH.HAVIG....P.......L..EPDT.VYY.......Y..RC...............GGG...G-.................................---.PE..-----fhlkt......................................
D9WCQ7_9ACTN/82-187                    ....................................................PFGRHLAL.....SA.D...P....TT..................QM..RVSWQ..V...P...............................F..................A.........V..KRP.......................YLRIG.PR.....P.TD.....................................L..T.RK........V.E..A.E......VR....H.LHTpsl...................................................................gdkLPAV.D..QYYL.HAAVE....G.......L..SPGV.TYY.......Y..GV...............GHE...GYdpa...........................dprHFS.SL..GTFRT...........................................
G4YJW0_PHYSP/154-259                   ....................................................PKHGHLSL.....TD.-...D....DT..................AM..AIMFN..T...A...............................S..................S.........-..KTP.......................MVKYG.EN.....P.QD.....................................L..K.HQ........A.T..G.T......ST....T.YGAddlchap...........................................................anvlgqrAFRD.P..GYMH.TIIMK....D.......L..KPDT.YYY.......Y..QY...............GHE...EY.................................GLS.HV..RRFK-s..........................................
E3LNV3_CAERE/25-110                    ....................................................PEQVHIAF.....YT.-...S....PW..................DI..SVTWI..T...F...............................E..................D.........-..ADP.......................ALSYG.TS.....T.AS.....................................M..Q.-N........I.T..G.T......TN....T.WKF.........................................................................-GGI.I..RHSH.VVILN....S.......L..KPSS.QYY.......Y..QI...............GSR...--.................................---.--..-----vftfrtls...................................
C3ZMT7_BRAFL/37-127                    ....................................................PTQIHLSY.....TG.-...S....PT..................SM..VVTWS..T...L...............................N..................N.........-..TAS.......................VVEYG.QG.....D.FH.....................................L..R.NS........G.I..S.T......LF....V.DGG.........................................................................KKHN.A..QYIH.RVVLT....G.......L..KPGY.RYI.......Y..RV...............GSD...E-.................................SWS.DI..YSFT-a..........................................
K7W1T8_MAIZE/226-334                   ................................................pvyp----RLAQ.....GK.-...S....WN..................EI..TVTWT..S...Gy.............................gT..................N.........E..ATP.......................FVRWG.IE.....G.QI.....................................Q..T.LS........P.A..G.T......L-....T.FSRdtmcg..............................................................ppartvGWRD.P..GFIH.TSFLK....D.......L..WPNL.LYT.......Y..QV...............GHRi.fNGs...............................iVWG.HQ..YSFK-a..........................................
A0A0D9V6T0_9ORYZ/145-246               .........sdpgylsckksacqkrrasgtckvrtcaatltfhvinfrtdve--------.....--.-...-....--..................--..-----..-...-...............................-..................-.........-..---.......................-----.--.....-.--.....................................-..-.--........-.-..-.-......--....-.--Fvlfsggia........................................................vlpspakdfGWHD.P..GYIH.SAVMT....G.......L..LPSQ.SYT.......Y..RY...............GSD...SV.................................GWS.DT..IKFRT...........................................
D0P2U6_PHYIT/97-195                    ....................................................PQQFHLAF.....AG.K...E...aGT..................GM..AISWT..S...F...............................G..................L.........E..ESP.......................SVWIG.TS.....E.AKv...................................aL..V.KD........A.K..I.E......VK....T.YYK.........................................................................DDKY.A..LYNY.HAVVG....G.......L..ESFT.EYF.......Y..RV...............GSA...TEk...............................kFQS.AV..SSFKT...........................................
G5A0U3_PHYSP/66-163                    ....................................................PQQIHLAF.....AG.K...K...vGT..................AM..TVSWA..T...F...............................E..................D.........V..TDS.......................SVWVG.DS.....E.DT.....................................L..E.LV........D.T..P.V.....sSL....S.YYS.........................................................................DKEY.N..LFHH.HATVT....G.......L..SPRT.KYF.......Y..KV...............GSR...SDd...............................kFTS.DV..YSFIT...........................................
R6NFW2_9CLOT/686-801                   ....................................................PSNVVMNL.....GE.D...S....AT..................EV..TVTWL..T...K...............................Y..................S.........L..TDS.......................DIELL.PY.....S.SSprft.............................grptT..D.SR........V.N..A.S......SE....A.VTRsypgad............................................................lgifgllPYET.D..YVLH.TVKLS....G.......L..EPGT.KYS.......Y..RV...............GDA...EK................................gWWS.EA..GVIET...........................................
A0A068X497_HYMMI/1-83                  ....................................................--------.....--.-...-....--..................-M..TITWT..T...L...............................K..................E.........A..ADS.......................GVLYG.VE.....E.LE.....................................T..Y.AP........A.S..Q.K......AF....V.DGG.........................................................................AEQR.V..TYIH.TVTLK....N.......L..QPNT.SYV.......Y..KV...............GNN...ATng.............................dsNWS.SP..YTFRT...........................................
A0A0G1ND05_9BACT/73-158                ...........................................ptitsiass--------.....--.V...T....TT..................GA..TISWT..T...N...............................E..................A.........-..GTS.......................RVEYG.LT.....T.SY.....................................G..N.TT........S.-..-.-......--....-.---.........................................................................-LST.S..LTSH.SHTLS....S.......L..PPNT.TYH.......Y..RV...............NTT...DSag.............................ntATS.QD..RTFTT...........................................
A0A0G0EPY6_9BACT/1908-1998             ................................................kvvt--------.....--.-...T....AK..................TA..TISWR..T...D...............................K..................P.........-..AGS.......................FVAIA.QE.....K.DF.....................................K.gT.NS........D.E..M.G......YV....Q.VIG.........................................................................GNST.S..TTDH.TVMIY....D.......L..EPET.NYH.......Y..QV...............RSK...ASvg.............................tiGYS.PD..FTFKT...........................................
B9GWK4_POPTR/214-316                   ...................................................p-LHGHISS.....ID.S...T....AT..................SM..RLTWV..S...G...............................G..................E.........-..ETQ.......................QVQYG.DG.....E.TL.....................................T..S.TA........K.T..F.S......QD....-.--Dmctsvl............................................................pspandfGWHD.P..GYIH.SAVMT....G.......L..RPST.TYS.......Y..RY...............GSD...SV.................................GWS.DK..IQFRT...........................................
B6HUH0_PENRW/33-119                    ....................................................PFQQRLSV.....YG.-...-....PD..................AV..SVGWN..T...Y...............................M..................Q.........L..EQS.......................CVHYG.LS.....E.SN.....................................L..N.TK........A.C..S.S......SS....T.T--.........................................................................YDPS.R..TWSN.VAVLT....G.......L..TPAT.TYY.......Y..KI...............DST...N-.................................--S.TV..GHF--ls.........................................
K7LXJ7_SOYBN/67-178                    ...................................................a-EQIALAI.....SS.-...-....PT..................SM..WVSWV..T...G...............................Daqigln......vtpidsA.........S..VES.......................EVWYG.KE.....S.GK.....................................Y..I.SV........R.K..G.D......SV....V.YSLlyp..................................................................feglWNYT.S..GIIH.HVKLK....G.......L..EPST.RYY.......Y..KC...............GDS...ST................................pAMS.RE..FIFET...........................................
A0A059BMC4_EUCGR/165-252               ...................................................h-ETVHISL.....AG.-...-....EG..................HM..HISWV..T...D...............................G..................K.........S..SPS.......................YMEYG.TS.....P.GR.....................................Y..D.ST........A.Q..G.E......ST....S.YSY.........................................................................LFYS.S..GRIH.HTVIG....P.......L..ESNT.VYF.......Y..RC...............GGE...G-.................................---.--..-----pefqlkt....................................
K3WPZ6_PYTUL/186-287                   ....................................................PKQVHTAY.....GK.-...E....PG..................SF..SVQWM..T...H...............................D..................Ec.......aL..GES.......................QVKLE.EG.....Y.HAlit..............................ertpV..V.SR........A.T..T.-......--....-.--Tlft...................................................................ddgKKKV.Q..RWHH.VAEIK....G.......L..KTNT.RYT.......Y..VV...............GNP...VY.................................SWS.IP..FSTKT...........................................
A0A0P0NHK2_9SPHI/50-133                ...............................................ylqtn--------.....--.-...F....GN..................SI..SILWI..T...S...............................K..................D.........-..SSS.......................WVEYG.ES.....P.EQ.....................................L..D.KK........A.Y..G.K......SE....-.--M.........................................................................GFKP.A..GRLN.CVKLE....H.......L..KPGT.TYH.......Y..KV...............VSK...E-.................................---.--..-----ikdfqpyklty................................
D2QUS8_SPILD/31-127                    ....................................................PDRLILGW.....QG.N...P....AT..................SQ..SVNWR..T...D...............................S..................T.........V..TTA.......................VGAIA.EA.....D.PS.....................................P..D.FV........S.S..A.S......VV....A.ATTer.....................................................................vvLDGK.A..VRYH.SVHFK....N.......L..KPGT.QYS.......Y..RV...............GDG...T-.................................HWS.EW..FHFRT...........................................
A0A078M3X7_9STAP/80-231                ....................................................PNRIITTI.....NG.N...T....QT..................EM..AFNWY..T...T...............................D..................L.........F..EDA.......................KVWVS.KS.....G.NFd..................................dtL..E.FK........A.E..A.T......KV....T.SSYgerdktgnyifaevkensegepveden..................gepvlngyytdrqahgddwmsgdyghieLTDV.T..EYSY.KAKAT....D.......L..EQNT.DYY.......Y..QV...............GSE...SG.................................KVS.ET..GTFKT...........................................
A0A0J7Z511_STRVR/31-126                .................................................lia---VNLEL.....VT.L...T....ED..................SA..VITWY..T...Gipgtdd...................glghplP..................A.........L..TEG.......................EIVYG.TH.....P.SR.....................................L..N.RT........A.S..-.-......--....-.---.........................................................................-EGR.P..TAHH.QVELT....D.......L..EPGQ.TYY.......Y..QA...............RSR...GT.................................---.--..-----aatptplhl..................................
M2Y0C9_DOTSN/29-119                    ....................................................PVQQRLAV.....KG.-...-....PS..................SM..AIAWN..T...Y...............................G..................K........lN..STA.......................CVKYG.TS.....A.SK.....................................L..T.SE........A.C..T.N......SQ....N.--T.........................................................................YATS.R..TYAH.DVTMT....G.......L..KPST.TYY.......Y..KI...............VST...N-.................................--S.TV..DHF--vsprt......................................
Q63X35_BURPS/53-150                    ....................................................PEQIHLTW.....GD.A...D....AN..................EV..VVSWA..S...L...............................A..................A.........A..TNP.......................RVRFA.GP.....N.-E.....................................A..W.RT........V.H..G.V......QR....T.YTD........................................................................gLNGE.V..VFTY.HARLR....G.......L..KPGA.VYR.......Y..EV...............TAD...ND.................................---.--..-----anaaqpfaarfeta.............................
A0A0Q5V6H3_9FLAO/20-110                ..............................................slypyl--------.....QA.P...T....TN..................SI..YVNWK..T...E...............................S..................N.........-..PES.......................IVEYG.ST.....P.NA.....................................L..T.LS........A.T..G.T......NS....I.FTD.........................................................................TGYPaN..YYYH.SVKIS....G.......L..NPNT.KYY.......Y..RV...............RTG...T-.................................STS.QT..MSFKT...........................................
R0G573_9BRAS/57-148                    ....................................................PQQVHITQ.....GD.V...E....GK..................AV..IVSWV..T...Q...............................E..................A.........K..GSN.......................KVIYW.KE.....N.SS.....................................K..K.YK........A.H..G.K......TN....T.YKY.........................................................................YNYT.S..GYIH.HCPIR....N.......L..EYDT.KYY.......Y..VV...............GVG...E-.................................-TE.RQ..-----fwfft......................................
S0FLP3_9FIRM/32-141                    ...........................................tqpyllslh--------.....--.-...P....KS..................EM..NICWL..T...G...............................E..................T.........A..RES.......................YVEYG.QA.....E.SL.....................................-..G.KK........V.P..A.R......EF....K.INGlrksatla.........................................................gynkepgeNPSL.D..VFQE.IAVLN....D.......L..TPGT.KYF.......Y..RV...............VTK...SGe..............................kiLKG.RT..YYFKT...........................................
W2PQU2_PHYPN/95-193                    ....................................................PQQFHLAF.....AG.K...V...aGT..................GM..TISWT..T...F...............................A..................L.........E..KKP.......................AVWIG.TS.....E.SK.....................................L..T.IV........K.D..A.T......IE....T.KSYy.......................................................................kDDHY.E..LYSY.HAVVG....G.......L..KPNK.EYF.......Y..KV...............GSG...SEt...............................kFQS.AV..SSFTT...........................................
U2T819_LEIAQ/19-112                    ..................................................qt--DIVLGV.....GA.-...D....QS..................QR..NFSWY..S...A...............................A..................D.........-..VAQ.......................VVQVG.YA.....S.EV.....................................V..G.GA........F.P..Q.V......VK....S.IPAt......................................................................ggLTTS.N..EYNR.FATVT....G.......L..KENT.SYV.......Y..RV...............GTE...G-.................................DWS.AT..YTFRT...........................................
A0A0G1KD60_9BACT/119-221               ..............................................issinv--------.....ST.-...G....ST..................SA..SVGWM..T...S...............................E..................G.........-..ARG.......................KVYYD.TS.....P.IR.....................................V..S.NI........F.D..V.N......GV....F.S-Geptvs...............................................................gilaqYDGV.E..RSAQ.AVNIT....G.......L..SPNT.TYY.......Y..LIvv...........ldSSN...NV.................................SVS.LP..ASFRT...........................................
A0A0K9NKL2_ZOSMR/168-277               ................................................pvyp----RLAQ.....GK.-...S....WD..................EM..VVTWT..S...G...............................Y..................Di.......nE..AEP.......................FVEWG.RQ.....N.QQ.....................................V..D.TR........S.P..A.G......TL....T.FNRnsmcg..............................................................apartvGWRD.P..GFIH.SSFLK....D.......L..WPNA.RYN.......Y..KL...............GHR..lNNg..............................syIWS.KV..YGFK-a..........................................
I2GL27_9BACT/31-127                    ....................................................PDRVILGW.....QG.N...P....AT..................SQ..SVNWR..T...D...............................S..................T.........V..SNA.......................VGAIT.EA.....D.PSpd................................lagK..A.MV........V.P..A.T......TE....R.VV-.........................................................................IDGK.T..VLYH.SVHFT....N.......L..KPAT.QYN.......Y..RV...............GDG...E-.................................HWT.EW..FQFKT...........................................
S8E0Z5_9LAMI/124-227                   ....................................................PEQIHLAL.....TG.-...R....IG..................EM..RVMFV..T...G...............................D..................G.........-..RES.......................FIRYG.PD.....A.GG.....................................M..K.TS........V.A..T.G......VS....R.YERdhmcds.............................................................panhslGWRD.P..GFVH.DGVIS....G.......L..RHGR.RYY.......Y..TV...............GSD...SG.................................GWS.KT..QSFV-s..........................................
A0A0G2ALL7_9BACT/176-266               .................................................dsa-----LVP.....GR.K...D....RT..................QT..VVSWK..T...D...............................E..................P.........-..STS.......................IVKYE.EG.....S.GS.....................................P..E.AT........L.A..N.K......QE....-.---.........................................................................DTTT.L..TTNH.TIILT....T.......L..KPGT.IYR.......F..QI...............GSS...DQa...............................gN--.--..-----astlpvrtiit................................
D0MUK6_PHYIT/61-158                    ....................................................PQQLHLAY.....AG.K...N...aGT..................AM..TVSWS..T...Y...............................A..................K.........I..DDS.......................SVWVG.RS.....E.DA.....................................L..E.LV........D.T..T.V.....tQT....S.YYH.........................................................................DATY.N..MFHH.HAMVS....G.......L..TPHT.KYY.......Y..KV...............GSK...ANa...............................qYTS.DV..HSFLT...........................................
R4LSU4_9ACTN/40-135                    ....................................................PTAIILGV.....GA.-...N....ES..................QR..IVTWY..T...T...............................T..................D.........-..TAQ.......................QIQLA.PT.....A.DL.....................................T..G.GA........F.P..A.S......AA....T.FAAlg....................................................................ganLATS.G..GYNR.HATIT....G.......L..KEHT.AYS.......Y..RV...............GAE...G-.................................AWS.ST..YTFKT...........................................
T1KY41_TETUR/31-122                    ....................................................PEQVHLSL.....GS.-...N....PS..................EM..VATWT..T...F...............................N..................S.........A..GQP.......................IVEYG.IK.....K.--.....................................L..D.KT........A.K..G.Q......ST....E.FVDg.......................................................................gSEAR.S..MFIH.RVTMK....N.......L..VPGQ.TYI.......Y..HV...............GSE..fG-.................................-WS.PI..FWFTT...........................................
L1LZW1_PSEPU/38-134                    ...................................................a-DRIVLTP.....GA.N...P....AR..................EM..AVTFR..T...D...............................S..................R.........Q..TSS.......................HLQLA.PA.....L.DGpq................................lekR..A.TL........V.E..G.S......SQ....P.LD-.........................................................................TENG.A..ARYH.QVRLA....G.......L..QPDT.PYV.......Y..RV...............KGA...E-.................................GWS.EW..LQLRT...........................................
K3WNF6_PYTUL/70-169                    ....................................................PQLLHLAY.....AG.S...Ps..dST..................GM..TISWA..T...Y...............................Q..................K.........A..SDS.......................AVWIG.LA.....E.SS.....................................L..E.IV........D.K..T.La....pSA....S.YYS.........................................................................DDDY.S..LFQN.HATMR....G.......L..KPHT.KYF.......Y..KV...............GSA...RDl...............................kLQS.PL..NTFT-m..........................................
A0A0D2BAX9_9EURO/68-171                ...............................................tnnvn-----VIQ.....LS.Y...L....PN..................GI..NIHYQ..T...P...............................F..................G........lG..VSP.......................TVFWG.TT.....A.GK.....................................L..D.RK........A.Q..G.Y......SR....T.YDRtppc.................................................................slvaVTQC.S..QFFH.DVQIT....G.......L..DPGT.TYY.......Y..QI...............PAA...NG................................tTTS.QV..MSFST...........................................
V4RJD8_9ROSI/86-198                    ....................................................PEQISVSL.....SS.-...T....HD..................SV..WISWI..T...G...............................Efqignn......lkpldpK.........S..VAS.......................VVRYG.TL.....R.SQ.....................................L..N.RR........A.T..G.H......SL....V.YNQlyp..................................................................flglQNYT.S..GIIH.HVRLT....G.......L..KPDT.LYH.......Y..QC...............GDP...SI................................pAMS.GA..YCFRT...........................................
Q10Q09_ORYSJ/172-280                   ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...Gy.............................gT..................N.........E..ATP.......................FVKWG.LQ.....G.QI.....................................Q..S.LS........P.A..G.T......L-....T.FSRstmcg..............................................................ppartvGWRD.P..GFIH.TSFLK....D.......L..WPNF.KYT.......Y..RI...............GHR..lSDg..............................siIWG.HE..YSFQ-a..........................................
A0A0P0V8Z3_ORYSJ/1-87                  ...................................................i------TQ.....GN.H...D....GT..................AM..IISWV..T...T...............................I..................E.........P..GSS.......................TVLYG.TS.....E.DN.....................................L..N.FS........A.D..G.K......HT....Q.YTF.........................................................................YNYT.S..GYIH.HCTIK....K.......L..EFDT.KYY.......Y..AV...............GIG...Q-.................................-TV.RK..FWFRT...........................................
A0A077S0P4_WHEAT/59-150                ....................................................PQQVHITQ.....GD.H...E....GT..................AM..IIPWV..T...T...............................V..................E.........P..GSS.......................TVLYG.TS.....E.DN.....................................L..N.YS........A.K..G.K......HS....Q.YTF.........................................................................YKYT.S..GYIH.HCTIK....K.......L..KFDT.KYY.......Y..AV...............GTE...E-.................................-TL.RK..FWFRT...........................................
K3X8L0_PYTUL/29-130                    ..................................................sp--QFHLSL.....VG.T...S....KTda.............kvvDY..TVDWI..T...S...............................A..................D.........V..TNS.......................QLIYG.TS.....A.DA.....................................M..A.TQ........V.D..A.K.....lGG....L.VEE.........................................................................SKGE.S..VKCW.SAVVR....N.......V..APGT.TIF.......Y..AL...............ADN...AAa...............................aGSS.AP..NSFT-v..........................................
A0A0G1JVH7_9BACT/2924-3008             ............................................isnissvy--------.....--.-...N....DK..................TA..VISWI..T...S...............................E..................S.........-..ATS.......................QVEYG.IT.....D.AY.....................................G..S.ST........A.L..D.-......--....-.---.........................................................................--SL.L..TASH.AVTLI....S.......L..TPAT.TYY.......Y..RV...............KSQ...DGlq.............................naSVS.AV..QSFTT...........................................
A0A0Q9TSE2_9BACL/55-141                ............................................kgpyllfe--------.....-G.-...S....NI..................SM..SVLWQ..T...S...............................V..................T.........-..ESN.......................VIKWG.TD.....T.TY.....................................S..M.GQ........A.T..-.-......V-....-.---.........................................................................GTYG.S..ANQH.KYTIT....G.......L..QPGT.KYY.......Y..QV...............DGQ...A-.................................---.--..-----gsfltapaasatav.............................
A0A0M2JBK7_9ACTN/78-183                ....................................................PFGRHLAF.....GA.D...P....KT..................QM..RISWQ..V...P...............................F..................A.........V..RRP.......................YVRIG.LR.....P.DA.....................................L..D.RR........I.S..A.D......LR....H.LHTpgv...................................................................sgvRLAV.E..QYYV.HAAVD....G.......L..RPGT.TYY.......Y..GV...............GHD...GF.................................--D.PT..-----ssahragitsfrt..............................
Q9VZ56_DROME/38-141                    ....................................................PEQVHLSF.....GE.R...T....DS..................EI..VVTWS..T...R...............................S..................L.........P..PDQevg.................avsVVEYG.QL.....V.DGq..................................vrL..T.QQ........A.R..G.K......AT....K.FVDg.......................................................................gHKQA.T..QFIH.RVTLR....D.......L..EPNA.TYS.......Y..HC...............GSD..fG-.................................-WS.AI..FQFRT...........................................
A0A075KBC7_9FIRM/38-129                ....................................................PRNIALTF.....TG.M...P....AS..................TQ..TITWQ..T...G...............................R..................Y.........S..SGS.......................RVEYT.KV.....T.DT.....................................L..H.SV........R.E..G.T......TQ....Q.VA-.........................................................................TDRG.M..ITVH.SVQLT....D.......L..EPAT.RYQ.......Y..RV...............GDG...L-.................................FWS.SY..HTFTT...........................................
M5WZ64_PRUPE/634-742                   ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................D.........I..NEAi.....................pFVEWG.IK.....G.-E.....................................L..R.MR........A.P..A.G......TL....T.FDRssmcg..............................................................spartvGWRD.P..GFIH.TSFLK....N.......L..WPNV.VYI.......Y..RM...............GHRl.vDGs...............................fIWS.KF..YSFR-s..........................................
A0A059CLT2_EUCGR/55-146                ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...S...............................D..................E.........P..GSS.......................EVQYG.TT.....T.GK.....................................Y..D.HS........A.E..G.K......SS....S.YSF.........................................................................YKYK.S..GYIH.HCLLD....G.......L..EYDT.KYY.......Y..KV...............GSG...G-.................................-SS.RE..FWFQT...........................................
A0A090Z5Z4_PAEMA/721-832               ....................................................PKDIAMSL.....YG.D...A....KT..................TR..SFAWY..T...Syevp.......................dnapA..................N.........I..LDS.......................IVEVV.PA.....D.QD.....................................F..D.SA........A.V..M.R......--....F.VGDpketqi............................................................lknlnlgSTTG.S..FISH.KAIAT....G.......L..TAGT.AYK.......Y..RV...............GSD...G-.................................NWS.QT..GRFTT...........................................
R4K654_CLOPA/61-157                    ....................................................PIEISLTP.....GK.-...N....AS..................EL..NFAWY..S...K...............................V..................T.........E..PNP.......................KFKIG.KK.....Q.DL.....................................S..D.AK........-.E..L.S......VN....T.T--.........................................................................AAVT.G..YNSN.KATAV....G.......L..EENT.TYY.......Y..SY...............QIN...G-.................................VW-.--..-----gqatpyktqstksfsf...........................
A0A081CF39_PSEA2/33-122                ....................................................PTQTRLAF.....QQ.-...-....LN..................AV..SVAWN..T...Y...............................E..................K.........L..NQS.......................CVAYG.TS.....P.TS.....................................L..T.QR........A.C..S.S......SS....S.--T.........................................................................YPTS.R..TWFN.NVLLT....G.......L..APAT.TYY.......Y..KI...............DST...N-.................................--S.TT..NSFK-sart.......................................
G2FUL4_9FIRM/652-750                   ..............................................asdltf------AP.....GQ.-...N....AT..................EL..NFAWY..S...T...............................V..................D........sQ..NNT.......................AVQVA.KK.....E.DM.....................................T..D.SE........F.P..E.D......KA....T.TYTgt.....................................................................vsSAVT.G..FFSN.KVIVT....N.......L..EEAT.EYV.......Y..RV...............GDA...SS................................gSWS.PV..YNFKT...........................................
U4TRK2_DENPD/26-117                    ....................................................PQQVHIAF.....GD.-...N....IH..................QI..VVTWS..T...Y...............................N..................P.........T..DDS.......................IVEYG.IG.....G.--.....................................L..I.NT........A.T..G.Q......SR....L.FVDg.......................................................................gPEKH.S..QYIH.RVVLS....D.......L..APDS.RYE.......Y..HC...............GGS...D-.................................GWS.DL..FWFKT...........................................
A0A078BX53_BRANA/49-136                ....................................................PQQVHVSL.....AG.-...-....KD..................HM..RVTYI..T...D...............................D..................M.........N..VAS.......................MVEYG.KS.....P.KK.....................................Y..D.RK........T.I..G.E......ST....S.YRS.........................................................................FFYS.S..GKIH.HVKIG....P.......L..QPST.TYY.......Y..RC...............GGH...G-.................................---.KE..FSFRT...........................................
A0A0G1JVH7_9BACT/2641-2729             ...........................................isnvqsili--------.....--.-...N....ST..................TI..KITWT..T...D...............................K..................V.........-..ASS.......................QVVYA.TN.....S.GL.....................................T..G.ST........S.F..-.-......--....P.V--.........................................................................SPSD.S..DTNH.EVQIT....G.......L..TAGT.TYY.......Y..KA...............RSV...DAnn.............................ntSDS.AV..YSFTT...........................................
H2QG98_PANTR/32-125                    ....................................................PEQVHLSY.....PG.-...E....PG..................SM..TVTWT..T...W...............................V..................P.........-..TRS.......................EVQFG.LQ.....P.SG....................................pL..P.LR........A.Q..G.T......FV....P.FVDg.......................................................................gILRR.K..LYIH.RVTLR....K.......L..LPGV.QYV.......Y..RC...............GSA...Q-.................................GWS.RR..FRFR-a..........................................
I1IG28_BRADI/54-147                    ....................................................PEQVHITQ.....GD.L...T....GR..................AM..TVSWV..T...P...............................H..................H.........P..GSN.......................VVRYG.LA.....A.DN.....................................L..T.RF........A.E..G.T......VR....R.YAF........................................................................gGSYQ.S..GHIH.HATLS....G.......L..DHAT.VYH.......Y..AV...............GYG..yE-.................................-NV.RR..FSFKT...........................................
A0A067F911_CITSI/43-130                ....................................................PQQVHISL.....AG.-...-....DS..................HM..RVTWI..T...D...............................D..................E.........S..SPS.......................VVEYG.TS.....P.GG.....................................Y..N.CG........A.E..G.E......ST....S.YRY.........................................................................LFYR.S..GKIH.HTVIG....P.......L..EHDT.VYF.......Y..RC...............GRQ...G-.................................---.PE..FEFKT...........................................
F2EF31_HORVD/51-143                    ....................................................PEQVHITQ.....GD.L...T....GR..................AM..TISWV..T...P...............................E..................H.........P..GSN.......................VVRYG.LA.....A.DN.....................................L..N.LT........A.E..G.T......VQ....R.YTW........................................................................gGTYQ.S..PYIH.HATLT....G.......L..DHAT.VYH.......Y..AV...............GYG...Y-.................................-AV.RS..FSFKT...........................................
K3Y794_SETIT/48-135                    ....................................................PQQVHVSA.....VG.-...-....AT..................HM..RVSWV..T...D...............................D..................K.........R..APS.......................VVEYG.RA.....S.RN.....................................Y..T.AS........A.A..G.E......HT....S.YRY.........................................................................FLYT.S..GKIH.HVKIG....P.......L..EPGT.VYY.......Y..RC...............GMA...GK.................................EFS.--..-----lrt........................................
K7LSE2_SOYBN/217-319                   ................................................plyg----HLSS.....ID.S...T....GT..................SM..RLTWV..S...G...............................D..................K.........-..EPQ.......................QIQYG.NG.....K.TV.....................................A..S.AV........T.T..F.S......QD....-.--Dmcssal............................................................pspakdfGWHD.P..GYIH.SALMT....G.......L..KPSS.TFS.......Y..RY...............GSG...WV.................................GWS.EQ..IKFST...........................................
A0A061GNY5_THECC/56-147                ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...A...............................D..................E.........P..GPS.......................KVQYG.TS.....E.KN.....................................Y..E.FT........A.D..G.K......MT....N.YTF.........................................................................YKYN.S..GYIH.HVFVD....G.......L..EYDT.KYY.......Y..KI...............GTG...D-.................................-SA.RE..FWFQT...........................................
M9M127_PAEPP/37-137                    .................................................pvs---LGTTI.....KG.D...P....RT..................SR..AFTWH..T...A...............................S..................S.........G..SQG.......................KVQVT.EG.....A.KAdpw...............................dgeN..V.LT........F.T..A.E......SA....N.IIS.........................................................................GEGK.P..QSVH.KAEAI....G.......L..KPGT.TYV.......Y..RV...............GNG...ED................................eGWS.EP..AIFVT...........................................
A0A0X3XU29_9ACTN/49-144                ..................................................ls--GVILGV.....GA.-...D....ET..................QR..IVTWY..S...S...............................A..................D.........-..TPQ.......................QLQVA.PT.....A.TL.....................................S..D.GQ........F.P..A.D......AA....T.FAAtg....................................................................ganIASS.G..GYNR.HATIT....G.......L..KENV.AYS.......Y..RV...............GSE...G-.................................DWS.PT..YTFKT...........................................
G1RWS4_NOMLE/32-125                    ....................................................PEQVHLSY.....PG.-...E....PG..................SM..TVTWT..T...W...............................V..................P.........-..TRS.......................EVQFG.LQ.....P.SG....................................pL..P.LR........A.Q..G.T......FV....L.FVDg.......................................................................gILRR.K..LYIH.RVTLR....K.......L..LPGV.QYV.......Y..RC...............GSA...Q-.................................GWS.RR..FRFR-a..........................................
U7UE06_9FIRM/68-160                    ...................................................y-EQVSIAP.....GT.-...N....ES..................KL..NFAWY..S...K...............................E..................K.........A..DRA.......................EVRIS.RN.....E.DM....................................sK..A.KT........F.G..G.V......CQ....E.GTV.........................................................................IGGK.T..YYAN.KVEIS....G.......L..KADS.TYW.......Y..QV...............KKN...G-.................................QWQ.KA..EMIKT...........................................
D5BE73_ZUNPS/69-175                    ....................................................PDRIISNL.....TD.D...Q....AH..................TF..AVNWR..T...D...............................Q..................Y.........V..SNG.......................VVEVA.LA.....T.EGpef...............................llgD..I.RR........I.K..A.N......SQ....K.IENqn.....................................................................rnEALV.K..ATYH.SALVN....N.......L..QPNT.TYV.......Y..RV...............GNG...DKn..............................ddYWS.EW..FQIKT...........................................
A0A0D3GYD7_9ORYZ/63-163                .............................................gshltpl--------.....-D.-...P....ST..................VR..SEVWY..S...E...............................R..................P.........-..SPT.......................AAAAG.DV.....S.GH.....................................Y..P.HV........A.R..G.K......AE....V.YSQlyp..................................................................ypglLNYT.S..GAIH.HVRLR....G.......L..RPAT.RYY.......Y..RC...............GDS...SVrg.............................gaGLS.GE..LSFET...........................................
A0A0X3V4Y3_9ACTN/91-196                ....................................................PFGRHLAF.....GA.D...P....RT..................QM..RVSWQ..V...P...............................F..................A.........V..RRP.......................YLRVG.LK.....P.WD.....................................L..G.RK........I.A..A.E......VR....H.LHTpsl...................................................................sakLPAV.D..QFYL.HAALD....G.......L..RPGT.TYY.......Y..GV...............GHD...GFdpa...........................dprRFA.AV..GTFRT...........................................
V9E365_PHYPR/67-164                    ....................................................PQQIHLAF.....AG.K..kP....GT..................AM..TVSWA..T...F...............................E..................D.........V..TDS.......................SVWVG.DS.....E.DT.....................................L..E.LV........D.T..PvS......SA....S.YYS.........................................................................DKEY.N..LFHH.HAKIT....G.......L..KPRT.KYY.......Y..KV...............GSR...GDe...............................kYTS.DV..TSFNT...........................................
A0A0A0LRK5_CUCSA/60-151                ....................................................PQQVHITQ.....GD.S...E....GK..................SV..IISWV..T...P...............................D..................K.........P..GSN.......................RVVYW.AE.....N.SG.....................................I..R.NH........A.E..G.Y......FT....S.YKY.........................................................................FNYT.S..GYIH.HCTIE....N.......L..EYDT.KYF.......Y..VI...............GFG...S-.................................-LS.RR..FWFTT...........................................
A0A067GD80_CITSI/59-150                ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...P...............................H..................E.........P..GPS.......................TVSYG.TS.....A.DK.....................................F..D.FT........A.E..G.T......VN....N.YTF.........................................................................YKYK.S..GYIH.QCLVD....G.......L..EYDT.KYY.......Y..KI...............GSG...D-.................................-SS.RE..FWFQT...........................................
U5GHV9_POPTR/51-138                    ...................................................a-QQVHVSL.....VG.-...-....RD..................HM..RVTWI..T...D...............................D..................K.........H..APS.......................TVEYG.KQ.....P.GT.....................................Y..N.AM........A.T..G.D......HT....S.YRY.........................................................................FFYS.S..GKIH.HVKIG....P.......L..EPGT.TYY.......Y..RC...............GGS...G-.................................---.PE..LSFKT...........................................
A0A0C2T2K3_AMAMU/1-87                  ...................................................m--QLRLAY.....AG.-...-....PT..................GM..VVSWN..T...F...............................S..................K.........L..SRP.......................TVRYG.RE.....P.KA.....................................L..A.HT........A.F..S.T......VS....V.T--.........................................................................YPTS.L..TYNN.HVKLT....G.......L..QPNT.QYY.......Y..LP...............EYS...N-.................................-ST.VP..YTFKT...........................................
C2GEV9_9CORY/25-111                    ...............................................ttdlf-----LGV.....GS.-...D....ET..................SA..NLNWY..M...P...............................S..................K.........-..QQQ.......................KVQVK.DA.....A.GK.....................................V..T.TV........D.P..S.E......-V....T.L--.........................................................................TSTN.A..EYAA.KATLT....G.......L..APG-.-YS.......Y..RV...............GSD...ED.................................GWT.PW..YDLT-v..........................................
W9RXZ3_9ROSA/15-96                     ...............................................spldp--------.....--.-...-....--..................--..-----..-...-...............................-..................D.........S..VDS.......................VVVYG.LY.....G.HP.....................................L..T.HQ........A.T..G.Y......SL....V.YNQlyp..................................................................yeglQNYT.S..GIIH.HVRLT....G.......L..RPNT.LYQ.......Y..QC...............GDP...LQ.................................GMS.NL..YYFKT...........................................
PPA2_ARATH/145-247                     ....................................................PEQIHLSF.....TN.-...M....VN..................TM..RVMFV..A...G...............................D..................G.........-..EER.......................FVRYG.ES.....K.DL.....................................L..G.NS........A.A..A.R......GM....R.YERehmcds.............................................................panstiGWRD.P..GWIF.DTVMK....N.......L..NDGV.RYY.......Y..QV...............GSD...SK.................................GWS.EI..HS---yi.........................................
A0A061FSS3_THECC/252-355               ................................................plyg----HLSS.....MD.S...T....GT..................SM..RLTWV..S...G...............................D..................K.........-..EPQ.......................QVKYG.DG.....K.SQ.....................................T..S.DV........T.T..F.S......AD....-.--Dmcssvvv...........................................................pspakdfGWHD.P..GYIH.TAVMT....G.......L..QPSS.TCN.......Y..KY...............GSD...SV.................................GWS.DQ..IQFRT...........................................
A0A0D3VD52_9BACL/752-849               ..................................................is--KVTVTF.....NG.D...P....VS..................SK..GFAWY..T...P...............................L..................A.........S..MGS.......................DLQVV.KK.....T.DA.....................................T..P.DY........S.K..A.T......QF....T.GRSs......................................................................isTNAK.E..ELVH.KAEAT....G.......L..QADS.TYF.......F..RV...............GDE...AL................................gTWS.AT..GTFQT...........................................
R6I8M7_9FIRM/700-815                   ....................................................PSNIGTTF.....TG.D...A....ST..................ER..SINWY..T...K...............................Y..................S.........L..KNS.......................DIQIA.EY.....S.EN.....................................P..T.FT........D.K..L.P.....kGV....K.VSTaselvkreyp.....................................................gvdlgiigfiSYGI.N..VNRH.IATIT....G.......L..KPGT.KYC.......Y..RV...............GDA...KY................................gWWS.GT..G----iiet.......................................
I1FS45_AMPQE/196-298                   ....................................................PLHGHLAL.....TG.-...N....PN..................EM..RVQWT..S...G...............................T..................N.........-..KTS.......................IVVYG.TD.....P.YK.....................................L..A.LK........S.I..G.G......CT....T.YKAadmcge.............................................................paradiNFIH.P..GYFH.DVLLT....D.......L..IPDT.LYY.......Y..QY...............GST...E-.................................AMS.DV..HSFV-a..........................................
M0YS05_HORVD/47-135                    ....................................................PQQVHLSV.....VG.-...-....AN..................HM..RVSWV..T...D...............................A..................K.........H..GHS.......................VVEYG.RA.....S.GN.....................................Y..T.SS........A.T..G.E......HS....S.YRY.........................................................................YLYS.S..GKIH.HVTIG....P.......L..DPDT.VYY.......Y..RC...............GMV...G-.................................---.--..-----deftlktp...................................
A0A0D2VCQ9_GOSRA/141-245               ....................................................PEQIHLAL.....TG.-...R....EG..................EM..RVMFV..A...E...............................D..................P.........-..EER.......................QVRYG.EK.....E.GE....................................wE..G.DV........A.V..A.R......VG....R.YERedmcha.............................................................panesvGWRD.P..GWIF.DAVMS....G.......L..RGGV.KYY.......Y..QV...............GSE...SK.................................GWS.TT..RSFV-s..........................................
A0A0D9Z9N8_9ORYZ/68-155                ....................................................PQQVHISL.....AG.-...-....EK..................HM..RVTFV..T...D...............................D..................N.........S..VPS.......................VVDYG.TE.....A.GT.....................................Y..T.ST........S.Q..G.E......ST....S.YSY.........................................................................LMYS.S..GKIH.HVVIG....P.......L..NDNT.VYY.......Y..RC...............GGH...G-.................................---.PE..FQFKT...........................................
A0A0E0RKH3_ORYRU/444-538               ...................................................n-DDVHITL.....GD.Q...T....GR..................AM..TVSWV..T...P...............................K..................L.........P..DSN.......................VVRYG.LR.....A.DN.....................................L..T.HT........A.N..G.T......FR....R.YSF........................................................................gRKYR.S..GFIH.HATLT....G.......L..DYGT.KYH.......Y..AV...............GSG...DT.................................ASA.RS..FSFTT...........................................
A0A176TDZ5_9FLAO/24-110                ..............................................eikpyl--------.....QD.A...E....PT..................SI..KVMWQ..T...N...............................F..................G.........-..EES.......................IVYWG.TK.....K.NK.....................................L..K.NK........V.S..G.T......SF....D.I--.........................................................................-NFT.E..KRVH.EVAIT....G.......L..TRFT.TYF.......Y..KV...............QTG...K-.................................AVS.EV..YQFKT...........................................
A0A0A1SY42_9HYPO/34-120                ..................................................pv--QQRIAI.....NG.-...-....PN..................SI..AVSWN..T...Y...............................Q..................D.........Q..ANS.......................CVKYG.TS.....A.SK.....................................L..D.KQ........V.C..S.T......TS....K.T--.........................................................................YPTS.R..TWFH.TVSLD....G.......L..SPAT.TYY.......Y..QI...............VGG...A-.................................--S.EV..NHF--fs.........................................
M7WV37_RHOT1/45-137                    ....................................................PLQHRLAF.....AG.-...-....PT..................GM..TVSWS..T...F...............................N..................Q.........L..SNP.......................QVFYG.TD.....P.SN.....................................L..D.QQ........A.S..S.S......ES....T.T--.........................................................................YPTS.R..TYNN.HVKLT....G.......L..KPGT.KYY.......Y..KV...............SYT...NAp..............................aaAYR.PT..YSFTT...........................................
A0A162JD06_9PEZI/27-118                ...................................................t-SQVRVAY.....HG.-...-....ET..................GM..VVSWN..T...F...............................K..................Q.........L..SQP.......................TVNYG.LS.....K.DA.....................................L..T.SV........A.S..S.D......VS....-.IT-.........................................................................YPTS.L..TYNN.HVWID....G.......L..LPDT.TYY.......Y..QP...............QDLl.aNE.................................TVF.GP..YSFKT...........................................
W5HP15_WHEAT/103-194                   ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IVSWV..T...P...............................S..................E.........P..APS.......................QVFYS.KE.....E.NR.....................................Y..D.QK........A.E..G.T......MT....N.YTF.........................................................................YDYK.S..GYIH.HCLVD....G.......L..EYNT.KYY.......Y..KI...............GTG...D-.................................-SA.RE..FWFQT...........................................
A0A0G1WH45_9BACT/317-405               ...............................................isnvl------TA.....ST.-...T....AN..................GS..HVQWT..T...N...............................E..................P.........-..ATS.......................VAWYG.TS.....T.PV.....................................-..-.TT........A.N..G.V......SS....S.---.........................................................................-SSA.L..VSGH.DLTLS....G.......L..SANT.TYY.......Y..MV...............VSA...DGag.............................ntATS.SQ..YSFIT...........................................
B4F8V0_MAIZE/83-201                    ....................................................PEQIALAA.....SA.-...D....AD..................SL..WVSWV..T...Grarvgs..................snlapldP..................A.........A..AGS.......................EVWYG.ER.....S.AAda.................................asY..P.HV........V.T..G.S......AE....V.YSQlyp..................................................................ypglLNYT.S..GAIH.HVRLR....G.......L..RPAT.RYY.......Y..RC...............GDS...SLp...............................gGLS.DE..HSFTT...........................................
A2R1M4_ASPNC/70-173                    .........................................nnvnvislsyi--------.....--.-...-....PK..................GM..HIHYQ..T...P...............................F..................G........lG..QLP.......................AVRWG.KD.....P.RN.....................................L..N.ST........A.Q..G.Y......SH....T.YDRtpsc................................................................sqvkaITQC.S..QFFH.EVSID....G.......L..EPDT.TYY.......Y..QI...............PAA...NG................................tTQS.DV..LSFKT...........................................
B8ANS7_ORYSI/63-176                    ....................................................PEQIAVAL.....SA.-...A....PS..................SA..WVSWV..T...G...............................Dfqmgaa......vepldpT.........A..VAS.......................VVRYG.LA.....A.DS.....................................L..V.RR........A.T..G.D......AL....V.YSQlyp..................................................................fdglLNYT.S..AIIH.HVRLQ....G.......L..EPGT.EYF.......Y..QC...............GDP...AIp...............................aAMS.DI..HAFRT...........................................
R6SXH0_9BACE/32-130                    ...............................................wlcdm--------.....--.-...T....EN..................AV..TVVWK..T...D...............................V..................P.........-..ATG.......................WVEFT.EN.....H.GQ.....................................H..F.YS........E.E..-.H......ER....V.YDAr......................................................................fgRRLT.H..ETIH.SVRLT....G.......L..KPGT.NYM.......Y..RI...............FSQ...AL................................tG--.--..-----wgtsddarlgeiassvvy.........................
A0A061FK56_THECC/60-151                ....................................................PQQVHITQ.....GD.H...L....GK..................GV..IVSWV..T...P...............................D..................E.........P..GSN.......................LVLYW.AE.....N.SE.....................................L..K.HQ........A.E..G.I......VL....T.YKY.........................................................................FNYT.S..GYIH.HCTIT....N.......L..ESDT.KYY.......Y..EV...............GIG...N-.................................-TS.RE..FWFRT...........................................
A0A147K259_9EURY/134-220               ..................................................pt--ITSVSV.....SG.I...T....TS..................SA..TITWV..T...D...............................E..................S.........-..ATS.......................VVEYG.TS.....P.SY....................................gL..T.KS........E.N..A.-......--....-.---.........................................................................----.L..VKNH.SITLT....G.......L..SAGT.TYY.......F..RV...............KSK...DSvg.............................leNAS.AG..MTFRT...........................................
M1BDJ4_SOLTU/15-127                    ....................................................PEQIALAL.....ST.-...S....SS..................SM..WISWI..T...G...............................Eaqigln......vtphdpK.........T..VAS.......................EVWYG.KE.....S.GK.....................................Y..T.MK........Q.N..G.V......SV....V.YSQlyp..................................................................feglWNYT.S..GIIH.HVKID....G.......L..EPET.KYY.......Y..KC...............GDS...SL................................vAMS.DE..LAFET...........................................
G7Y8H2_CLOSI/37-129                    ....................................................PEQVHLAI.....GE.-...T....TS..................QL..TVTWV..T...Q...............................K..................S.........T..AAS.......................ILEYG.VK.....N.VS.....................................-..D.QR........A.Y..G.T......AS....K.FVDg.......................................................................gKEKR.V..FYIH.RVRLR....K.......L..EPNF.LYL.......Y..RC...............GDG...V-.................................VWS.DI..FQFR-v..........................................
A0A087HD53_ARAAL/61-152                ....................................................PQQVHITQ.....GD.V...E....GK..................AV..IVSWV..T...Q...............................E..................A.........P..GSN.......................TVVYW.KE.....N.SS.....................................K..K.YK........A.H..G.K......SN....T.YKY.........................................................................YNYT.S..GYIH.HCPIR....N.......L..EYDT.KYY.......Y..VV...............GVG...Q-.................................-T-.--..-----erkfwfft...................................
G4ZZW6_PHYSP/96-194                    ....................................................PQQFHLAF.....AG.K...K...aGS..................GM..TISWT..T...F...............................D..................L.........E..EDP.......................AVWIG.SS.....E.DE.....................................L..T.PV........K.D..A.Tf....eTK....S.YYK.........................................................................DKSY.S..LYSY.HAIVT....G.......L..KPNT.EYF.......Y..KV...............GSA...STk...............................kFQS.AV..SSFKT...........................................
A0A0B2QFR6_GLYSO/45-133                ....................................................PQQVHISQ.....VG.-...-....QN..................KM..RISWI..T...D...............................S..................P.........-..TPA.......................KVSYG.PS.....P.SV.....................................N..A.SS........A.I..G.T......TS....S.YRY.........................................................................LVYE.S..GEIH.NVVIG....P.......L..NPNT.VYY.......Y..RL...............GDP...P-.................................-SS.QT..YNFKT...........................................
I1R436_ORYGL/52-144                    ....................................................PQQVHISV.....VG.-...-....AN..................RM..RICWV..T...D...............................D..................Ddg.....rsS..PPS.......................VVEYG.TS.....P.GE.....................................Y..T.AS........A.T..G.D......HG....T.YSY.........................................................................SDYK.S..GAIH.HVTIG....P.......L..EPAT.TYY.......Y..RC...............GAG...E-.................................--E.--..-----eelslrt....................................
M5TC38_9PLAN/36-128                    ....................................................PAQWRVVW.....TD.D...P....AT..................TA..TVSWS..T...A...............................A..................A.........G..KSH.......................TVRFR.IK.....G.SD.....................................E..V.AS........A.Q.lA.D......SG....R.YT-.........................................................................GGES.E..LYYH.HARLT....G.......L..QPGT.AYE.......V..QM...............ISD...A-.................................DES.PV..FYFVT...........................................
G0RUS8_HYPJQ/23-113                    ...................................................n-SQIRIAY.....HG.-...-....DD..................GM..MVSWN..T...F...............................D..................H.........V..ARP.......................SVFWG.RS.....K.EH.....................................L..V.NV........A.S..S.A......VS....V.T--.........................................................................YPTS.T..TYNN.HVLIK....G.......L..KPDT.TYY.......Y..LP...............AQL...NE................................dVCY.EP..FNFTT...........................................
R0GHY0_9BRAS/54-166                    ....................................................PEQIALAL.....ST.-...T....PT..................SM..WVSWV..T...G...............................Daivgkd......vkpldpS.........S..VAS.......................EVWYG.KE.....K.GK.....................................Y..L.LK........K.I..G.N......AT....V.YNQlyp..................................................................fdglLNYT.S..GIIH.HVLID....G.......L..EPET.KYY.......Y..MC...............GDS...SV................................pAMS.EE..LSFVT...........................................
M4D9B2_BRARP/17-108                    ....................................................PQQVHITQ.....GD.L...E....GK..................AV..IVSWV..T...Q...............................K..................A.........K..GSN.......................MVLYW.KE.....H.SS.....................................K..M.LK........A.H..G.K......SK....T.YKF.........................................................................YHYT.S..GHIH.HCTIR....N.......L..EYDT.KYY.......Y..MV...............GVG...Q-.................................-TE.--..-----rkfwflt....................................
G3XQ08_ASPNA/70-173                    .........................................nnvnvislsyi--------.....--.-...-....PK..................GM..HIHYQ..T...P...............................F..................G........lG..QLP.......................AVRWG.KD.....P.RN.....................................L..N.ST........A.Q..G.Y......SH....T.YDRtpsc................................................................sqvkaITQC.S..QFFH.EVSID....G.......L..EPDT.TYY.......Y..QI...............PAA...NG................................tTQS.DV..LSFKT...........................................
T1KXV2_TETUR/32-123                    ....................................................PEQVHLSL.....GV.-...N....PS..................EM..IVTWT..T...F...............................D..................P.........I..SLP.......................SAAYG.IS.....T.LN.....................................E..T.TY........G.Y..S.T......KF....V.DGG.........................................................................SEKR.V..MYIH.RVTMN....N.......L..KPDQ.KYV.......Y..RV...............GSD...A-.................................GWS.EI..FWFKT...........................................
A0A0E0AY17_9ORYZ/177-288               ................................................pvyp----RLAQ.....GK.-...S....YD..................EM..TVTWT..S...G...............................Y..................Di.......sE..AYP.......................FVEWG.MV.....V.AGa..................................aaP..T.RT........A.A..G.T......-L....T.FNRgsmcg..............................................................epartvGWRD.P..GFIH.TAFLR....D.......L..WPNK.EYY.......Y..KI...............GHE..lSDg..............................siVWG.KQ..YTFR-a..........................................
A0A0C2ALL4_9ACTN/62-155                ...................................................v-QGLHLTF.....GA.D...P....SR..................QM..VVSWL..T...D...............................G..................P.........V..KKP.......................RVLYG.TL.....E.HG.....................................L..G.ST........A.E..A.R......TR....T.YTD........................................................................gKSGR.V..VYVH.HAALS....R.......L..SPGT.DYV.......Y..LV...............SHE...G-.................................AAP.DS..GMFTT...........................................
W5BCH6_WHEAT/47-134                    ....................................................PQQVHLSV.....VG.-...-....AN..................HM..RVSWV..T...D...............................A..................K.........H..GHS.......................VVEYG.RA.....S.GS.....................................Y..T.TS........A.T..G.E......HT....S.YRY.........................................................................YLYS.S..GKIH.HVTIG....P.......L..DPDT.VYY.......Y..RC...............GVV...G-.................................---.--..-----defalkt....................................
S0GJN4_9PORP/269-364                   ..............................................ylqnpv--------.....--.-...-....GN..................GI..TVMWQ..T...T...............................V..................P.........-..AYS.......................WVEYG.TD.....K.NQ.....................................L..K.KA........R.T..I.V......D-....-.--G.........................................................................QVIC.N..DLQN.KVRLN....D.......L..EPGK.TYY.......Y..RV...............CSQ...EImlyqay....................kkvfgetAVS.DF..HSF--tl.........................................
W4ZQQ8_WHEAT/172-285                   .................................................pvf---PRLAQ.....GK.-...T....HD..................EM..TVTWT..S...G...............................Y..................Di.......dE..AYP.......................LVEWG.MV.....A.PGgg.................................vrN..P.TR........T.P..A.G......TL....T.FNRgsmcg..............................................................epartvGWRD.P..GFIH.TAFMR....D.......L..WPNK.EYT.......Y..KI...............GHE..lSDg..............................tmVWG.KP..YTFR-a..........................................
N1S268_FUSC4/75-176                    ...........................................syipaqpgr--------.....--.-...D....TV..................GI..NIHYQ..T...P...............................F..................G........lG..RAP.......................SVHWG.TS.....H.SA.....................................L..N.NA........A.T..G.L......TV....T.YDRtppc.................................................................shvaITQC.S..QFFH.NVQIE....Q.......L..QPGT.TYF.......Y..QI...............PAA...NG................................tTPS.AV..LSFTT...........................................
A0A0D2P070_GOSRA/184-292               ................................................plyp----RLSQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Nv.......iE..AVP.......................FVEWG.MK.....G.ES.....................................Q..T.RS........P.A..G.T......LT....F.HQNdmcap...............................................................partvGWRD.P..GFIH.TSFLK....D.......L..WPSS.VYT.......Y..KL...............GHKl.vDGs...............................yVWS.KS..YSFK-s..........................................
D3BJ35_POLPA/15-114                    ....................................................PNNVNLAF.....TT.-...S....QS..................EM..RATWY..T...V...............................N..................Q.........-..TVG.......................AVRFS.SQ.....Q.FSadt..............................adsvD..M.SL........S.P..S.T......FT....E.YGE.........................................................................FPGW.S..GFVN.TAVMS....N.......L..NALQ.QYF.......Y..QV...............GDS...QQ................................nLWS.PV..YNFTT...........................................
J3NEE7_ORYBR/165-273                   ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Di.......kE..AVP.......................FVEWG.AK.....G.GPrlls.............................pagtL..-.--........-.-..-.-......--....T.FDRnsmcg..............................................................apartvGWRH.P..GYIH.TSYLK....E.......L..WPDS.LYT.......Y..RL...............GHRl.pNGt...............................hIWS.KS..YSFK-a..........................................
M1AD80_SOLTU/53-144                    ....................................................PQQVHITQ.....GD.Y...E....GK..................AV..IVSWV..T...P...............................D..................K.........P..GSS.......................EVRYG.LS.....K.GK.....................................Y..D.FT........A.K..G.S......FT....N.YTF.........................................................................YTYK.S..GYIH.KCFLN....G.......L..QYDT.KYY.......Y..EI...............GNG...D-.................................-SA.RN..FWF--et.........................................
A0A162LLJ0_9ACTN/1-94                  ....................................................---MHLTF.....GP.D...P....AT..................SM..VVSWI..T...R...............................G..................P.........V..RRP.......................RVRLR.PR.....E.CDqr................................lsaA..K.QQ........I.E..A.V......T-....-.--Rsy....................................................................vdaVTAR.E..IHTH.HALLT....G.......L..EPDT.EYH.......Y..EI...............SHQ...--.................................---.--..-----aprpgrfar..................................
E8NAG2_MICTS/48-143                    ..................................................vs--GVILGV.....GA.-...D....EA..................QR..IVTWY..S...S...............................A..................D.........-..TTQ.......................SVQVA.PT.....S.TL.....................................V..N.GA........F.P..A.S......AT....T.FSAsg....................................................................tanIATS.G..GFNR.HASIT....G.......L..AENT.AYS.......Y..RV...............GSD...G-.................................NWS.ST..YAFKT...........................................
A0A0N4TSS9_BRUPA/46-134                ....................................................PEQIALSY.....GG.-...N....VS..................AM..WITWL..T...Y...............................N..................D.........T..FSS.......................IVEYG.IN.....D.--.....................................L..R.WS........V.K..G.S......SI....L.FIDg.......................................................................gKQRS.R..RYIH.RVLLT....G.......L..IPGT.IY-.......-..--...............---...--.................................---.--..-----rtftphesksiiytf............................
K4B3L9_SOLLC/56-147                    ....................................................PQQVHITQ.....GD.H...V....GK..................AV..IVSWV..T...M...............................D..................E.........P..GSS.......................TVVYW.SE.....K.SK.....................................H..K.CK........A.S..G.K......VT....S.YTY.........................................................................YNYT.S..GYIH.HCNIK....N.......L..KFDT.KYY.......Y..KI...............GIG...H-.................................-IS.RT..FWFTT...........................................
D6CY00_9BACE/260-356                   ............................................kpylqnpv--------.....--.-...-....GN..................GI..TVMWE..T...T...............................V..................P.........-..SYC.......................WVEYG.TD.....T.TR.....................................L..E.RA........R.M..I.V......--....-.-DG.........................................................................QVVC.N..NKLH.KIRID....G.......L..QPGQ.KYY.......Y..RV...............CSQ...EM.................................---.--..-----llyqaykkvfgntaqstfseft.....................
F6HKK1_VITVI/2-80                      ..................................................vg--------.....--.-...-....AD..................KM..RITWV..T...K...............................D..................E.........-..TPA.......................EVHYG.TA.....Q.GQ.....................................L..G.SS........A.T..G.S......TR....S.YKY.........................................................................VVYT.S..GTIH.DVVIG....P.......L..NANT.VYY.......Y..RC...............GSS...G-.................................---.PE..FSFKT...........................................
D3BF43_POLPA/46-187                    ....................................................PRQINLAL.....TY.-...N....AN..................DM..LVNWI..T...K...............................D..................E.........I..TQP.......................VVYYY.IG.....D.CMwdtds...........................ddeddS..-.--........-.-..-.-......-K....S.SSSsssspssssashsksnsksn................................skaekkkrntdikmtmgttktYYPY.K..GYLH.SVKLQ....H.......L..SSGV.GYC.......Y..RV...............GGN...FVpta...........................datSWS.KW..RSFRT...........................................
A0A089ICS5_9BACL/753-850               ..................................................ik--KVTVTF.....NG.D...P....VS..................AK..GFTWY..T...A...............................L..................K.........S..AGS.......................DLQVV.EN.....T.GVt..................................pdF..T.KA........A.E..F.T......GR....S.AVS.........................................................................RNSK.D..ELVH.KAEAS....G.......L..KADT.KYY.......F..RV...............GDK...AL................................gLWS.AV..GTFET...........................................
B4FKP7_MAIZE/52-139                    ....................................................PQQVHVSA.....VG.-...-....EK..................HV..RVSWV..T...D...............................D..................M.........R..AQS.......................VVDYG.KA.....S.RN.....................................Y..T.AS........A.T..G.E......HT....S.YRY.........................................................................FLYS.S..GKIH.HVSIG....P.......L..EPST.VYY.......Y..RC...............GKA...GK.................................EFS.--..-----lrt........................................
A0A078H7E5_BRANA/145-248               ....................................................PEQIHLAF.....ED.-...K....VN..................RM..RVTFV..A...G...............................D..................G.........-..EER.......................FVRYG.EG.....K.DA.....................................L..A.NS........A.A..A.R......GI....R.YERehmcna.............................................................panstvGWRD.P..GWIF.HTVMK....N.......L..NGGV.RYY.......Y..QV...............GSD...SK.................................GWS.EI..HSF--ia.........................................
A0A0G1U7N1_9BACT/206-292               ..............................................ptkisn-----VTA.....VA.L...S....PT..................KV..LVSWT..T...N...............................H..................P.........-..ANG.......................KVNWG.YD.....D.GI.....................................Y..E.FE........N.Q..-.-......--....-.---.........................................................................-TDK.R..TSKH.EFVLE....N.......L..KPDT.EYH.......Y..EV...............MSQ...NRn...............................yVYD.AN..RKFKT...........................................
A0A024TEA4_9STRA/129-242               ....................................................PQHGHLAL.....ND.-...R....VD..................QM..VLMYN..T...A...............................S..................N.........R..TTP.......................SVRAT.RV.....A.DPpfd..............................svaaP..V.TV........H.Y..G.T......SS....T.YTAsdmchqp...........................................................ativgqqWFRH.P..GYMH.TVVID....G.......L..FPDC.MYA.......Y..QF...............GND...MD.................................GWS.EI..YTFR-s..........................................
M1D1Z7_SOLTU/56-147                    ....................................................PQQVHITQ.....GD.H...V....GK..................AL..IVSWV..T...M...............................D..................E.........P..GSS.......................TVVYW.SE.....K.SK.....................................L..K.NK........A.N..G.K......VT....T.YKF.........................................................................YNYT.S..GYIH.HCTIE....H.......L..KFDT.IYY.......Y..KI...............GIG...H-.................................-VA.RT..FWFVT...........................................
D2RNV9_ACIFV/60-153                    ..................................................ar--NIRQVM.....TA.D...P....AH..................SR..VIMWQ..S...D...............................Y..................A.........V..KEP.......................VLEYR.ME.....G.KE.....................................N..G.ET........V.P..V.Q......AE....K.FT-.........................................................................DGGK.N..TWIY.RARIS....G.......L..EPGQ.TYG.......Y..RI...............RDG...KK.................................-AT.AW..MS---lkafa......................................
D0NUG4_PHYIT/1-83                      ....................................................--------.....--.-...-....--..................-M..AVSWT..T...F...............................E..................L.........D..KDP.......................TVWLS.RT.....K.SK.....................................L..K.IV........V.N..A.E......IE....T.KSYy.......................................................................kDKTY.E..LYSY.HAVVG....G.......L..KANT.EYF.......Y..KV...............GNA...DNe...............................hFQS.GE..SSFTT...........................................
A0A0D2ZV86_BRAOL/60-151                ....................................................PQQVHITQ.....GN.H...E....GN..................GV..IISWV..T...P...............................S..................A.........P..GSN.......................TVRYW.SE.....N.GK.....................................S..K.KL........A.E..A.T......MN....T.YRF.........................................................................FNYT.S..GYIH.HCLID....D.......L..EFDM.KYY.......Y..EI...............GSG...K-.................................-WQ.RR..FWFFT...........................................
B4JMN6_DROGR/2-89                      ..............................................ptqtvl--------.....--.-...-....--..................DI..VVTWN..T...R...............................N..................N.........T..NDS.......................ICEYG.ID.....A.IDe...................................hI..A.KS........P.Q..G.P......NK....F.VDG........................................................................gAQKA.T..QYIH.RVTLA....Q.......L..QANT.TYR.......Y..HC...............GSQ...L-.................................GWS.AI..YWFRT...........................................
A0A078CPY0_BRANA/43-131                ....................................................PEQVHISL.....VG.-...-....PD..................KM..RISWI..T...K...............................N..................S.........-..VMP.......................TVVYG.TT.....S.GK.....................................Y..E.GS........A.N..G.T......SS....S.YHY.........................................................................LIYR.S..GQIN.DVVIG....P.......L..KLNT.VYY.......Y..KC...............GGQ...S-.................................-ST.QE..FNFKT...........................................
W2PUE4_PHYPN/1-82                      ....................................................--------.....--.-...-....--..................-M..TVSWA..T...F...............................E..................D.........V..SDS.......................SVWVG.SS.....E.DS.....................................L..E.LV........D.T..P.V.....sSD....S.YYS.........................................................................DDEY.N..LFHH.HATIT....G.......L..KPRT.KYF.......Y..KV...............GSR...GDe...............................kYTS.DV..SSFIT...........................................
R6PJ75_9CLOT/19-110                    ....................................................PDHIMLSF.....WG.D...A....KT..................ST..AISWR..T...D...............................E..................N.........S..GDS.......................YILYR.RE.....G.SA.....................................D..L.LR........Q.E..A.V......TR....S.AE-.........................................................................TDID.R..SNYH.WVRLS....G.......L..EPGC.KYC.......Y..TV...............GDD...E-.................................HRS.GE..FTFET...........................................
A0A0P0VUV1_ORYSJ/41-149                ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...Gy.............................gT..................N.........E..ATP.......................FVKWG.LQ.....G.QI.....................................Q..S.LS........P.A..G.T......L-....T.FSRstmcg..............................................................ppartvGWRD.P..GFIH.TSFLK....D.......L..WPNF.KYT.......Y..RI...............GHR..lSDg..............................siIWG.HE..YSFQ-a..........................................
J3NFB3_ORYBR/53-144                    ....................................................PQQVHITL.....GD.Q...T....GT..................AM..TVSWV..T...A...............................N..................E.........E..GSS.......................TVRYG.RS.....A.EK.....................................L..E.QA........A.E..G.R......HA....R.YDY.........................................................................FNYT.S..GFIH.HCTLT....G.......L..SHAT.KYY.......Y..AM...............GFG...H-.................................-TV.RT..FSFTT...........................................
A0A096RFT2_MAIZE/67-158                ....................................................PEQVHITQ.....GN.H...D....GT..................AM..IISWV..T...T...............................S..................E.........P..GSS.......................TVIYG.TS.....E.DN.....................................L..N.YT........A.N..G.K......HT....Q.YTF.........................................................................YNYT.S..GYIH.HCTIK....K.......L..EFDT.KYY.......Y..AV...............GIG...Q-.................................---.--..-----tvrkfwflt..................................
F9Z3J6_ODOSD/33-129                    ..............................................pclqsl--------.....--.-...T....GN..................GI..TVSWL..T...H...............................V..................P.........-..VYS.......................WVEYG.TD.....T.LE.....................................L..K.KA........R.T..M.-......--....-.LDG.........................................................................QVVC.N..NYIH.KIRLE....N.......L..EAGE.TYY.......Y..RV...............CSR...EIlkygay....................skifghtAVS.PF..YSFR-v..........................................
I1I8W6_BRADI/173-285                   .................................................pvf---PRLAQ.....GK.-...S....HD..................EM..TVTWT..S...G...............................Y..................Di.......gE..AYP.......................FVEWG.MV.....G.KNp..................................tpT..P.RR........T.P..A.G......TL....T.FSRgsmcg..............................................................epartvGWRD.P..GFIH.TAFMR....D.......L..WPNK.DYI.......Y..KV...............GHEl.lDGt...............................vVWG.KP..YSFR-a..........................................
A0A0J7Z6M1_STRVR/80-185                ....................................................PFGRHLAY.....GN.D...P....RT..................EM..TISWQ..V...P...............................V..................A.........V..KKP.......................FIRIG.AH.....P.WD.....................................L..S.RK........I.E..A.E......VR....T.LYTpag...................................................................vgaSADH.T..QYYV.HARLT....H.......L..RPGR.TYY.......Y..GV...............GHA...G-.................................---.--..-----fdpaephllgtlgtftt..........................
K1RZH9_CRAGI/3-74                      ......................................asttsgrryakffg--------.....--.-...-....--..................--..-----..-...-...............................-..................-.........-..---.......................-----.--.....-.SN.....................................L..S.QQ........A.K..G.Y......TT....K.FVDg.......................................................................gTEQH.T..QYIH.RVVLS....Q.......L..QPGK.KHM.......Y..QC...............GNG...K-.................................TFS.KI..FNFK-a..........................................
A0A0U2N9Q7_9BACL/1076-1175             ....................................................PYNVNVNM.....GA.D...P....KS..................SR..GFTWH..T...H...............................P..................S.........V..QTT.......................VVELA.KK.....E.GFtgf...............................dgpN..V.IK........V.T..G.E......NS....L.FVT.........................................................................YDLG.T..VRVH.KAAVS....G.......L..EPGT.EYV.......Y..RV...............GDG...AS.................................HYS.AQ..GSFAT...........................................
A0A0B5DD86_9ACTN/48-143                ..................................................lt--GIILGV.....GA.-...N....ES..................QR..TVTWY..S...S...............................A..................D.........-..TAQ.......................KVQLA.PT.....A.QL.....................................V..N.GE........F.P..A.G......AA....T.FDAig....................................................................genIATS.G..GYNR.HATLT....G.......L..KEHT.QYS.......Y..RV...............GSE...G-.................................NWS.SA..YSFKT...........................................
A0A090II36_9GAMM/225-311               .................................................vqi---THLSV.....IE.R...G....DE..................SA..TLSWR..T...N...............................K..................P.........-..TTG.......................MVKYG.LT.....E.DL.....................................E..E.DS........I.T..L.-......--....-.---.........................................................................---P.L..AKEH.QVTIN....N.......L..NNDT.HYF.......Y..RV...............EAN...VDpk.............................dtIQS.KM..QSFDT...........................................
A0A0G1D050_9BACT/43-128                ................................................pkdi----RISN.....I-.-...D....NS..................SA..TISWI..T...D...............................K..................E.........-..TFS.......................FVSWG.EG.....Q.TS.....................................L..N.KI........E.R..-.-......--....-.---.........................................................................EGNE.K..LSIH.TISLT....G.......L..KPGT.KYF.......Y..KI...............NSG...GT.................................---.--..-----mfdnkgipwqfst..............................
D8TBR4_SELML/77-168                    ....................................................PEQVHITQ.....GS.V...T....AD..................SM..IVSWV..T...P...............................S..................Q.........P..GSL.......................AVSFG.NE.....T.AK.....................................Y..S.RT........A.T..G.N......IT....T.YKY.........................................................................ANYT.S..GYIH.HVKLT....N.......L..EYAT.KYY.......Y..RL...............GDG...E-.................................-CA.RQ..FWFV-t..........................................
A0A0L8H5I1_OCTBM/1-84                  ...................................................m--------.....--.-...-....--..................--..---WS..S...V...............................V..................N.........-..CSS.......................SVKYG.DT.....M.WN.....................................K..N.YK........A.E..P.T......TV....F.FNL.........................................................................TNSLaR..HYYY.HAVLK....N.......L..KPNA.TYY.......Y..SI...............VNS...K-.................................-MV.TP..AYFKTppkgnewsps.................................
ACP7_HUMAN/32-125                      ....................................................PEQVHLSY.....PG.-...E....PG..................SM..TVTWT..T...W...............................V..................P.........-..TRS.......................EVQFG.LQ.....P.SG....................................pL..P.LR........A.Q..G.T......FV....P.FVDg.......................................................................gILRR.K..LYIH.RVTLR....K.......L..LPGV.QYV.......Y..RC...............GSA...Q-.................................GWS.RR..FRFR-a..........................................
K0C6Y0_ALCDB/1124-1217                 ....................................................PRHLYLTP.....GS.-...D....GT..................QV..NVTWY..T...S...............................T..................D.........V..SAS.......................EVAYG.TG.....S.LN.....................................Q..T.AT........G.E..S.E......IL....P.FFY........................................................................gSEAG.V..VRVH.HVALD....N.......L..TPGT.TYR.......Y..RV...............GDG...AG.................................NQS.AE..FSFTT...........................................
A0A0M2VT08_9BACL/1076-1175             ....................................................PYNINVNM.....GE.D...P....TV..................SR..GFAWH..T...H...............................P..................D.........V..EQT.......................VVEIA.KQ.....S.GFtdf...............................dgpD..V.KT........I.S..G.D......SY....L.YHT.........................................................................LDLG.T..IRVH.KALAS....D.......L..EPGT.AYV.......Y..RV...............GDE...KG.................................NYG.PK..GTFRT...........................................
K7H7C8_CAEJA/22-105                    ....................................................PEQVHLAF.....YT.-...G....PW..................DI..SVSWI..T...F...............................D..................T.........-..AEP.......................VLSYG.TS.....S.SS.....................................M..Q.-N........V.T..G.T......TN....T.WVF.........................................................................-EGI.T..RHSH.AVILK....N.......L..EPSN.QYY.......Y..KI...............EN-...--.................................---.--..-----rlfnfrt....................................
I1R438_ORYGL/55-142                    ....................................................PQQVHISA.....VG.-...-....SD..................KM..RVTWI..T...D...............................D..................D.........-..APA.......................TVEYG.TV.....S.GE.....................................Y..P.FS........A.A..G.N......TT....T.YSY.........................................................................VLYH.S..GNIH.DVVIG....P.......L..KPST.TYF.......Y..RC...............SND...T-.................................--S.RE..LSFRT...........................................
W5N439_LEPOC/28-121                    ....................................................PEQVHISY.....PG.-...V....PQ..................SM..VITWT..T...F...............................D..................K.........-..AES.......................WVEYG.VW.....G.GK.....................................L.fE.LT........A.K..G.S......YT....L.FEDg.......................................................................gKEKR.K..LHIH.RVTLT....D.......L..KPGS.TYV.......Y..HC...............GSS...D-.................................GWS.EM..FYFT-a..........................................
A0A067FSP1_CITSI/169-277               ...............................................pvypr-----LAQ.....GK.-...V....WN..................EM..TVTWT..S...G...............................Y..................Gi.......nE..AEP.......................FVEWG.PK.....G.GD.....................................R..T.YS........P.A..G.T......LT....-.FGRgsmcg..............................................................apartvGWRD.P..GYIH.TGFLR....E.......L..WPNA.MYT.......Y..KL...............GHRl.fNGt...............................yIWS.SE..YQFK-a..........................................
A0A0D2E4L5_9EURO/69-172                .................................................tnn---VNVVQ.....LS.Y...L....PN..................GI..NIHYQ..T...P...............................F..................G........lG..ELP.......................TVMWG.TS.....A.GK.....................................L..S.NK........T.Q..G.H......TH....T.YDRtppc.................................................................slvaVTQC.S..QFFH.EVQIK....G.......L..TAGT.TYY.......Y..QI...............PAA...NG................................tTTS.PV..MKFTT...........................................
J0DZ43_LOALO/1-78                      ....................................................--------.....--.-...-....--..................-M..WITWL..T...Y...............................N..................D.........T..FSS.......................VVEYG.IS.....D.--.....................................L..Q.WS........V.K..G.N......ST....L.FIDg.......................................................................gEQKS.R..RYIH.RVLLT....D.......L..IPGT.IYQ.......Y..HV...............GSQ...Y-.................................GWS.SI..YRFK-a..........................................
V4PJ70_9CAUL/53-154                    ....................................................PERIILNL.....TN.D...P....QH..................EM..AVTWR..T...S...............................A..................D.........R..PAG.......................RVQYA.VS.....E.PG.....................................P..N.FV........K.N..T.R......EV....M.AKSdvlt................................................................ldveeQAGF.K..ARYN.SLVLT....G.......L..EPST.RYI.......Y..RV...............GDG...T-.................................NWS.EW..FQFST...........................................
A0A0J1CTG6_9BURK/54-151                ....................................................PEQIHLTW.....GN.E...P....AT..................EI..VISWA..S...L...............................A..................A.........A..VNP.......................RVRFG.RA.....G.ET.....................................-..K.AT........V.H..G.I......QR....T.YTD........................................................................gLNGE.I..VCTY.HARLR....G.......L..KPGT.HYE.......Y..EV...............TAD...NDsn............................aahPFS.AT..F----qta........................................
D3BN02_POLPA/144-247                   ....................................................PEKPYLAF.....TN.-...S....TT..................EM..RLKWI..S...G...............................C..................S.........-..DVP.......................IVNYG.LS.....S.NN.....................................L..N.MV........A.K..G.T......VG....T.YSMnqmcng.............................................................pandpnYFRD.P..GFIQ.DVVMV....G.......L..TEST.QYF.......Y..NF...............GSE...QS.................................GFS.DI..YSFV-s..........................................
R7S961_TREMS/71-175                    ..............................................tnninv------IS.....MA.Y...M....PN..................GM..HIHFQ..T...P...............................F..................G........iG..GEP.......................CVNWG.TS.....I.GT.....................................L..D.QT........T.K..G.W......TR....T.YDRtpsc................................................................sevdaVTQC.S..EFFH.EVSIT....G.......L..QPAT.QYF.......Y..QI...............PGG...NG................................tTPS.PV..MTFTT...........................................
G9N7D3_HYPVG/66-169                    .........................................tnnvnvisisy--------.....--.-...V....PN..................GI..NIHYQ..T...P...............................F..................G........lG..EAP.......................SVVWG.TS.....A.SD.....................................L..S.NT........A.T..G.K......SV....T.YGRtpsc.................................................................slvvTTQC.S..EFFH.DVQIG....N.......L..KPGT.TYY.......Y..QI...............PAA...NG................................tTAS.DV..LSFKT...........................................
A0A183QH72_9TREM/30-137                peqvhialggkatinykyymgyarkyrefnctlxxxxxxxxxxxxxxxxxxx--------.....--.-...-....--..................--..-----..-...-...............................-..................-.........-..---.......................-----.--.....-.--.....................................L..N.MK........S.T..G.Y......V-....-.--Kefi...................................................................dggREQR.K..MYVH.RVILS....D.......L..IAGT.IYY.......Y..KC...............GSL...D-.................................GWS.DV..LNFR-a..........................................
A0A0P0XNU8_ORYSJ/186-294               ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Di.......kE..AYP.......................FVEWG.MK.....W.SP.....................................P..T.RT........A.A..G.T......V-....T.FDReslcg..............................................................epartvGWRD.P..GFIH.TAFLT....D.......L..WPNK.EYY.......Y..KI...............GHMl.pDGk...............................iVWG.KF..YSFK-a..........................................
A0A0D9WUQ9_9ORYZ/146-252               ....................................................PGQVHLSF.....AD.-...G....VD..................EM..RVLFV..C...G...............................D..................G.........-..GKR.......................VVRYG.LE.....K.GEe..................................ggN..W.KE........V.A..T.E......VR....T.YEQkhmcds.............................................................panssvGWRD.P..GFVF.DGLMK....G.......L..EPGR.RYF.......Y..KV...............GSD...SG.................................GWS.DT..YSF--is.........................................
G0T435_SOYBN/60-151                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IVSWV..T...P...............................D..................E.........P..GTR.......................HVQYG.TS.....K.DK.....................................F..K.TS........A.E..G.T......VA....N.YTF.........................................................................YNYK.S..GYIH.HCLIE....G.......L..EYKT.KYY.......Y..RI...............GSG...D-.................................-SA.RD..FW---fet........................................
V4UHD2_9ROSI/43-130                    ....................................................PQQVHISL.....AG.-...-....DS..................HM..RVTWI..T...D...............................D..................E.........S..SPS.......................VVEYG.TS.....P.GG.....................................Y..N.CG........A.E..G.E......ST....S.YRY.........................................................................LFYR.S..GKIH.HTVIG....P.......L..EHDT.VYF.......Y..RC...............GRQ...G-.................................---.PE..FEFKT...........................................
S2Y8N8_9BACL/986-1091                  .................................................ikn---ILSTP.....TS.D...P....HK..................GK..GFTWM..S...S...............................P.................lA.........K..EKP.......................VIQFA.RK.....K.DFdkkge..........................rsletiD..-.--........-.-..-.-......--....-.--Gsstnqv............................................................fsgeqdpTKNG.I..VRVN.EVTLK....K.......L..QQGT.TYV.......Y..RV...............GDG...E-.................................NWS.EL..QEFTT...........................................
M1AWF5_SOLTU/165-273                   ................................................plyp----RLAL.....GK.-...L....WN..................EM..TLTWT..S...G...............................Y..................Nl.......lE..AVP.......................FIEWG.RK.....G.DP.....................................Q..H.RS........P.A..G.T......-L....T.FDRntmcg..............................................................ppartvGWRD.P..GFIH.TSFMK....D.......L..WPST.LYT.......Y..KM...............GHMl.sNGs...............................yVWS.KM..YSFR-s..........................................
A0A0D9XPN9_9ORYZ/81-170                ....................................................PQQVHISL.....AG.-...-....EK..................HM..RITFV..T...D...............................D..................N.........S..VPS.......................VVDYG.IE.....A.GT.....................................Y..T.ST........S.Q..G.E......ST....S.YSY.........................................................................LMYS.S..GKIH.HVVIG....P.......L..NDNT.VYY.......Y..RC...............GGH...G-.................................---.--..-----pefqlktpp..................................
A0A0B7N9E8_9FUNG/59-156                ....................................................PQQIHISW.....IS.-...N....GK..................AT..RIQFS..T...M...............................A..................S.........V..DES.......................RLQYW.SD.....S.DN.....................................Q..D.DI........N.E..G.L......DW....E.FVDg.......................................................................gIAKH.S..QFMH.TFITK....E.......L..APST.VYK.......Y..KV...............ETT...KDd..............................qvYTS.KT..YEFHT...........................................
U5FF77_POPTR/63-154                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...P...............................D..................E.........P..GSI.......................SVKYG.TS.....E.NS.....................................Y..D.FS........A.E..G.T......VT....N.YTF.........................................................................YKYK.S..GYIH.HCLVD....G.......L..EYDS.KYY.......Y..KI...............GEG...D-.................................-SS.RV..FWFQT...........................................
A0A0G1D637_9BACT/323-413               ..............................................lpiidi--------.....--.-...T....ST..................TA..TFAWK..T...D...............................K..................P.........-..SNS.......................LVAIV.PV.....G.LY.....................................K..S.TA........V.E..P.Y......II....E.TG-.........................................................................NSRE.L..VTDH.TVTVT....E.......L..RPDA.AYH.......Y..QI...............RSQ...GSlg.............................lvAKS.RD..YEFKT...........................................
A0A059BLE4_EUCGR/1-75                  ....................................................--------.....--.-...-....--..................-M..RISWV..T...D...............................G..................K.........S..SPS.......................YVEYG.TS.....P.GR.....................................Y..D.ST........A.Q..G.E......ST....S.YSY.........................................................................LFYS.S..GKIH.HTVIG....P.......L..ESNT.VYF.......Y..RC...............GGE...G-.................................---.--..-----pefqlkt....................................
A0A0E0P3W6_ORYRU/63-176                ....................................................PEQIAVAL.....SA.-...A....PS..................SA..WVSWV..T...G...............................Dfqmgaa......vepldpT.........A..VAS.......................VVRYG.LA.....A.DS.....................................L..V.RR........A.T..G.D......AL....V.YSQlyp..................................................................fdglLNYT.S..AIIH.HVRLQ....G.......L..EPGT.EYF.......Y..QC...............GDP...AIp...............................aAMS.DI..HAFRT...........................................
K9B9F6_9STAP/72-224                    ....................................................PNRIIANF.....NG.D...T....KS..................QM..GFSWY..T...T...............................D..................Q.........F..KDA.......................KVWVS.KS.....K.DFs..................................daK..E.FD........A.E..S.K......EV....T.SNYverdkhgniifadvkkddegnpveddkg.................nkvingyytdknakgpewtsgdmhgdvkTTKE.K..EYTY.KAKAE....G.......L..DPNT.EYY.......Y..RV...............GSE...NG.................................PKS.EV..GTFKT...........................................
A0A1B6PD28_SORBI/64-157                ....................................................PQQVHITL.....GD.Q...E....GT..................AM..TVSWV..T...A...............................S..................E.........L..GNS.......................TVKFG.EK.....P.DPe...................................kM..E.RR........A.E..G.T......HT....R.YDY.........................................................................FNYT.S..GFIH.HCTLK....H.......L..KHST.KYY.......Y..AM...............GFG...H-.................................-TV.RT..FSFTT...........................................
A0A067LF84_JATCU/46-133                ....................................................PQQVHISL.....AG.-...-....KD..................HM..RVSWV..T...E...............................N..................K.........H..VRS.......................NVEYG.KE.....P.GK.....................................Y..N.EM........A.T..G.E......NT....S.YRY.........................................................................FFYS.S..GRIH.HVKIG....P.......L..EPNT.TYY.......Y..RC...............GGS...G-.................................---.PE..FSFRT...........................................
T0HMP1_9SPHN/40-140                    ....................................................PERVILNL.....TA.D...P....AT..................EM..AVTWR..S...A...............................P..................G.........-..HAG.......................QVQYA.KA.....T.NSpdf..............................vkapL..-.--........-.-..-.-......SV....A.AKTddat................................................................lavreDPAF.R..AAYH.SAVLT....G.......L..EPDT.VYA.......Y..RV...............GDG...A-.................................QWS.EW..FQFRT...........................................
I1QLK5_ORYGL/177-288                   ................................................pvyp----RLAQ.....GK.-...S....YD..................EM..TVTWT..S...G...............................Y..................Di.......sE..AYP.......................FVEWG.MV.....V.AGa..................................aaP..T.RT........A.A..G.T......-L....T.FNRgsmcg..............................................................epartvGWRD.P..GFIH.TAFLR....D.......L..WPNK.EYY.......Y..KI...............GHE..lSDg..............................siVWG.KQ..YTFR-a..........................................
N4UGE1_FUSC1/75-176                    ...........................................syipaqpgr--------.....--.-...D....TV..................GI..NIHYQ..T...P...............................F..................G........lG..RAP.......................SVHWG.TS.....H.SA.....................................L..N.NA........A.T..G.L......TV....T.YDRtppc.................................................................shvaVTQC.S..QFFH.NVQIE....Q.......L..QPGT.TYF.......Y..QI...............PAA...NG................................tTPS.AV..LSFTT...........................................
R5T6U2_9FIRM/41-133                    .................................................pis---VRQLV.....AA.D...N....EH..................NR..TIMFQ..L...L...............................K..................S.........-..VEA.......................FVEYR.EK.....G.ND.....................................R..I.FS........V.P..A.K......GV....V.LKG........................................................................nNGIT.D..SYIY.TAELK....D.......L..KKGT.AYE.......Y..RT...............RTG...N-.................................TVS.GW..MDFRT...........................................
A0A101NVP0_9ACTN/56-149                ..................................................va--GLHLQF.....GS.D...A....SR..................EV..VISWH..S...T...............................A..................S.........V..SRP.......................RVLLG.TP.....A.GG.....................................L..G.RT........V.A..A.Q......TT....T.YRD........................................................................aKSGT.E..VQVH.HARVR....G.......L..RADT.DYV.......Y..AA...............VHD...G-.................................AQA.EF..GTVRT...........................................
A0A0E0BUF2_9ORYZ/173-281               ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Si.......kE..AIP.......................FVEWG.HK.....G.GN.....................................Q..M.LS........P.A..G.T......L-....T.FSRnsmcg..............................................................spartvGWRD.P..GYIH.TSFLK....E.......L..WPDS.LYT.......Y..RL...............GHRl.lDGt...............................hIWS.KS..YSFR-a..........................................
B9SXP6_RICCO/60-151                    ....................................................PQQVHITQ.....GD.Y...N....GK..................AV..IISWV..T...P...............................D..................E.........P..GSS.......................KVQYG.VS.....E.NK.....................................Y..D.FI........A.E..G.T......AR....N.YTF.........................................................................YQYK.S..GYIH.QCLID....D.......L..EYDT.KYY.......Y..KI...............GDG...D-.................................-SS.RE..FYFQT...........................................
X6NTD5_RETFI/24-174                    .................................pmhahisvvnpvnnkavtn--------.....--.-...-....DF..................AI..QVMWV..Q...K...............................A..................W.........-..QNP.......................VVKYG.TS.....A.SDldn...............................sisY..N.NG........A.N..G.Y......IT....T.YTPsmlcdtq..........................................................ygqpaalgGWFD.P..GYFI.NILLQ....G.......L..KSDT.TYF.......Y..QL...............KKK...KKrrv..........................fqktK--.--..-----kkklcpfaffffflrrvgessygwtnifnftt...........
R6MVT1_9BACE/45-136                    ....................................................PGRVLLTF.....GD.E...N....EL..................SR..NISWQ..Y...D...............................S..................I.........V..VPS.......................HVDLV.DT.....L.SK.....................................D..T.IQ........I.E..A.Q......GE....T.FRS.........................................................................-RNG.I..AAYY.VAKLR....S.......L..HPDR.YYT.......Y..RV...............CNE...D-.................................KAS.PW..YSFRT...........................................
Q0AVG7_SYNWW/44-137                    ....................................................PDHIMLSW.....TD.D...P....QT..................TR..TMAWR..S...D...............................S..................A.........A..DQE.......................WVQYL.PA.....A.NY.....................................N..G.SF........T.S..A.S......RV....A.AVK.........................................................................TELY.T..GYSHcEATLF....Q.......L..APDC.KYI.......Y..RV...............GRE...G-.................................VWS.EP..ASFST...........................................
A0A0D2V8Z6_GOSRA/1-76                  ....................................................--------.....--.-...-....--..................--..MVSWV..T...A...............................D..................K.........P..GSS.......................RVQYG.TS.....E.KK.....................................Y..D.FK........A.D..G.T......VA....N.YTF.........................................................................YNYK.S..GYIH.HCLVD....G.......L..EYET.KYY.......Y..KI...............GEG...H-.................................-SS.RE..FWFQT...........................................
J0N5M6_9CLOT/56-152                    ...................................................y-QQVSLTP.....GK.-...N....ET..................EL..NLGWY..S...K...............................T..................G........tT..ATP.......................VVRLA.TK.....E.DM.....................................S.dA.KT........F.T..G.T......TS....-.---.........................................................................PAID.G..YISN.KVTVS....G.......L..KENS.TYY.......Y..TY...............QVN...GV.................................---.--..-----esnpvkyatksfssfk...........................
J3N632_ORYBR/1-75                      ....................................................--------.....--.-...-....--..................-M..RVTWI..T...G...............................D..................D.........-..APA.......................TVEYG.TT.....S.GQ.....................................Y..P.FS........A.T..G.S......TD....T.YSY.........................................................................VLYH.S..GKIH.DVVIG....P.......L..KPST.TYY.......Y..RC...............SND...T-.................................--S.RE..FSFRT...........................................
B1BZV7_9FIRM/238-330                   .................................................qka---LNLTV.....GK.-...D....ET..................EM..NLTWY..A...N...............................T..................S.........-..EIG.......................TVEYA.KA.....S.ED.....................................G..E.FP........S.E..F.T......TV....N.ATGn.......................................................................qSNDN.G..FYYN.QATLT....N.......L..EENT.KYV.......Y..RL...............VND...D-.................................TVS.KT..YEFTT...........................................
I1IUC5_BRADI/135-226                   ....................................................PQQVHISI.....VG.-...-....TN..................HM..RISWV..T...D...............................D..................R.........S..APS.......................VVHYG.TS.....R.SN.....................................Y..T.SS........A.T..G.S......HT....T.YRY.........................................................................FLYK.S..GAIH.HATIG....P.......L..SPGT.VYY.......Y..RC...............GDA...GD.................................---.--..-----eftlrtppss.................................
A0A072VQW8_MEDTR/56-148                ....................................................PQQVHITQ.....GD.L...V....GK..................EV..IVSWV..T...E...............................D..................E.........P..GSI.......................AVRYW.ST.....D.NS....................................kQ..K.KL........A.K..G.K......IV....T.YRF.........................................................................FNYS.S..GFIH.HTTIR....N.......L..EYNT.KYY.......Y..EV...............GLG...N-.................................-TT.RQ..FWF--it.........................................
A0A0L0LAW7_9BACT/153-239               ...............................................visli------SS.....GT.P...S....DT..................SA..TVTWT..T...N...............................E..................A.........-..ADS.......................QLAYG.TT.....A.SY.....................................G..A.TT........T.-..-.-......--....-.---.........................................................................LDAT.L..VTSH.SVGLT....G.......L..TAAT.TYH.......F..RI...............RTA...DGsg.............................naTFS.SD..QTFTT...........................................
A0A094ERD0_9PEZI/39-130                ...................................................n-SQVRLAY.....AG.-...-....PN..................GM..VVSWN..T...F...............................D..................K.........V..ARP.......................TVKYG.TS.....P.QR.....................................L..I.YC........A.E..S.T......VS....V.T--.........................................................................YDTS.L..TYNN.HVPLK....G.......L..KPDT.LYY.......Y..LPep...........llKDD...S-.................................-TT.VP..YSFRT...........................................
A0A0E0MCI6_ORYPU/139-227               ....................................................PQQVHISI.....VG.-...-....EK..................NM..RISWV..T...D...............................D..................L.........N..APS.......................VVEYG.TS.....P.GK.....................................Y..T.AS........A.T..G.D......HT....T.YRY.........................................................................FFYK.S..GAIH.HVTIG....P.......L..DAST.TYY.......Y..RC...............GKA...GD.................................---.--..-----eftlrtp....................................
A0A1B6PF13_SORBI/73-166                ....................................................PQQVHIGL.....AD.Q...T....GT..................SM..FVSWV..T...V...............................E..................A.........E..GNS.......................TVLYG.LA.....A.DK.....................................L..D.LA........A.E..G.T......IT....R.YTY.........................................................................YNYT.S..GYIH.HATLT....N.......L..QHGT.RYH.......Y..AV...............GVG...VG.................................DTV.RA..FWFTT...........................................
A0A0D9WSJ1_9ORYZ/133-224               ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IVSWV..T...V...............................S..................E.........P..GTS.......................EVFYG.KN.....E.HH.....................................Y..D.QR........A.E..G.T......VT....N.YTF.........................................................................YDYK.S..GYIH.HCLVD....G.......L..EYST.KYY.......Y..KI...............GSG...D-.................................-SA.RE..FWFET...........................................
A0A0G0F7W2_9BACT/80-178                .........................................qalnissvdes--------.....--.-...-....-G..................IA..TITWN..T...N...............................K..................L.........-..ATS.......................QVIYG.PT.....P.PA.....................................Y..I.LD........I.V..E.P......YL....G.YFGypl...................................................................gtvEDTT.K..VINH.SVSLT....G.......L..IPGQ.TYV.......Y..RV...............VSR...ASp...............................pTIS.PE..HQFT-v..........................................
F1A0C3_DICPU/214-317                   ....................................................PCYVYLTL.....NQ.S...P....HN..................SI..IANFH..T...Sle...........................kgD..................K.........V..PTP.......................ICKYD.TT.....S.ISatn...............................gsiS..N.YQ........F.S..A.S......GN....Y.YEM.........................................................................PLEV.I..RYVN.WVHLE....N.......L..QPNT.TYY.......F..RC...............GSD...EN.................................GYS.EE..RKFKT...........................................
M4DT62_BRARP/176-285                   ................................................pvyp----RLAL.....GK.-...E....WN..................EM..TVTWT..S...Gy.............................gP..................D.........V..AEP.......................VVEWG.IK.....G.GK.....................................R..K.L-........S.P..A.R......TL....T.YGRndlcg..............................................................ppartvGWRD.P..GYIH.TSFLK....E.......L..WPSS.KYT.......Y..KV...............GHR..lSNag.............................afIWS.KE..YHFK-s..........................................
W3A5M7_PHYPR/62-159                    ....................................................PQQLHLAY.....AG.A...S...aGT..................GM..TLSWS..T...Y...............................S..................Q.........V..QDS.......................SVWIG.KS.....K.DT.....................................L..A.LV.......nT.P..V.S......QS....S.YYS.........................................................................DNTY.N..MFHH.HATIS....G.......L..TPHT.KYF.......Y..KV...............GSK...STp...............................dYVS.AV..YSFVT...........................................
U7UC34_9FIRM/57-147                    .............................................vnirqvi--------.....IA.D...S....TT..................SR..TIMWQ..S...A...............................V..................S.........E..PDA.......................VVDYR.VN.....G.DE.....................................T..V.RT........L.P..A.A......EE....S.FT-.........................................................................DNGQ.T..TFIH.RALIK....G.......L..TAGT.EYE.......Y..RI...............GTN...G-.................................KRS.PW..FPLKT...........................................
I7A076_MELRP/24-120                    ....................................................PDRIILNL.....TE.Q...P....SS..................SI..AVTWH..T...N...............................E..................S.........H..DNS.......................FVELA.EA.....T.KW.....................................I..E.FK........D.S..A.Ik....tPA....Q.MNEl.......................................................................nYKGN.L..SYTY.SAVLN....D.......L..KPNT.LYV.......Y..RV...............GYD...S-.................................VTS.EW..NQFRT...........................................
A0A0V8HL76_9BACI/984-1089              ..............................................kniisp-------T.....TD.D...P....YK..................SK..SFTWM..S...S...............................Pl................gK.........G..ETP.......................VIQYA.RK.....K.DYdkkg.............................dkglL..T.--........A.K..G.-......--....-.--Swsnqvf.............................................................sgeldiTKNG.I..ARVN.QVTLK....K.......L..KQDT.TYV.......Y..RV...............GNG...E-.................................TWS.DM..QEFTT...........................................
A0A059ANQ1_EUCGR/68-159                ....................................................PQQVHITQ.....GD.H...V....GK..................GV..IVSWV..T...P...............................D..................E.........P..GSS.......................VVLYW.SK.....N.SE.....................................H..K.KK........A.K..G.K......VN....R.YEF.........................................................................YNYT.S..GYIH.HCTLN....D.......L..MYNT.KYY.......Y..EV...............GIG...H-.................................---.--..-----tvrqfwfit..................................
A0A0G1HH80_9BACT/47-139                ....................................................PKQVRLTN.....VT.-...-....DT..................GF..SVSWT..T...D...............................Q..................A.........-..ATG.......................KIKVG.TD.....E.KN.....................................L..K.DQ........V.L..D.D......RD....Q.LS-.........................................................................GETG.S..FEVH.YLTAK....N.......L..KANT.KYY.......F..KI...............ESE...GRa..............................fdNQG.KP..FEIT-t..........................................
A0A017SWE8_9DELT/87-188                .............................................avdapgr--------.....-A.D...P....AT..................SI..ALAWQ..T...D...............................D..................G.........T..LAS.......................EVQWG.TT.....P.DP.....................................A..T.WP........A.G..N.R......QS....G.MTWitp..................................................................agliSETG.P..TRMH.EAYVC....G.......L..APDT.TYH.......Y..RV...............GGG..pEGq...............................eVWS.DV..LSFKT...........................................
D5SQD8_PLAL2/52-139                    ....................................................PETMFLTW.....PG.D...P....TS..................TI..CIQWV..D...Q...............................D..................H.........G..NEL.......................EIAYS.PL.....E.SD.....................................N..W.QI........A.K..V.T......TK....P.F--.........................................................................-PMT.K..DKVY.RASIS....S.......L..QPGT.EYR.......F..RM...............GAD...A-.................................---.PT..FRFRTm..........................................
V5RV84_9BACT/1611-1695                 .................................................epv-------V.....TN.I...T....TK..................KA..TISWS..T...N...............................R..................T.........-..SDT.......................KIQYG.EG.....S.GD.....................................Y..I.DE........E.P..S.N......S-....-.---.........................................................................---E.Q..VTDH.EINLS....N.......L..SPGT.TYY.......F..VAkw...........tdEDG...NT.................................GIS.EE..YEFKT...........................................
M5VW03_PRUPE/54-141                    ....................................................PQQVHIST.....VG.-...-....AD..................KM..RVSWI..T...E...............................S..................P.........-..SSA.......................TVEYG.TS.....P.GA.....................................Y..E.QS........A.T..G.S......TS....S.YKY.........................................................................LMYE.S..GEIH.DVVIG....P.......L..KPNT.VYY.......Y..RC...............GSN...S-.................................--G.PE..FSFKT...........................................
D8SVS9_SELML/141-244                   ....................................................PTQIHLSL.....TS.-...N....FG..................EV..RVMFV..T...R...............................D..................A.........-..LEC.......................FILYG.TE.....Q.DS.....................................L..D.LT........V.A..T.K......SI....T.YQQgdmcde.............................................................panttlGWRN.P..GYIH.DGVLG....K.......L..KPSK.RYF.......Y..QV...............GSK...EG.................................GWS.KT..YSFV-s..........................................
A0A0P1AKJ6_9STRA/86-192                ....................................................PKHVHTAY.....GH.-...T....AG..................SL..AVQWM..T...K...............................Efcgeg........taqiqM.........I..EGY.......................HARIE.TE.....G.PN....................................mT..P.VV........A.W..A.N......ST....L.FEDd.......................................................................gEKQS.K..RWLH.VVRLN....G.......L..KVDT.RYT.......Y..VV...............GNA...HY................................aSWS.IP..YVTKT...........................................
G7IXK7_MEDTR/43-130                    ....................................................PQQVHISL.....AG.-...-....DK..................HM..RVTWI..T...D...............................D..................K.........S..APS.......................VVEYG.TL.....P.GK.....................................Y..D.NV........A.E..G.E......TT....S.YSY.........................................................................IFYS.S..GKIH.HTVIG....P.......L..EPNS.VYF.......Y..RC...............GG-...--.................................---.--..-----lgpefelkt..................................
V4STL8_9ROSI/169-277                   ................................................pvyp----RLAQ.....GK.-...T....WN..................EM..TVTWT..S...G...............................Y..................Gi.......nE..AEA.......................FVQWG.RK.....G.GD.....................................R..T.HS........P.A..G.T......L-....T.FDRgsmcg..............................................................apartvGWRD.P..GYIH.TSFLK....E.......L..WPNA.MYT.......Y..KV...............GHRl.fNSt...............................yIWS.SE..YQFK-a..........................................
A0A0J6ZPB5_9FIRM/30-125                .............................................venlvqi-------I.....SK.D...S....AT..................SR..TVSWQ..D...T...............................A..................R.........R..SDY.......................MVEYR.RQ.....G.TG.....................................E..I.RE........A.Y..M.T......GL....K.APPv......................................................................ydADWQ.A..PNTY.GAYMQ....Q.......L..TPET.TYE.......Y..RI...............RNS...D-.................................GTS.GW..MPFTT...........................................
T1LMZ2_TRIUA/160-269                   .................................................pvf---PRLSQ.....GK.-...Q....WN..................EM..AVTWT..S...G...............................Y..................Ni.......gE..AYP.......................FVEWR.MK.....G.EE.....................................T..S.KR........T.P..A.G......TL....T.FTRghlcg..............................................................npargqGYRD.P..GYIH.TAFLK....D.......L..WPNR.EYS.......Y..QI...............GHE..lQDg..............................tvAWG.KS..ATFR-a..........................................
A0A0G0T2X8_9BACT/6-96                  ................................................pgei------KI.....TN.I...T....ES..................SM..SVSWT..T...S...............................V..................K.........-..TAG.......................TLSYG.ET.....A.-N.....................................L..G.FT........A.L..D.D......RD....-.-ED.........................................................................GNPK.N..YETH.HVTIR....N.......L..KENT.KYF.......F..KI...............ISG...NK.................................---.--..-----kfdnggdpysaft..............................
W5W597_9PSEU/58-163                    .................................................pia---KHLAF.....GR.N...P....RT..................QM..RVGWQ..V...P...............................V..................P.........V..RKP.......................FVRYG.TD.....P.RH.....................................L..S.ER........I.P..A.E......VR....A.LHSev....................................................................pgvIAPY.D..QYYL.HAELC....D.......L..RPGH.TYY.......Y..AV...............GHD...GFdpa..........................rgdgGTG.AI..STFR-t..........................................
V7D3J7_PHAVU/82-194                    ....................................................PQQISLSL.....SA.-...S....HH..................SV..SISWI..T...G...............................Efqigdn......iepldpN.........S..VAS.......................VVRYG.RF.....R.RS.....................................M..S.HR........A.T..G.Y......SL....V.YSQlyp..................................................................feglQNYT.S..GIIH.HVRLT....G.......L..RPNT.LYQ.......Y..EC...............GDP...SL................................sAMS.DV..HYFRT...........................................
A2ZN55_ORYSI/66-157                    ....................................................PQQVHITL.....GD.Q...T....GT..................AM..TVSWV..T...M...............................E..................E.........A..GNS.......................TVLYG.LA.....M.DK.....................................L..D.MA........A.D..A.T......VT....T.YTY.........................................................................YNYT.S..GFIH.HCTLT....N.......L..QYGV.KYY.......Y..AM...............GFG...FT.................................VRS.FW..F----tt.........................................
K7LHW3_SOYBN/47-134                    ....................................................PQQVHISL.....VG.-...-....ND..................HM..RVSWI..T...D...............................D..................K.........H..SES.......................VVEYG.TK.....K.GE.....................................Y..S.TK........A.T..G.E......HT....S.YHY.........................................................................FLYE.S..GKIH.HVVIG....P.......L..QPNT.IYY.......Y..RC...............GGS...G-.................................---.SE..FSFKT...........................................
T1IRD3_STRMM/31-122                    ....................................................PQQVHLSF.....SK.-...N....PN..................EV..IVTWV..T...L...............................M..................K.........T..NRS.......................IVKYG.LK.....H.PD.....................................Q..V.VR........G.A..G.K......EF....F.DSG.........................................................................LAHR.S..IFIH.RAALT....G.......L..KPKK.TYY.......Y..RC...............GSP...A-.................................GWS.AV..YHFT-a..........................................
A0A0E0BVP9_9ORYZ/66-157                ....................................................PQQVHITL.....GD.Q...T....GT..................AM..TVSWV..T...M...............................E..................E.........A..GNS.......................TVLYG.LA.....M.DK.....................................L..D.MA........A.D..A.T......VT....T.YTY.........................................................................YNYT.S..GFIH.HCTLT....N.......L..QYGV.KYY.......Y..AM...............GFG...FT.................................VRS.FW..F----tt.........................................
A0A0M3CFJ3_9SPHI/38-135                ....................................................PDRITLTW.....SD.Q...P....ST..................TQ..SVSWR..I...N...............................G..................S.........A..TKA.......................VGQVV.EE.....Q.SS.....................................P..D.LE........K.S..A.Q......TV....L.GVTsp....................................................................lkiEGQT.A..DNYG.QVSFQ....G.......L..KPGT.IYT.......Y..RV...............GDG...T-.................................NWS.AW..NQFRT...........................................
A0A017TFD5_9DELT/30-113                ................................................rrpy-----LQL.....AT.-...-....PT..................SV..TVVWT..T...D...............................V..................A.........-..SNT.......................RLRYG.AS.....P.AA.....................................L..S.TT........V.D..N.A......--....-.---.........................................................................---A.A..VTQH.EVTLT....G.......L..TPGT.RYY.......Y..SV...............GTT...GS.................................---.--..-----tlagadndhyfet..............................
A0A0N0TDC2_9ACTN/76-181                ....................................................PFGRHLAW.....GN.D...P....RT..................EI..TVSWQ..V...P...............................V..................A.........V..KKP.......................FIRIG.AH.....P.WD.....................................L..S.RR........I.E..A.E......VR....T.LYTpag...................................................................vgaSGDH.T..QYYL.HAKLT....H.......L..RPGR.TYY.......Y..GV...............GHQ...GFdpa...........................aphLLG.TV..GTFT-t..........................................
A0A0G0JA05_9BACT/1404-1499             .............................................sgvevid--------.....--.S...N....VT..................SA..TISWQ..T...K...............................D..................Nqa....dpeL..SSS.......................FVQYS.TA.....S.SS.....................................E..Q.FA........S.T..F.K......EV....-.---.........................................................................GRDE.L..VSDH.EVVLD....N.......L..TQNQ.TYY.......Y..RV...............RSV...DAng.............................niAWH.PV..ASTT-y..........................................
A0A075K6R6_9FIRM/39-135                ...................................................a-DHITLTW.....AG.D...P....RT..................TQ..TITWR..T...E...............................V..................T.........T..AAG.......................QVQYA.EV.....T.ESk...................................lL..P.NA........A.K..I.A......IA....E.VEQl.......................................................................fTNMG.S..MSIH.SATLT....G.......L..KPNT.RYK.......Y..QV...............GDG...S-.................................LWS.EP..RTFLT...........................................
A0A0G1XDC1_9BACT/51-138                .................................................pss----KVNL.....AN.I...T....DT..................SF..TVYWT..T...G...............................K..................E.........-..VTG.......................AVFYG.ST.....P.EL.....................................T..G.GI........A.L..D.D......RA....L.T--.........................................................................DPDA.K..YLTH.FVRVG....N.......L..QPDT.KYY.......F..KV...............GSV...--.................................---.--..-----rpsfgntddg.................................
F7APV1_HORSE/25-116                    ....................................................PEQVHLSY.....LD.-...E....PG..................SM..TVTWT..T...W...............................V..................P.........-..TPS.......................EVQFG.LQ.....P.SG....................................pL..P.LR........A.Q..G.T......FP....F.VDG........................................................................gILRR.K..LYIH.RVTLR....G.......L..LPGV.QYV.......Y..RC...............GSA...Q-.................................GWS.R-..-----rvplq......................................
A0A0B2PVB9_GLYSO/54-145                ....................................................PQQVHITQ.....GD.L...V....GK..................AV..IVSWV..T...V...............................D..................E.........P..GSS.......................EVHYW.SE.....N.SD.....................................K..K.KI........A.E..G.K......LV....T.YRF.........................................................................FNYS.S..GFIH.HTTIR....N.......L..EYKT.KYY.......Y..EV...............GLG...N-.................................-TT.RQ..FWFVT...........................................
R5YAM8_9FIRM/62-155                    ...................................................y-EHVSLTP.....GA.-...D....ET..................QL..NYAWY..S...H...............................T..................V.........-..ETP.......................KVRVA.TK.....Q.NM.....................................D.gA.IE........F.E..G.T......QT....E.AVT.........................................................................IDGV.K..YYSN.KVIVK....N.......L..KADT.NYY.......Y..QV...............MQN...G-.................................KWQ.DA..EVYT-tks........................................
A0A0D2WPG4_CAPO3/70-162                ....................................................PFHVHFAY.....GY.D...T....AR..................AM..QLSWQ..T...Q...............................Q..................D.........T..VAS.......................LALFG.LQ.....P.GS.....................................R..Y.YS........A.I..G.S......SF....T.Y--.........................................................................NATA.A..GYFH.AVSLY....G.......L..TPDT.TYY.......V..VV...............GDN...NT................................nTYS.AE..FSFHT...........................................
A0A061EK97_THECC/643-755               ....................................................PEQISVSL.....SS.-...N....CS..................SV..WISWV..T...G...............................Efqfgdd......ikpldpQ.........S..VAS.......................VVQYG.TF.....N.SS.....................................R..N.NQ........A.T..G.N......SL....V.YSQqyp..................................................................yeglKSYT.S..GIIH.CVLVT....G.......L..DPDT.LYE.......Y..QC...............GDP...SI................................pAMS.DV..HYFRT...........................................
A0A0N0U4G2_9HYME/25-116                ....................................................PEAVHLAY.....GD.-...N....IH..................DI..VVTWS..T...R...............................N..................D.........T..EES.......................IVEYG.IG.....G.LI.....................................L..T.AQ........G.N..S.T......LF....I.DGG.........................................................................KEKQ.K..QYIH.RVWLR....N.......L..EPNS.KYI.......Y..HC...............GSK...Y-.................................GWS.NV..FYLKT...........................................
B9HIE6_POPTR/180-288                   ............................................pvyprlaq--------.....GK.-...I....WN..................EM..TVTWT..C...G...............................Y..................Gi.......nE..AEP.......................FVEWG.QK.....D.GD.....................................R..M.HS........L.A..G.T......LT....-.FDRnslcg..............................................................apartvGWRD.P..GFIH.TSFLK....E.......L..WPNA.VYT.......Y..KL...............GHKl.fNGt...............................yVWS.QE..YQFR-a..........................................
A0A127AMD0_9DELT/639-722               .............................................sevdsqp--------.....--.-...S....TN..................SA..VITWT..T...D...............................E..................P.........-..ATS.......................QVEYG.LN.....T.DY.....................................G..S.LT........D.L..-.-......--....-.---.........................................................................-DSN.L..VTSH.SVTIT....G.......L..VPET.LYH.......Y..RV...............RSQ...DAng.............................neAIS.ID..HTFTT...........................................
A0A0D3D354_BRAOL/54-148                ....................................................PEQVHITQ.....GD.H...N....GR..................GM..IISWV..T...P...............................I..................N........dD..GSN.......................VVQYW.VA.....D.GDe...................................sT..K.KS........A.E..A.S......TS....T.YRY.........................................................................YDYA.S..GFLH.HATIK....K.......L..EYST.KYF.......Y..EL...............GTG...R-.................................-ST.RR..FSFTT...........................................
A0A176J5D3_9BACI/1115-1215             ....................................................PERLNVTF.....TG.-...K....PS..................SR..NISWT..T...A...............................P..................Q.........V..TDS.......................VVQIA.KL.....E.DY.....................................K..K.DG........F.N..G.K......RF....T.AKNgks..................................................................tplaMDEG.E..LQAH.TAEVI....G.......M..VPGQ.MYM.......Y..RA...............GDG...TP................................eGWS.EP..AEIK-a..........................................
C5WST2_SORBI/175-283                   ................................................pvfp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...Gy.............................gT..................N.........E..ATP.......................FVRWG.IQ.....G.QI.....................................Q..I.LS........P.A..G.T......-L....T.FSRetmcg..............................................................ppartvGWRD.P..GFIH.TSFLK....E.......L..WPNL.LYT.......Y..QV...............GHHi.fNGs...............................iVWG.HQ..YSFK-a..........................................
A0A078E744_BRANA/143-246               ....................................................PEQIHLAF.....ED.-...G....VN..................GM..RVTFV..A...G...............................D..................G.........-..EER.......................FVRYG.ER.....K.ER.....................................L..G.NS........A.P..A.R......GV....R.YERehmcna.............................................................pantsiGWRD.P..GWIF.DAVMK....N.......L..NGGV.KYY.......Y..QV...............GSD...SK.................................GWS.EI..HSF--ia.........................................
A0A0F7IFW4_9EURY/621-708               ...............................................pkien-----ISI.....KS.V...T....AT..................SA..TIVWN..T...D...............................E..................Y.........-..SDS.......................AVKYG.TE.....S.GN.....................................Y..T.YY........M.S..D.P......TF....-.---.........................................................................----.-..KTTH.SLTLT....N.......L..IPNT.KYY.......F..VI...............ISK...DMsg.............................nnAQS.EE..YTFTT...........................................
I1MU36_SOYBN/92-183                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...T...............................E..................E.........P..GHS.......................HIQYG.TS.....E.NK.....................................F..Q.TS........E.E..G.T......VT....N.YTF.........................................................................HKYK.S..GYIH.HCLIE....G.......L..EYET.KYY.......Y..RI...............GSG...D-.................................-SS.RE..FWFKT...........................................
I1PL09_ORYGL/52-141                    ....................................................PQQVHVSL.....VG.-...-....AN..................HM..RVSWI..T...E...............................D..................K.........H..VKS.......................VVEYG.KV.....S.GN.....................................Y..T.AS........A.T..G.E......HT....S.YRY.........................................................................FLYS.S..GKIH.HVKIG....P.......L..DPGT.VYY.......Y..RC...............GMA...GD.................................---.--..-----efglrtpp...................................
A0A0X3SMJ8_9ACTN/66-183                ....................................................PFGRHLAF.....GA.D...P....RS..................QM..RISWQ..V...P...............................L..................A.........V..RKP.......................FVRVG.LK.....P.WE.....................................L..S.RR........I.E..A.E......VR....H.LHTppl...................................................................sdqVPGV.D..QFYP.HAALD....G.......L..RPGT.TYY.......Y..GV...............GHE...G-.................................-WD.--..-----padprhygslgtfrtapgtaevftfta................
A5N8V9_CLOK5/51-136                    ..................................................ik--DVTFAP.....GK.-...D....QS..................QL..NFTWY..S...K...............................S..................T.........-..SET.......................QVQVA.LK.....S.DM.....................................S..G.SE........F.P..V.D......KA....Q.TFNge.....................................................................ksNGND.R..YTSN.KVTVT....G.......L..KQGV.EYV.......Y..RV...............GDG...T-.................................---.--..-----n..........................................
A0A160IKU0_9BACI/985-1091              ..................................................fk--NIISNP.....TG.N...P....YK..................TK..GFTWM..S...S...............................Pl................kD.........D..ESS.......................VVQYA.KK.....K.DYeqkg.............................msslK..T.QT........A.S..G.N......NQ....V.FSGel.....................................................................diKKNG.V..VRIN.EVELK....K.......L..QQDT.TYV.......Y..RV...............GDG...N-.................................HWS.EF..MEFTT...........................................
A0A0G0UHT0_9BACT/44-134                ................................................pgei------KI.....TN.I...T....ES..................SM..SVSWT..T...S...............................V..................K.........-..TAG.......................TLSYG.ET.....A.-N.....................................L..G.FT........A.L..D.D......RD....-.-ED.........................................................................GNPK.N..YETH.HVTIR....N.......L..KENT.KYF.......F..KI...............ISG...NK.................................---.--..-----kfdnggdpysaft..............................
A0A078I9H0_BRANA/59-150                ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IVSWV..T...P...............................D..................E.........P..GSS.......................TVHYG.AV.....Q.GN.....................................Y..D.FV........A.K..G.T......FS....N.YTF.........................................................................YKYK.S..GYTH.HCLLS....G.......L..EYNT.KYY.......Y..KI...............ESG...E-.................................-SS.RE..FWFVT...........................................
A0A0U1QM85_9BACL/39-139                ...................................................v-KKVVATF.....TG.D...A....RT..................TK..GFTWY..T...S...............................L..................A.........S..TQS.......................DLQLV.KK.....N.GKskkk.............................pnfkK..A.LT........F.K..-.-......--....-.--Gts....................................................................aisSNDS.E..ERMH.KAEAK....G.......L..RSNT.EYY.......Y..RV...............GDA...KR................................kIWS.MV..GVIKT...........................................
S8C684_9LAMI/5-97                      ....................................................PLQVHISL.....AG.-...-....AN..................HM..RISWV..V...N...............................D..................K.........H..SPS.......................MVEYG.TS.....P.GH.....................................Y..T.ST........S.Q..G.E......ST....S.YSY.........................................................................LLYS.S..GKIH.NAVIG....P.......L..EDDK.TYY.......Y..RC...............SGQ...G-.................................---.--..-----pefqlktppskf...............................
A0A078JJN4_BRANA/76-187                ....................................................PEQISLAL.....SS.-...N....YD..................SI..WVSWI..T...G...............................Efqigmn......vtpldpT.........S..IAS.......................IVQFG.TL.....G.DS.....................................L..I.HT........A.T..G.S......SL....V.YNQlyp..................................................................feglLNYT.S..GIIH.HVRIT....G.......L..QPST.VYY.......Y..RC...............GDP...SH.................................GMS.KI..HHFKT...........................................
A0A0E0LDX1_ORYPU/54-145                ....................................................PQQVHITQ.....GD.Y...N....GK..................AV..IVSWV..T...V...............................A..................E.........P..GTS.......................EVFYG.KN.....E.HQ.....................................Y..D.QR........A.E..G.T......VT....N.YTF.........................................................................YDYK.S..GYIH.HCLVD....G.......L..EYNT.KYY.......Y..KI...............GSG...D-.................................-SA.RE..LW---fet........................................
A0A0K0EAF3_STRER/25-113                ...................................................h-EQVHLAL.....TK.-...D....PR..................SI..VVSWT..T...F...............................Y..................Dis.....lyK..RKP.......................SVKYG.TI.....K.SS.....................................L..S.KV........K.R..G.S......TG....S.TRKli....................................................................epnNSTI.I..RYFH.TIYLQ....N.......L..LYNK.RYY.......Y..KV...............GD-...--.................................---.--..-----...........................................
V4SW87_9ROSI/216-319                   ................................................plyg----HLSS.....VD.S...T....GT..................SM..RVTWV..S...G...............................D..................K.........-..EPQ.......................QVEYG.DD.....G.KT.....................................L..T.SE........V.S..T.F......T-....-.KENmcssal............................................................pspakdfGWHD.P..GYIH.TAVMT....G.......L..QPSS.TVS.......Y..RY...............GSE...AV.................................DWS.DK..IQFRT...........................................
H3H2W2_PHYRM/71-168                    ....................................................PQQVHLAY.....AG.E...T...aGT..................GM..TVSWA..T...Y...............................E..................A.........V..SDS.......................SLWVG.SS.....K.DS.....................................L..T.LV........D.T..TvE......SA....N.YYH.........................................................................DDTY.D..MYHH.HAKVS....G.......L..SPHT.KYY.......Y..KV...............GSK...AQt...............................tYQS.DV..HSFVT...........................................
H3GXL5_PHYRM/22-133                    ..................................................ss--QFHLSI.....VG.KqgnD....KV..................HY..MLDWV..T...A...............................S..................T.........V..NSS.......................RLLFG.TS.....A.DD.....................................L..G.ST........I.N..G.K......SA...gQ.VTE.........................................................................SAGE.T..VVCW.SALLA....N.......L..EPGA.TVF.......Y..AL...............ESD...TEq...............................qT--.--..-----tsslgfdalsksaaskmmnft......................
G7L615_MEDTR/54-141                    ....................................................PQQVHISL.....VG.-...-....KD..................KM..RVSWI..T...E...............................D..................K.........E..TET.......................MVEYG.TK.....A.GE.....................................Y..S.EK........T.M..G.E......HT....S.YQY.........................................................................FFYN.S..GKIH.NAVIG....P.......L..EPNT.TYF.......Y..RC...............GGL...G-.................................---.PE..FSFKT...........................................
A0A0E0BFD7_9ORYZ/146-234               ....................................................PQQVHISM.....VG.-...-....EK..................NM..RISWV..T...D...............................D..................L.........N..APS.......................VVEYG.TS.....P.GK.....................................Y..T.AS........A.T..G.D......HT....T.YRY.........................................................................FLYK.S..GAIH.HATIG....P.......L..EAST.TYH.......Y..RC...............GKA...GD.................................---.--..-----eftlrtp....................................
A0A0G1W6U6_9BACT/1183-1275             ...............................................pvitn-----ISS.....GT.P...G....TN..................SA..TITWD..T...T...............................G..................E.........S..STS.......................QVQYN.KT.....G.TF.....................................G..D.CP........T.D..C.T......T-....-.---.........................................................................LDSN.L..VFTH.SVPLS....N.......L..DSGT.TYY.......Y..RV...............RSK...DSag.............................neAVS.SN..NTFAT...........................................
D6K1I5_9ACTN/83-188                    ....................................................PFGRHLAY.....GN.D...P....RT..................EI..TVSWQ..V...P...............................V..................A.........V..KKP.......................FIRIG.AH.....P.WD.....................................L..S.RK........I.E..A.E......VR....T.LYTpag...................................................................vgaSGDH.T..QYYL.HAKLT....H.......L..RPGR.TYY.......Y..GV...............GHQ...G-.................................---.--..-----fdpaqahlagtlgtftt..........................
A0A136KLQ2_9BACT/32-131                ..............................................esvris--------.....-D.L...T....DT..................SV..TISWT..T...V...............................N..................E.........Q..LAA.......................VEYYQ.EG.....S.NEvmt...............................afdT..R.DL........V.K..N.S......SG....Q.YELs.......................................................................eQGRA.T..RNIH.YVVIR....N.......L..NPDT.TYT.......F..SI...............KNA...G-.................................NF-.--..-----neqtiktypt.................................
R4K6T8_CLOPA/49-144                    ..................................................ft--DISLSV.....GS.-...N....PT..................DL..NLTWY..S...L...............................N..................S.........K..GTA.......................TVQVA.LK.....S.DY.....................................N..G.TS........F.P..A.D.....kAR....V.FTGt......................................................................tsLGNN.G..FTSY.KVNTN....G.......F..AEST.QYV.......Y..RL...............GDG...T-.................................NWS.PV..YNYNT...........................................
A0A183DK95_9BILA/1-78                  ....................................................--------.....--.-...-....--..................-M..WVTWL..T...Y...............................N..................N.........T..FLS.......................LVEYG.IG.....D.FR.....................................W..T.AQ........G.N..S.T......LF....T.DGG.........................................................................KLKR.K..RYIH.RVLLT....D.......L..KPGT.EYQ.......Y..HV...............GSE...Y-.................................GWS.SI..YRLR-a..........................................
W5GS60_WHEAT/1-80                      ....................................................--------.....--.-...-....--..................-M..RITWV..T...D...............................D..................N.........S..VPS.......................VVEYG.TT.....S.NT.....................................Y..T.SS........S.N..G.E......ST....S.YSY.........................................................................LMYS.S..GKIH.HVVIG....P.......L..EDNT.IYY.......Y..RC...............GGR...GS.................................---.--..-----efqlktppsqf................................
A0A059BMI9_EUCGR/44-131                ....................................................PQQVHISL.....AG.-...-....EG..................HK..CISWV..T...D...............................G..................K.........S..SPS.......................YVEYG.TS.....P.GR.....................................Y..D.ST........A.Q..G.E......ST....S.YSY.........................................................................LFYS.S..GKIH.HTVIG....P.......L..ESNT.VYF.......Y..RC...............GGE...G-.................................---.--..-----pefrlkt....................................
A0A0L7QV16_9HYME/25-116                ....................................................PEAVHLSY.....GD.-...N....IH..................DI..VVTWS..T...R...............................N..................D.........T..EES.......................VVEYG.IG.....E.--.....................................L..I.FT........A.T..G.N......ST....L.FIDg.......................................................................gSQKQ.K..QYIH.RVWLK....N.......L..TPNS.KYI.......Y..HC...............GSK...Y-.................................GWS.NV..FYMKT...........................................
Q01ZC1_SOLUE/47-144                    ...........................................napylqnlg--------.....--.-...-....AD..................HV..TVVWA..A...K...............................E..................N.........-..QAA.......................SVQYS.TD.....G.SF.....................................S..K.SV........A.A..R.V......VR....T.FSSs......................................................................etDIGF.T..FSQY.RADLT....G.......L..APGT.AYS.......Y..RV...............IVG...GQ.................................PFA.PV..SD---ttayrfst...................................
A0A0G3HIE4_9CORY/163-240               ..................................lddngkpeevkgyftdeq--------.....--.-...-....--..................--..-----..-...-...............................-..................-.........-..---.......................-----.IT.....R.DN.....................................T..K.WT........S.D..G.S......EL....A.YLE.........................................................................LQDV.T..EHVY.KAEAT....G.......L..APDT.QYY.......Y..QL...............GSE...AE.................................GLT.ET..GSFRT...........................................
A0A0N4YBN9_NIPBR/40-134                ....................................................PEQVHLSL.....GT.-...S....LS..................EM..VVTWL..T...F...............................D..................D.........T..EKT.......................MVEFG.PI.....T.DK.....................................K.pT.KI........V.E..G.R......CS....A.FSDn.......................................................................pKSKQ.K..RFIH.RVLLT....G.......L..VPGK.TYQ.......Y..RV...............GSE...Y-.................................GWS.AL..YRFT-a..........................................
A0A0G0EPY6_9BACT/1615-1706             ..........................................ittgpdsssi--------.....--.-...S....DT..................TA..IIQWT..T...D...............................E..................D.........-..ANA.......................RVYFG.PE.....S.GN.....................................D..I.SD........Y.-..A.T......ST....S.---.........................................................................LAVN.Y..NRDH.TVALI....N.......L..ATST.KYY.......Y..RV...............YSS...DAng.............................nsVVS.DE..ADFTT...........................................
I1IXG9_BRADI/49-136                    ....................................................PQQVHVSL.....VG.-...-....AN..................HM..RVSWI..T...D...............................A..................K.........H..GQT.......................VVEYG.RA.....S.RN.....................................Y..T.AS........A.T..G.D......HT....S.YTY.........................................................................FLYT.S..GKIH.HVTIG....P.......L..DPGT.VYY.......Y..RC...............GMA...GD.................................EFS.--..-----lkt........................................
K4CXG1_SOLLC/48-140                    ....................................................PQQVHISL.....AG.-...-....DK..................HM..RITWI..T...N...............................D..................G.........S..SPS.......................IVEYG.TS.....P.GK.....................................Y..S.AI........S.Q..G.E......ST....K.YSY.........................................................................LLYS.S..GKIH.HTVIG....P.......L..QENT.TYF.......Y..RC...............GGG...G-.................................---.--..-----lefqlktppskf...............................
A0A078HF42_BRANA/144-247               ...................................................a-EQIHLAF.....EN.-...K....PN..................RM..QVTFV..A...G...............................D..................G.........-..DER.......................FVRYG.ET.....K.DL.....................................L..G.NS........A.A..A.R......GI....R.YDReqmcna.............................................................panssiGWRD.P..GWIF.HTVLK....N.......L..NPAV.RNY.......Y..QI...............GSE...AK.................................GWS.EI..YSF--is.........................................
A0A024TI22_9STRA/80-177                ....................................................PRQVHLAY.....AG.R...T...pGT..................GM..TVSWA..T...Y...............................H..................R.........V..NDS.......................TLWVG.ST.....P.TN.....................................L.sL.AT........V.D..A.E......TL....S.YYA.........................................................................DDVY.T..LYTY.HATVR....G.......L..TPRS.KYF.......Y..RV...............GSA...SNd...............................sHVS.PV..YHFHT...........................................
A9U0Q4_PHYPA/74-185                    ....................................................PEQIFLAL.....ST.-...-....PD..................AM..WVSWV..S...G...............................Dwqmgpk......vtpldpT.........S..VKS.......................VVQYG.TA.....S.EK.....................................Y..T.MS........A.S..G.I......SE....V.YSQlyp..................................................................fdnvLNYT.S..GIIH.HVRIT....G.......L..KPNT.KYY.......Y..KC...............GDP...TL................................sAMS.GE..HSFTT...........................................
M4F3X6_BRARP/43-130                    ....................................................PEQVHISL.....AG.-...-....DK..................HM..RVSWV..T...N...............................D..................K.........S..SPS.......................FVEYG.TS.....P.GK.....................................Y..S.FL........G.Q..G.E......ST....S.YSY.........................................................................IFYR.S..GKIH.HAVIG....P.......L..EPDT.VYY.......Y..RC...............GGG...G-.................................---.PE..-----fhlkt......................................
B5WPE7_9BURK/57-156                    ....................................................PEQIHLTW.....GN.D...P....TS..................EV..TVSWS..S...L...............................A..................P.........A..VNP.......................QVRMS.GR.....D.GAe...................................rA..K.QT........V.H..A.V......QS....T.YTD........................................................................gINGE.V..VFNY.HARVR....D.......L..KADT.SYQ.......Y..EV...............TAD...ND................................sNAS.QP..FT---asfrt......................................
I0Z217_COCSC/152-255                   ....................................................PTQGHLTF.....TS.-...T....QG..................EV..SVQWT..T...R...............................D..................V.........-..GTP.......................VVKFG.TS.....S.GQ.....................................Y..G.AP........V.P..A.K......TG....G.YTRdimcg..............................................................qpastyGYFD.P..GSLH.YGTIA....G.......L..APNT.KYY.......Y..TY...............GDAv.lG-.................................LFA.PE..SSFVT...........................................
R6BPC8_9FIRM/75-172                    ..................................................ss--RIILTP.....GK.-...T....AK..................DL..GFAWY..S...Q...............................K..................K.........-..GEP.......................AVKIG.KK.....E.DL....................................sD..A.QE........F.K..G.T......AT....E.INRs.......................................................................nQKNT.Y..KASN.KVTVE....G.......L.fEENT.TYY.......Y..SY...............TDD..vKN................................pNWS.EV..QSYTT...........................................
A0A087HDK4_ARAAL/44-133                ....................................................PEQVHISL.....VG.-...-....SD..................KM..RISWI..T...K...............................D..................S.........-..IIP.......................SVVYG.TV.....S.GK.....................................Y..E.SS........A.D..G.T......SS....S.YHY........................................................................lLIYQ.S..GQIH.DVVIG....P.......L..KPNT.VYY.......Y..KC...............GGP...D-.................................-SP.QE..FNFKT...........................................
A0A0J1BK20_9SPHI/32-130                ....................................................PDRIILTW.....SG.D...P....AT..................TQ..SVTWR..T...D...............................S..................T.........V..KTS.......................FAQIL.AE.....N.SSpkle.............................kpasK..E.YT........-.-..-.-......--....-.--Angt..................................................................vlkgKEYE.A..ANYH.SVTFD....Q.......L..QPDQ.VYT.......Y..RV...............GDG...Q-.................................NWS.EW..FQFKT...........................................
A0A061EBE6_THECC/176-284               ...............................................pvypr-----LAQ.....GK.-...V....WN..................EM..TVTWT..S...G...............................Y..................Gi.......gE..AVP.......................FVEWS.WK.....G.GL.....................................P..I.HS........P.A..G.T......L-....T.FDSnsmcg..............................................................epamtvGWRD.P..GFIH.TSFLK....E.......L..WPNT.LYT.......Y..RL...............GHV..lSDg..............................tyVWS.QQ..YSFK-a..........................................
A0A0G1TB45_9BACT/66-155                ..............................................gvkevg--------.....--.-...-....SD..................YA..VVTWA..T...D...............................Q..................D.........-..AGG.......................VVRYA.RD.....S.EY.....................................R..D.GS........S.D..P.Y......TT....E.-SG.........................................................................DAGE.R..TRGH.SVRIN....G.......L..SPGT.LYH.......F..QV...............VSE...AD................................lGL-.--..-----sgeslddtfit................................
F2U8E5_SALR5/37-136                    ....................................................PTQVHLAL.....GD.T...A....GA..................SM..VVSWI..T...T...............................N..................A.........-..SAG.......................HVYYG.TS.....K.DK.....................................L..N.TR........V.E..Q.La....dAE....R.YTFqs....................................................................tygEHYV.S..GLIH.HAKIP....N.......L..APLT.KYY.......Y..RC...............GAD...GF.................................GYS.DV..FSFTT...........................................
I3IMC5_9BACT/31-117                    ...................................................v-SRIHLSW.....QH.D...P....AS..................SM..TIMWS..S...D...............................T..................S.........H..KPP.......................KVEYG.RT.....T.-A.....................................Y..G.NV........V.T..G.V......--....-.---.........................................................................DTEH.G..EYVH.TVELT....G.......L..TPDT.LYH.......Y..RV...............SDD...GG.................................LWS.RD..YTFWT...........................................
A0A151SMJ7_CAJCA/72-184                ....................................................PEQISVSL.....ST.-...T....HD..................SV..WISWI..T...G...............................Efqigfd......ikpldpE.........T..VSS.......................VVQYG.TS.....R.FG.....................................L..V.HE........V.S..G.Q......SL....I.YNQlyp..................................................................feglENYT.S..GIIH.HVRLT....G.......L..EPST.LYY.......Y..QC...............GDP...SL................................qAMS.DI..YYFRT...........................................
A0A0W8D2I7_PHYNI/20-120                ...................................................s-SQFHLSL.....VE.K...E....DNg...............qvHY..MVDWV..T...A...............................S..................T.........V..NSS.......................RLIVG.TS.....A.DD.....................................L..S.SA........V.D..G.K......RA...gL.VRE.........................................................................AADE.D..VACW.SALLS....N.......L..EPGS.TIF.......Y..AL...............ESD...AT.................................---.--..-----qqttssldfdels..............................
R5R657_9FIRM/100-195                   ..................................................tg--KIVLTP.....GA.-...K....AT..................DL..NFAWY..S...E...............................E..................T.........-..GTP.......................TVKIS.TN.....Q.DM.....................................S.gA.KT........V.T..G.S......AD....K.INK.........................................................................NNSF.KnyTASN.KVALK....D......yL..VENM.TYY.......Y..QY...............STN...GV.................................DWS.DT..YTYKT...........................................
D8SYQ0_SELML/73-183                    ....................................................PEQIALAQ.....GT.-...D....SS..................SM..FVSWI..T...G...............................Efqvgqd......vtplnpS.........L..IKS.......................VVEYG.IF.....K.--.....................................L..D.HF........A.V..G.K......AS....V.YSQlyp..................................................................ykglNNYT.S..GIIH.HVKLQ....G.......L..KSST.TYY.......Y..RC...............GDP..fAK.................................AMS.PV..YSFTT...........................................
F8AZC8_FRADG/9-103                     ...................................................v-EHLHLTF.....GP.D...P....TV..................SM..AVSWT..T...P...............................R..................M.........V..RRP.......................RVRFG.ST.....P.GR.....................................L..D.RE........V.H..A.V......TR....V.YTD........................................................................aVTGE.D..VINH.HALLT....G.......L..EPDS.RYL.......Y..EV...............IHD...R-.................................-I-.--..-----srtgggtlrt.................................
W1PSR3_AMBTC/46-133                    ....................................................PQQVHISL.....VG.-...-....ND..................RM..RISWI..T...D...............................D..................E.........-..STP.......................SVEYG.TS.....S.GI.....................................Y..D.AS........A.T..G.N......TS....T.YSY.........................................................................VLYK.S..GQIH.DVIIG....P.......L..KPET.VYF.......Y..RC...............GGF...S-.................................--G.KE..YSFKT...........................................
M0ZS86_SOLTU/47-135                    ....................................................PQQVHISM.....VG.-...-....ED..................KM..RISWI..M...E...............................D..................S.........G..SPA.......................TVKYG.TS.....P.GS.....................................Y..P.FS........A.N..G.D......TT....K.YRY.........................................................................ILYK.S..GEIH.NVVIG....P.......L..KPNT.VYY.......Y..IC...............GPF...T-.................................--S.PE..FNFKT...........................................
A0A0K9PLM9_ZOSMR/78-190                ....................................................PEQIALAV.....SS.-...-....PT..................SM..WVSWV..T...G...............................Daqvgan......ltpldsS.........M..VRS.......................EVWYG.LM.....E.TG....................................nY..S.FF........Q.Q..G.T......ST....V.YSQlyp..................................................................fkglMNYT.S..GIIH.HVRLE....G.......L..QPGK.RYH.......Y..RC...............GDS...SL................................gAMS.EE..HVFQ-i..........................................
A0A0G1BZF4_9BACT/1356-1456             ...............................................ptitn-----VAI.....SD.V...G....AQ..................TA..TVTWD..T...D...............................E..................P.........-..ANS.......................TVEYI.TV.....V.GG.....................................D..F.SN........A.Q..S.S......GI....A.TML.........................................................................DSNT.G..LGQH.HVVLT....G.......L..LPDT.TYY.......L..QV...............KSR...DPsnns.........................vtdkEGS.NG..YSFTT...........................................
W2RI01_PHYPN/62-159                    ....................................................PQQLHLAY.....AG.A...S...aGT..................GM..TLSWS..T...Y...............................S..................Q.........V..QDS.......................SVWIG.KS.....K.DT.....................................L..A.LV.......nT.P..V.S......QS....S.YYS.........................................................................DNTY.N..MFHH.HATIS....G.......L..TPHT.KYF.......Y..KV...............GSK...STp...............................dYVS.AV..YSFVT...........................................
A0A0R0BLR2_9GAMM/47-142                ....................................................PDRIVLSP.....AA.D...A....AS..................GF..AVSWR..T...D...............................D..................S.........V..SAP.......................LLELA.PL.....G.DS.....................................P..A.FA........A.S..R.R......IT....A.Q-Tlp.....................................................................laSETG.S..AHFH.HARVD....G.......L..APGS.AWL.......Y..RV...............QGN...G-.................................RWS.SW..NRVVT...........................................
PPA9_ARATH/143-246                     ....................................................PEQIHLSY.....TD.-...N....IN..................EM..RVVFV..T...G...............................D..................G.........-..EER.......................EARYG.EV.....K.DK.....................................L..D.NI........A.V..A.R......GV....R.YEIehmcha.............................................................panstvGWRD.P..GWTF.DAVMK....N.......L..KQGI.RYY.......Y..QV...............GSD...LK.................................GWS.EI..HSFV-s..........................................
V9EPT2_PHYPR/243-349                   ....................................................PKHVHTAY.....GR.-...T....PG..................SL..SVQWM..T...K...............................Qf................cA.........E..GDT.......................QLKLV.EG.....Y.HAhieve..........................gpkatpV..A.AW........A.N..T.T......LF....E.DEG.........................................................................EAQS.K..RWMH.VVRLE....G.......L..KPDT.RYT.......Y..VV...............GNA...HY................................sSWS.IP..YVTKT...........................................
A0A166ES63_DAUCA/52-139                ....................................................PQQVHISL.....VG.-...-....ND..................KM..RISWI..T...D...............................D..................L.........-..VES.......................TVEYG.TS.....A.GF.....................................K.aG.TS........A.T..G.T......YS....T.YKY.........................................................................AVYT.S..GYIY.DVIIG....P.......L..KPST.TYF.......Y..RC...............GGS...S-.................................---.QE..FNFET...........................................
M2XXL8_GALSU/129-244                   ....................................................PEQFHLAL.....TS.-...N....PG..................EV..IISYS..T...L...............................S..................Np.......eP..YGQ.......................CVTIE.DD.....I.DG.....................................L..G.NT........F.T..G.K......VF....C.TNDtrtftig...........................................................sgqppliCRNY.T..GYFH.HVKVT....G.......L..IPGK.KYY.......Y..SA...............NAY...S-.................................---.--..-----nrysfiapygtnsshvtf.........................
A0A090LLM7_STRRB/1-84                  ....................................................--------.....--.-...-....--..................-M..IVSWV..T...F...............................Y..................Dys.....vsH..RKP.......................IVKYG.TS.....S.SC....................................mS..K.IS........F.G..R.S......KS....L.IEN.........................................................................NNSSiV..RYYH.TVYLK....N.......L..NYNK.KYY.......Y..KV...............GDG...R-.................................KWS.KK..FYFKT...........................................
A0A0S7XLK7_9BACT/30-106                .................................................pyl--------.....QN.V...T....QT..................SI..VVMWE..T...D...............................V..................A.........-..ALG.......................RVDYG.PT.....A.AY.....................................G..S.SA........F.D..-.-......--....-.---.........................................................................--LR.S..VTIH.EAKVT....G.......L..TAGA.TYH.......Y..RV...............ASG...A-.................................ASS.AD..STFQ-a..........................................
A0A0B0NDX7_GOSAR/58-149                ....................................................PQQVHITQ.....GD.M...D....GS..................GV..IISWI..T...P...............................D..................E.........P..GSN.......................MVYYW.PE.....N.SN.....................................H..K.NK........A.E..G.I......FV....R.YKF.........................................................................FNYT.S..GYIH.HCTIN....N.......L..EYNT.KYI.......Y..EI...............GRG...DS.................................--I.--..-----rqfwfvt....................................
G7KLC0_MEDTR/71-182                    ....................................................PEQIALAI.....SS.-...-....PT..................SM..WISWI..T...G...............................Ksqigln......vtpldpA.........S..IGS.......................EVWYG.KK.....S.GK.....................................Y..T.NV........G.K..G.D......SL....V.YSQlyp..................................................................feglLNYT.S..GIIH.HVKLE....G.......L..EPGT.RYY.......Y..KC...............GDS...SI................................pAMS.QE..NYFET...........................................
X0C4R0_FUSOX/75-176                    ........................................syipaksggdtv--------.....--.-...-....--..................GI..NIHYQ..T...P...............................F..................G........lG..LAP.......................SVYWG.TS.....P.SS.....................................L..N.NV........A.T..G.L......TA....T.YDRtppc.................................................................slvaVTQC.S..QFFH.NVQIE....Q.......L..QPGT.TYF.......Y..QI...............PAA...NG................................tTQS.TV..LSFTT...........................................
K3Y7K6_SETIT/112-199                   ....................................................PQQVHISV.....VG.-...-....PN..................HM..RISWV..T...D...............................D..................R.........N..APS.......................VVEYG.TS.....P.GK.....................................Y..T.AS........A.T..G.N......HT....T.YHY.........................................................................FFYK.S..GAIH.HVTIG....P.......L..EPVT.TYY.......Y..RC...............GRA...G-.................................---.DE..FSFRT...........................................
I1GQN0_BRADI/67-157                    ....................................................PQQVHISL.....AG.-...-....EK..................HM..RITWV..T...D...............................D..................N.........S..VPS.......................VVDYG.TK.....T.GT.....................................Y..T.ST........S.Q..G.E......ST....S.YSY.........................................................................LLYS.S..GKIH.HVVIG....P.......L..EDNM.IYY.......Y..RC...............GGQ...G-.................................---.--..-----pefqlktpps.................................
A0A0K9PZI5_ZOSMR/149-253               ....................................................PEQVHLAL.....TE.-...R....EN..................EM..RVMWI..T...G...............................N..................K.........-..DEC.......................FVEYG.RR.....K.EG....................................kL..E.ER........I.K..A.V......LA....R.YEIshmcdk.............................................................pantsiGWRD.P..GWVH.DAVMT....G.......L..KRGT.RYY.......Y..RV...............GSD...AL.................................GWS.PT..YSF--is.........................................
A0A0G1NZQ5_9BACT/1954-2037             ..................................................pe-------V.....GE.I...T....TK..................KA..EVDWT..T...S...............................R..................T.........-..ADS.......................KVAYG.TA.....S.GD.....................................Y..F.DE........E.V..G.N......S-....-.---.........................................................................---D.Q..VTVH.SLTLN....N.......L..SPGA.TYY.......F..VAk.............wTDE...-Dg..............................nlGSS.EE..YTFAT...........................................
V4LMR6_EUTSA/65-168                    ....................................................PEQISVSL.....SY.-...S....FD..................SV..WISWV..T...A...............................E..................Kfq.....sgS..VQS.......................IVQYS.EF.....D.VV....................................sR..N.KT........A.K..G.H......YL....V.YNQdg....................................................................nglKNYT.S..GKIH.HVQLT....G.......L..KPKT.LYQ.......Y..RC...............GDP...SL................................sAMS.KE..HYFRT...........................................
F0SQ14_RUBBR/59-173                    ....................................................PDRILVSW.....AN.S...P....DR..................SF..SVTWR..S...L...............................E..................S.........-..PDA.......................VAEFA.PA.....T.DG.....................................P..E.FT........K.N..I.Q......RV....A.ADTap.....................................................................laTNLG.Q..VHMH.AATFS....G.......L..EPNT.LYV.......Y..RV...............GNR...RTvslpsgdak...............gveqhtqdyAWS.EW..IHVRT...........................................
A0A183AC67_9TREM/28-121                ....................................................PEQVHLSI.....GE.-...S....AS..................TM..VVTWV..T...E...............................S..................E.........T..PQS.......................AVMYG.TQ.....R.NA.....................................E..D.IV........I.Y..G.S......QE....K.FVDg.......................................................................gSEQR.A..IFIH.RVTLN....N.......L..RTGT.IYY.......Y..KC...............GSA...D-.................................NWS.ST..FQFR-v..........................................
B9RGF7_RICCO/220-322                   ................................................plyg----HISS.....ID.S...T....AT..................SM..KVTWV..S...G...............................S..................K.........-..EPQ.......................QVEYG.DD.....K.KV.....................................A..S.QV........T.T..F.S......QK....D.MCSsvlps...............................................................pakdfGWHD.P..GYIH.SAVMT....G.......L..KPSS.NYT.......Y..RY...............GSA...LV.................................GWS.SQ..TQFRT...........................................
D8S4S9_SELML/1-94                      ....................................................PEQVFISQ.....AD.H...T....GT..................AF..TISWS..S...N...............................R..................S.........-..MGS.......................RVFYS.NQ.....P.SS.....................................Y..D.LS........A.T..G.G......SS....S.Y--.........................................................................ADYT.S..GNLH.HVTIS....N.......L..TYST.RYY.......Y..RI...............GEG...GS.................................---.--..-----ddrhlvfasefvt..............................
M0WKF6_HORVD/63-176                    ....................................................PEQIAVAL.....SA.-...A....PT..................SA..WVSWI..T...G...............................Dfqmgga......vkpldpG.........T..VGS.......................VVRYG.LA.....A.DS.....................................V..V.RE........A.T..G.D......AL....V.YSQlyp..................................................................feglQNYT.S..GIIH.HVRLQ....G.......L..EPGT.KYY.......Y..QC...............GDP...AIp...............................gAMS.AV..HAFRT...........................................
A0A0L0D9T5_THETB/138-241               ..................................................pt--MGHLAL.....GE.-...A....AG..................SM..SISWT..T...R...............................D..................L.........-..GTP.......................MVRWG.AS.....P.DS.....................................L..D.AQ........A.P..A.T......TT....T.YTTgdlcna.............................................................panesvNFIK.P..GSLH.TAVMT....G.......L..KPGA.TVY.......Y..TY...............GSE...AF.................................GWA.EV..ASFV-a..........................................
E3LJQ2_CAERE/43-136                    ....................................................PEQIRLAY.....GG.-...D....ES..................TY..SVTWQ..T...Y...............................D..................D.........T..LKS.......................IVEYG.TD.....I.SD.....................................L..K.NS........V.E..G.R......CA....V.FLD.........................................................................GQKH.SvwRYIH.RVNLT....G.......L..EPGT.RYY.......Y..HV...............GSE...H-.................................GWS.PI..FFFT-a..........................................
A0A0G1QVM7_9BACT/1483-1570             ...............................................pavel--------.....--.-...T....TT..................SA..KITWD..T...D...............................K..................A.........S..DSK.......................VVYAG.VQ.....S.KP.....................................S..S.FD........G.Y..P.S......QG....S.-TA.........................................................................LATS.G..TDAH.NVTLV....G.......L..QPGT.RYF.......Y..EI...............RSA...VS.................................GNS.--..-----tpgtknse...................................
U5RWF2_9CLOT/45-112                    ....................................................PDHITLTW.....TK.D...P....KT..................TQ..TITWR..T...S...............................T..................N.........V..TKG.......................LVQYK.NL.....T.TG.....................................E..T.KT........F.N..A.T......KQ....D.FST.........................................................................S---.-..----.-----....-.......-..----.---.......-..--...............---...--.................................---.--..-----stdintgcinllfl.............................
A0A090SHU6_9VIBR/310-404               ....................................................PRHVFFTP.....GV.-...D....SS..................EV..QVTWF..T...D...............................T..................A.........M..DAT.......................YAYYG.KN.....G.NP.....................................N..Q.HA........S.M..T.E......SE....-.ILPff.....................................................................ygPESG.V..VRVH.HATFT....G.......L..EPNT.EYS.......Y..YV...............AND...F-.................................ARS.ET..FTFRT...........................................
M8ARZ8_TRIUA/143-248                   ....................................................PEQVHLAF.....AD.-...R....AD..................EM..RVMFV..C...A...............................D..................A.........-..GKR.......................AVRYG.LE.....K.EE.....................................E..K.GW........A.EvgT.E......VR....T.YEQkhmcda.............................................................pandsvGWRD.P..GFVF.DGLMN....G.......L..EPGR.RYF.......Y..KV...............GSD...PG.................................GWS.KT..YSF--is.........................................
A0A0G0MNR8_9BACT/2024-2108             .............................................apfvssi--------.....--.-...T....TK..................KA..QITWS..T...S...............................R..................A.........-..SDS.......................KIAFG.TK.....S.GL.....................................Y..F.EE........E.P..-.-......--....-.---.........................................................................SNSD.Q..VTSH.SINLS....G.......L..NPNT.TYF.......Y..VAkw...........tdEDG...NT.................................GIS.EE..KSFKT...........................................
E3NT34_CAERE/20-115                    ...................................................v-EQVHLSL.....SG.-...K....MD..................EM..VVTWL..T...Q...............................G..................Pl.......pN..VTP.......................YVTYG.LS.....K.DS.....................................L..R.WT........A.K..A.T......TT....S.WKDq.......................................................................gSHGY.I..RYTH.RATIT....K.......M..IAGD.VYY.......Y..KV...............GSS...Q-.................................DMS.DV..YHFK-q..........................................
A0A068SCY1_9FUNG/62-166                ....................................................PQQIHLSF.....GS.-...D....SK..................YA..RIQFA..T...L...............................S..................P.........I..DQA.......................VLKYW.PK.....S.RH.....................................V..S.TS........S.K..K.P......VT....H.LRGeswt................................................................ftdggALQR.E..LYMH.MIKTK....N.......L..KAAT.VYA.......Y..QV...............GAT...TCn..............................gtEWG.PE..LEFHT...........................................
C0PDY0_MAIZE/66-179                    ....................................................PEQIAVAL.....SA.-...S....PT..................SA..WVSWI..T...G...............................Dyqmgga......vepldpG.........A..VGS.......................VVRYG.LA.....A.DA.....................................L..D.HE........A.T..G.E......SL....V.YSQlyp..................................................................feglQNYT.S..GIIH.HVRLQ....G.......L..EPGT.RYL.......Y..RC...............GDP...AIp...............................dAMS.DV..HAFRT...........................................
B4L6R8_DROMO/1-95                      ...............................................mhrcl-----LSF.....AD.-...S....LQ..................DI..VVTWS..T...R...............................S..................S.........T..NQS.......................LVNFA.QD.....Y.VH....................................dA..L.SS........V.S..G.S......WQ....F.FQDg.......................................................................gKQGR.S..QYIH.KVTLS....S.......L..KPNT.HYE.......Y..SC...............GSD...L-.................................GWS.AV..YSFKT...........................................
Q86IH2_DICDI/184-299                   ..................................................ic--NFILTV.....PE.N...L....SN..................SI..IVGWH..S...N...............................D..................E.........P..IGS.......................FAYYD.TT.....S.HSdyfkdglv....................mkienfknlY..G.FS........V.N..G.T......YF....E.MDN........................................................................iRQEE.Q..RYVS.WADIT....G.......L..TPST.VYY.......I..VV...............GIE...KSdg.............................elIFY.PE..RKFRT...........................................
W4FTY6_9STRA/128-237                   ....................................................PQHGHLAF.....ND.-...H....ID..................QM..VIMYN..S...A...............................S..................N.........R..TIP.......................SVKYS.RR.....D.PSg..................................stN..V.FV........R.S..G.T......SS....T.YSAsdmchmp...........................................................ativgqqWFRH.P..GYMH.TVVMD....S.......L..DLNA.TYS.......Y..QF...............GND...ID.................................GWS.AT..YSFQ-s..........................................
Q741N5_MYCPA/69-162                    ..................................................va--GLHLQF.....GK.N...A....GT..................EV..VVSWH..S...T...............................D..................A.........V..RNP.......................RVVFG.TP.....A.SG.....................................F..G.RT........V.A..A.D......TR....T.YRD........................................................................aKSGI.E..VRVN.HARLT....G.......L..TPDT.DYV.......Y..AA...............LHD...G-.................................AQ-.--..-----pqqgtvrt...................................
A0A0B0M7C6_GOSAR/169-277               ................................................plyp----RLAQ.....GK.-...S....WS..................EM..TVTWT..S...G...............................Y..................Di.......dE..AVP.......................FVEWG.RK.....G.DL.....................................Q..V.RS........P.A..G.T......-L....T.FKQnsmcg..............................................................spastvGWRD.P..GFIH.TSFLK....D.......L..WPNF.IYM.......Y..RM...............GHLl.yNGs...............................vVWS.KT..YSFK-s..........................................
A0A0D2S6J5_GOSRA/80-183                ................................................plyg----HLSS.....ID.S...S....AT..................SM..RLTWI..S...G...............................D..................K.........-..KPQ.......................QVIYG.NG.....K.SQ.....................................I..S.QV........T.T..F.S......QD....-.--Dmcgstfi...........................................................pspaqdfGWHD.P..GYVH.TAIIT....G.......L..QPST.IFN.......Y..KY...............GSD...AV.................................GWS.DE..IEFRT...........................................
A0A0D2W8U8_GOSRA/56-147                ....................................................PQQVHITQ.....GN.Y...D....GN..................AV..IISWI..T...F...............................D..................E.........P..GSS.......................KVQYG.KS.....D.KN.....................................Y..E.FS........A.E..G.K......MT....N.YTF.........................................................................YKYN.S..GYIH.HVLVD....G.......L..EYDT.KYY.......Y..KT...............GDG...D-.................................-SA.RE..FWFQT...........................................
A0A0G0QNR1_9BACT/45-135                .................................................tpq----NITF.....TN.I...T....ED..................SV..VISWK..T...N...............................S..................A.........-..AAS.......................FITWG.QN.....D.PR.....................................E..K.TV........L.D..D.R......DL....S.ANA.........................................................................AGPK.P..RSIH.YVTLK....N.......L..LPKT.RYQ.......F..KI...............ISG...K-.................................LAS.ET..LNFET...........................................
S2XLY7_9BACL/483-586                   .................................................ftp----TVNV.....GA.-...T....DE..................EV..GITLV..T...D...............................S..................V.........L..KEA.......................HVQYM.PT.....S.EK.....................................D..W.SN........A.S..V.M......ET....K.VSYfesay..............................................................genidnSSYR.V..LASH.EADLA....D.......L..KRGT.TYQ.......Y..RY...............GLT..pEG.................................PWG.QA..YSFET...........................................
V6MGX3_9BACL/38-138                    ....................................................PHSVVTNF.....KG.N...P....QT..................SR..AFTWH..T...K...............................S..................P.........D..AAT.......................VLQLA.PG.....S.GVtsf...............................dgkD..V.MT........F.Y..G.K......TS....Q.IRL.........................................................................KDGV.L..QGVH.KVEAT....D.......L..APGT.RYS.......Y..RV...............GNG...EK................................nGWS.QP..AEFET...........................................
W9RG64_9ROSA/50-137                    ....................................................PQQVHISL.....VG.-...-....KD..................GM..RVSWV..T...E...............................H..................K.........H..TKS.......................TVEYG.TT.....P.GK.....................................Y..N.AA........A.T..G.E......HA....S.YQY.........................................................................FFYK.S..GTIH.HVTIG....P.......L..EPGT.TYY.......Y..RC...............GGS...G-.................................---.PE..FSFRT...........................................
F7EI35_MACMU/32-125                    ....................................................PEQVHLSY.....PG.-...E....PG..................SM..TVTWT..T...W...............................V..................P.........-..TRS.......................EVQFG.LQ.....P.SG....................................pL..P.LR........A.Q..G.T......FV....P.FVDg.......................................................................gILRR.K..LYIH.RVTLR....K.......L..LPGV.QYV.......Y..RC...............GSA...Q-.................................GWS.RR..FRFR-a..........................................
V7AEU9_PHAVU/54-145                    ....................................................PQQVHITQ.....GD.L...V....GR..................AM..IISWV..T...M...............................D..................E.........P..GSS.......................AVRYW.SE.....K.NG.....................................R..K.RI........A.K..G.K......MS....T.YRF.........................................................................FNYS.S..GFIH.HTTIR....K.......L..KYNT.KYY.......Y..EV...............GLR...N-.................................-TT.RR..FSFIT...........................................
A0A102CZU7_9BACT/41-138                ....................................................PDRIMLTW.....SG.D...P....AT..................TQ..AVTWR..T...D...............................A..................S.........V..TEA.......................VAELA.VA.....T.AGpg................................frdS..V.TT........V.A..A.T......TS....A.LE-.........................................................................TESG.L..AHYH.SVVFT....D.......L..RPNT.RYV.......Y..RV...............GDG...AE.................................HWS.EW..IQFRT...........................................
R7DJF1_9PORP/612-696                   ..............................................qpepyl--------.....QS.K...T....TE..................SI..LINWR..S...A...............................D..................G........eE..GVP.......................TVEYG.TT.....D.LN.....................................L..-.-T........V.T..G.T......TK....S.V--.........................................................................---G.S..LKWS.GVRLT....G.......L..SPDT.EYQ.......Y..RC...............RIG...D-.................................NIS.EV..YKFRT...........................................
A0A0C1MXN9_9CYAN/19-103                ................................................vrgp----YLQL.....GS.-...-....ES..................SI..AIRWA..T...D...............................T..................P.........-..VQG.......................RVWYG.ES.....P.ER.....................................L..C.LV........Q.D..E.T......T-....-.---.........................................................................----.I..ACNH.AVKLS....Q.......L..APDT.KYY.......Y..AV...............GTP...EGl..............................laGKT.ED..FFF--vt.........................................
A0A0A2TMD8_9FIRM/46-138                ....................................................PEQIILTW.....SG.D...P....ET..................SQ..TITWL..M...P...............................D..................N.........-..SSA.......................QVQYL.RA.....E.EF.....................................T..G.SF........A.A..A.Q......QM....D.GGG........................................................................tAFDS.T..HYRY.TVNIT....G.......L..MPNE.KYF.......Y..RV...............GRE...G-.................................AWS.QT..LSFST...........................................
A0A0G0Y1S6_9BACT/1110-1209             ..............................................etessv--------.....--.-...S....SS..................SV..TITWD..T...D...............................F..................E.........-..TTS.......................RVIYD.TV.....S.HDpan..............................ptfdD..P.FD........K.Y..G.Y......AN....T.TDEf.......................................................................dTGEG.K..TISH.SVDIS....G.......L..TAGT.TYH.......Y..RT...............ISH...GSp...............................eAVG.DE..QNFSTs..........................................
B9RHA3_RICCO/58-149                    ....................................................PQQVHITQ.....GD.H...D....GK..................AV..IVSWV..T...E...............................D..................E.........P..GSS.......................NVLYW.SK.....S.SP.....................................H..K.KQ........A.K..G.K......YT....T.YKF.........................................................................YNYT.S..GYIH.HCTIR....N.......L..EYNT.KYY.......Y..AV...............GIG...H-.................................-TT.RQ..FWFVT...........................................
W2Q499_PHYPN/198-304                   ....................................................PKHVHTAY.....GR.-...T....PG..................SL..AVQWM..T...K...............................E..................Fc.......gK..GNA.......................QLQMV.EG.....Y.HArieve..........................gpnatpV..T.AW........A.N..T.T......LF....E.DDG.........................................................................EKQS.K..RWLH.VVRLE....G.......L..KPDT.RYT.......Y..VV...............GNA..yYT.................................SWS.IP..YVTKT...........................................
W9RRF3_9ROSA/1-76                      ....................................................--------.....--.-...-....--..................-M..RVSWI..T...E...............................S..................S.........S..SLA.......................KVDYG.LS.....P.GS.....................................Y..G.YT........A.S..G.T......TS....S.YKY.........................................................................LLYE.S..GAIR.DVVIG....P.......L..KPST.VYY.......Y..RC...............GPN...L-.................................--S.PE..FSFKT...........................................
M0SE93_MUSAM/55-146                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...E...............................S..................E.........T..GTS.......................EVLYG.TE.....E.HK.....................................Y..E.HI........A.Q..G.T......TT....N.YTF.........................................................................YNYK.S..GFIH.HCLVD....G.......L..KYNT.KYH.......Y..KI...............GTG...A-.................................-SA.RE..FWFQT...........................................
A0A0S9R9N1_9ACTN/35-128                ....................................................PMAVVLTP.....AA.-...T....SA..................SQ..VVTWR..S...V...............................K..................A.........W..GNQ.......................RVVAQ.PV.....G.GG.....................................T..Q.VR........A.A..A.R......RK....A.ATSv.......................................................................rDSGS.A..RPAY.TATLT....G.......L..EPGT.RYR.......Y..RV...............VND...G-.................................GSA.GD..YHFTT...........................................
Q5BAS0_EMENI/33-121                    ...................................................p-VQQRLAI.....YG.-...-....PN..................SI..SIGWN..T...Y...............................E..................K.........L..NES.......................CVEYG.TS.....S.EK.....................................L..D.RR........A.C..A.L......VE....P.TT-.........................................................................YPTS.R..TYEN.VVILT....D.......L..TAGT.TYY.......Y..KI...............VST...N-.................................--S.TV..DHF--lsp........................................
A0A0D3H2H4_9ORYZ/244-355               ................................................pvyp----RLAQ.....GK.-...S....YD..................EM..TVTWT..S...G...............................Y..................Di.......sE..AYP.......................FVEWG.MV.....V.AGa..................................aaP..T.RT........A.A..G.T......-L....T.FNRgsmcg..............................................................epartvGWRD.P..GFIH.TAFLR....D.......L..WPNK.EYY.......Y..KI...............GHE..lSDg..............................siVWG.KQ..YTFR-a..........................................
A0A0G1Q468_9BACT/1007-1100             .............................................isaeass--------.....-E.V...T....ST..................ST..TITWT..T...D...............................D..................P.........-..STS.......................RVIYD.MV.....S.HG....................................eL..G.AA........P.N..Y.G......YA....N.STV.........................................................................EDST.K..VTAH.SVDIT....G.......L..TAGT.TYY.......Y..RT...............ISH...GSp...............................eAVS.EE..KSVTT...........................................
H3GMG0_PHYRM/183-288                   ....................................................PKHGHLSL.....TD.-...D....ET..................AM..VIMFN..S...G...............................S..................N.........-..KKP.......................VVKYG.ES.....P.QN.....................................L..D.SQ........A.T..G.T......ST....T.YGAgdmchpp...........................................................attlgqrSFRD.P..GFMH.TIIMT....D.......L..KPDT.YYY.......Y..QY...............GHE...EY.................................VWS.HV..RRFK-s..........................................
I1LP05_SOYBN/106-208                   ................................................plyg----HLSS.....ID.S...T....GT..................SM..RLTWV..S...G...............................D..................K.........-..EPQ.......................QIQYG.NG.....K.TV.....................................A..S.AV........T.T..F.S......QD....-.--Dmcssal............................................................pspakdfGWHD.P..GYIH.SALMT....G.......L..KPSS.TFS.......Y..RY...............GSG...WV.................................GWS.EQ..IKFST...........................................
A0A059AEB4_EUCGR/219-322               ................................................plyg----HLSS.....ID.S...T....GT..................SM..RITWV..S...G...............................D..................K.........-..EPQ.......................EVQYG.DG.....K.SQ.....................................T..S.EV........S.T..F.S......QD....D.MCTgnvlh..............................................................spakdfGWHD.P..GYIH.SAVMT....G.......L..QPST.SYP.......Y..KY...............GSD...SA.................................GWS.QQ..VQFRT...........................................
V4TFD7_9ROSI/142-245                   ....................................................PEQVHLAF.....TE.-...D....AS..................EM..RVMFL..A...E...............................D..................G.........-..EKR.......................YVKYG.EK.....K.DQ.....................................M..G.QV........A.A..T.S......VE....R.YERdqmcdk.............................................................panssiGWRD.P..GWIF.DAVIK....G.......L..KKGV.RYY.......Y..KV...............GSD...SK.................................GWS.ET..HSFV-s..........................................
A0A0G0GHW0_9BACT/189-277               ................................................pvis----NLNV.....TN.V...K....SH..................KA..TINWT..T...D...............................T..................K.........-..SNT.......................MVWIS.KT.....S.PV.....................................D..T.NL........A.K..Y.S......--....-.---.........................................................................-RKA.L..VLNH.KMELK....K.......L..EANT.KYY.......V..VV...............GSK...NKa..............................giTKS.AE..MSFTT...........................................
G3J4A5_CORMM/73-174                    .................................................inv---ISLSY.....AG.-...-....ST..................GV..NIHYQ..T...P...............................F..................G........lG..SAP.......................SVRWG.TS.....R.DA.....................................L..E.KT........A.N..G.A......SH....S.YDRtppc.................................................................sevaVTQC.S..QHYH.DVQIK....D.......L..APGT.TYY.......Y..QI...............TAA...NG................................tTAS.DV..LHFAT...........................................
D2VCD2_NAEGR/31-130                    ....................................................PRELHLAF.....TN.-...N....PN..................EL..VVSFH..T...S...............................N..................Yse.....qlL..GKP.......................LITFS.TS.....E.NLa...................................nY..E.TA........S.I..G.S......VV....T.SYG.........................................................................DSSK.T..GFDF.HVLLT....N.......L..KFAT.KYY.......Y..KC...............GFE...KA................................eFLS.ET..FFFYT...........................................
A0A078FNU1_BRANA/173-280               ................................................pvyp----RLAL.....GK.-...E....WD..................EM..TVTWT..S...G...............................Yg................lK.........I..AEP.......................VVEWG.VK.....G.ERklspa...........................gtltfA..-.--........-.-..-.-......--....-.--Rntmcg..............................................................apartvGWRD.P..GYIH.TAFLK....E.......L..WPNA.KYT.......Y..RV...............GHR..lSNd..............................afVWS.KV..YQFK-s..........................................
A0A059DFL1_EUCGR/1-75                  ....................................................--------.....--.-...-....--..................-M..RISWI..T...Q...............................G..................S.........-..APP.......................TVEYG.KS.....P.GV.....................................Y..P.GS........S.T..G.S......TT....S.YKY.........................................................................ALYN.S..GEIH.EAVIG....P.......L..EPNT.VYY.......Y..RC...............SSD...S-.................................--A.RE..FSFKT...........................................
M4F891_BRARP/61-152                    ....................................................PQQVHITQ.....GD.V...E....GK..................AV..IVSWV..T...Q...............................E..................A.........P..GSD.......................TVLYW.KE.....N.SS.....................................K..K.LK........A.Y..G.K......SK....T.YKF.........................................................................YNYT.S..GHIH.HCTIR....N.......L..EYDT.KYY.......Y..VV...............GVG...Q-.................................TER.EF..Y----fft........................................
R6DVD1_9FIRM/34-128                    ...................................................v-TRVSCAF.....NG.D...S....QT..................SR..GFCWY..T...E...............................T..................Y.........-..TRS.......................DVQII.KT.....S.DF.....................................N..G.SY........A.N..A.T......EY....-.-SAg......................................................................niYKFR.D..LYCH.KVTVD....N.......L..EPGT.SYT.......Y..RV...............GDR...SL................................nLWS.GD..GTFKT...........................................
R0G4V5_9BRAS/57-148                    ....................................................PQQVHITQ.....GD.V...E....GK..................AV..IVSWV..T...Q...............................E..................A.........K..GSN.......................KVIYW.KE.....N.SS.....................................K..K.YK........A.H..G.K......TN....T.YKY.........................................................................YNYT.S..GYIH.HCPIR....N.......L..EYDT.KYY.......Y..VV...............GVG...E-.................................-TE.RQ..-----fwfft......................................
I3LZ30_ICTTR/32-125                    ....................................................PEQVHLSY.....PG.-...E....PG..................SM..TVTWT..T...W...............................V..................P.........-..APS.......................EVQFG.LQ.....P.SG....................................pL..P.LR........A.R..G.S......AR....P.FVDg.......................................................................gILRR.T..LYMH.RVTLR....G.......L..LPGV.QYV.......Y..RC...............GSA...Q-.................................GWS.RR..FRFR-a..........................................
A0A0E0MQ19_ORYPU/564-656               ....................................................PEQVHITL.....GD.L...T....GR..................AM..IVSWV..T...P...............................K..................L.........P..DTN.......................VVRYG.LR.....A.DN.....................................L..T.HT........A.N..G.T......LR....R.YSF........................................................................gRKYR.S..GFIH.HATLT....G.......L..DHAT.KYH.......Y..AV...............GSG...A-.................................-TA.RS..FSFTT...........................................
A0A087SN34_AUXPR/76-188                ....................................................PEQVSVTY.....YG.-...-....PT..................SV..RFGWA..T...G...............................Qaqtgyg......alegfhD.........S..TGS.......................NVQLG.LS.....P.SA.....................................Y..T.DV........L.E..G.T......SS....H.YDQiyyg.................................................................fsnaLNYT.S..PKLH.SVVVE....D.......L..TPNT.SYF.......Y..RV...............GDL...KS................................qYWS.EE..YNFTT...........................................
Q764C1_PHAVU/60-151                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...P...............................D..................E.........P..GPN.......................HVQYG.TS.....E.SK.....................................F..Q.TS........L.E..G.T......VT....N.YTF.........................................................................YEYK.S..GYIH.HCVIE....G.......L..EYKT.KYY.......Y..RI...............GSG...D-.................................-SS.RE..FWFET...........................................
A0A0L8HI16_OCTBM/36-138                ..................................................vr--TVHISF.....GN.-...K....TN..................QI..CILWC..S...Tnl...........................dyD..................K.........N..IPP.......................RVRYG.FT.....K.SL.....................................L..S.QI........S.I..G.K......TV....Q.F--.........................................................................NSAK.K..RFFH.RVVLS....N.......L..LPEN.TYY.......Y..QI...............IRQ...NKs..............................nsYLD.PI..ESF--tvpqspt....................................
Q9U309_CAEEL/22-117                    ...................................................v-EQVHLSL.....SG.-...K....MD..................EM..VVTWL..T...Q...............................G..................Pl.......pN..VTP.......................YVMYG.LS.....K.DA.....................................L..R.WT........A.K..A.T......TT....S.WKDq.......................................................................gSHGY.V..RYTH.RATMT....K.......M..VPGD.TYY.......Y..KV...............GSS...Q-.................................DMS.DV..YHFH-q..........................................
A0A0F7GCR8_9CHLR/40-132                ..............................................itgvav--------.....SN.I...G....YS..................GA..VISWQ..T...N...............................A..................A.........-..ATS.......................QVFYG.TA.....A.HA.....................................D..T.AD........Y.T..R.Q......TT....-.---.........................................................................VDTS.L..VLSH.SVSLT....G.......L..APGT.TYH.......F..RVrs..........vftGDG...ES................................iAVS.LD..YTFVT...........................................
A0A0G0YV40_9BACT/29-117                ...............................................kfsnv------NV.....YG.I...K....NG..................TA..KISWD..T...F...............................S..................E.........P..TKA.......................FVSYG.TS.....A.DN.....................................L..G.KK........I.D..-.-......Y-....-.---.........................................................................--GV.Y..DYNH.ETTLT....G.......L..EKDV.TYY.......Y..KI...............IAV...--.................................---.--..-----tkadeakelflqtfstk..........................
A0A0E3WGT0_9BACL/607-706               ....................................................PEYVRIYV.....TE.D...M....KT..................TQ..SIVWK..T...A...............................P..................R.........V..ERG.......................VIQYV.EA.....S.KF.....................................T..G.FD........Q.P..N.I......KE....Q.TAEpql..................................................................llapDRVG.E..TLFH.KGMLQ....S.......L..SPGT.EYI.......Y..RV...............GSP...G-.................................LWS.EQ..HRFTT...........................................
W2ZET4_PHYPR/174-279                   ....................................................PKHGHLSL.....TD.-...D....ET..................AM..AILFN..S...G...............................S..................S.........-..KTP.......................MVKYG.EN.....P.QD.....................................L..K.FH........A.T..G.T......TT....T.YGAddlchep...........................................................anvlgqrAFRD.P..GFMH.TVIMT....D.......L..KPDT.YYY.......Y..QY...............GHE...GH.................................ALS.HV..RRFK-s..........................................
A0A0B0MRB3_GOSAR/69-181                ....................................................PEQISVSL.....SV.-...N....YD..................SV..WISWI..T...G...............................Efqvgnk......ikplnpN.........T..VAS.......................VVRYG.RS.....R.VP.....................................L..T.DE........A.S..G.H......SL....V.YNQlyp..................................................................feglQNYT.S..GIIH.HVRLT....G.......L..KPST.LYY.......Y..RC...............GDP...SI................................sAMS.DI..YHFRT...........................................
V4UUX0_9ROSI/87-174                    ....................................................PQQVHISL.....VG.-...-....QD..................RM..RISWI..T...E...............................N..................S.........-..SPA.......................TVKYG.TS.....P.GV.....................................Y..D.NS........A.N..G.T......TS....S.YHY.........................................................................VLYK.S..GEIH.DVVVG....P.......L..KANT.VYY.......Y..RC...............GPD...S-.................................--A.QE..RSFKT...........................................
D8UDV5_VOLCA/84-198                    ....................................................PWGVHLTG.....PY.P...D....GT..................TY..LVSWL..T...G...............................Aptig..........rnpaQ.........-..--Pnts................slitHAAVT.PA.....Q.GG.....................................T..E.TR........F.A..G.S......II....T.YLRlysd................................................................ttlanYSYL.S..PYIH.HVILA....N.......L..APST.TYN.......Y..KV...............SCR...NG.................................SLA.GN..YSFKT...........................................
F3Z681_9ACTN/60-155                    ..................................................at--GIILGV.....GA.-...N....ET..................QR..TVSWY..T...A...............................E..................D.........-..SAQ.......................QVQLV.PT.....A.RL.....................................A..N.GE........F.P..A.D......AA....V.FDAsg....................................................................sanIATS.G..GFNR.HATLT....G.......L..QEHT.AYS.......Y..RV...............GTA...G-.................................SWS.PT..YSFKT...........................................
A0A067RT69_ZOONE/23-114                ....................................................PEQIHLSF.....GD.-...T....VN..................DV..VVTWN..T...I...............................N..................D.........T..EES.......................LVEYS.FG.....G.LN.....................................L..T.AN........G.T..S.T......LF....V.SGG.........................................................................KEKR.K..QYIH.RVKLP....N.......L..ARGI.KYT.......Y..HC...............GSG...K-.................................GWS.DK..FWFKT...........................................
V9F974_PHYPR/174-279                   ....................................................PKHGHLSL.....TD.-...D....ET..................DM..AILFN..S...G...............................S..................S.........-..KTP.......................MVKYG.EN.....P.QD.....................................L..K.FH........A.T..G.T......TT....T.YGAddlchep...........................................................anvlgqrAFRD.P..GFMH.TVIMT....D.......L..KPDT.YYY.......Y..QY...............GHE...GH.................................ALS.HV..RRFK-s..........................................
A0A168LPI5_9BACL/528-625               ..................................................is--KVTVTF.....NG.D...T....TT..................AK..GFTWY..T...P...............................K..................T.........S..TGN.......................DLQVV.EK.....S.SDga................................dftK..S.TR........F.N..G.R......SA....-.I-S.........................................................................TNSP.N..ERLH.KAEAT....N.......L..KPDT.MYY.......F..RV...............GDAw.lN-.................................SWS.DV..GTFRT...........................................
A0A0J7XZ74_9SPHN/38-134                ....................................................PDRIVLTA.....GA.D...P....AR..................EM..AVSFR..T...D...............................G..................A.........Q..GDA.......................QAQIA.VA.....V.DGpt................................lerE..A.RT........I.I..G.T......TR....P.IE-.........................................................................SANG.A..ANYH.QVRFT....G.......L..EPGR.AYA.......Y..RV...............KGA...A-.................................GWS.EW..LQFRT...........................................
R6WW38_9PORP/269-363                   ..............................................ylqnpv--------.....--.-...-....GN..................GI..TVMWQ..T...T...............................V..................P.........-..TYS.......................WVEYG.TD.....K.EH.....................................L..Q.KA........R.T..I.V......--....-.-DG.........................................................................QVIC.N..NLQN.KIRLD....G.......L..EPGK.TYY.......Y..RV...............CSQ...EImlyqa.......................ykkvfG--.--..-----etavsdfhtft................................
H9JFJ6_BOMMO/807-898                   ....................................................PEQIHIAF.....GE.-...K....TN..................DI..KITWS..T...F...............................N..................D.........T..QES.......................TVEYG.EG.....I.ME.....................................K..E.AT........G.S..A.T......LF....T.DGG.........................................................................KEKR.S..QWIH.TVLLK....D.......L..KFNT.RYV.......Y..HV...............GSV...Y-.................................GWS.EL..FSFKT...........................................
B6IEC7_CAEBR/20-104                    ....................................................PEQVHIAF.....YT.-...S....PW..................DI..SVSWI..T...F...............................E..................Q.........-..AEP.......................SLSFG.TS.....T.ST.....................................M..-.QD........V.S..G.T......TN....T.WVF.........................................................................-GGI.T..RHSH.SVILK....D.......L..KPST.QYY.......Y..QI...............QN-...--.................................---.--..-----rlfnfrsl...................................
A0A166GFG1_DAUCA/56-147                ....................................................PQQVHITQ.....GD.H...E....GK..................AM..IVSWV..T...M...............................E..................E.........P..GSS.......................TVSYW.SE.....N.SK.....................................H..K.NK........A.M..G.N......FN....T.YKY.........................................................................YNYT.S..GYIH.HCTLR....N.......L..KFDT.KYF.......Y..EV...............GIG...Q-.................................-TP.RT..FWF--vt.........................................
R6EIX1_9FIRM/1-85                      ..................................................mt-------P.....GE.-...D....NT..................KM..NFSWQ..S...S...............................F..................K.........S..SKA.......................EIEVG.TK.....Q.DM.....................................S..D.AQ........S.L..D.V......ES....K.F--.........................................................................NIFC.F..EYTH.EATAS....E.......L..EADT.TYY.......Y..KY...............YAD...K-.................................TWS.DV..YSFTT...........................................
A0A151T035_CAJCA/50-161                ....................................................PEQIALAI.....SS.-...-....PT..................SM..WVSWV..T...G...............................Daqigln......vtpvdpA.........S..VGS.......................EVWYG.KE.....S.GK.....................................Y..T.GV........G.K..G.D......SV....V.YSQlyp..................................................................feglWNYT.S..GIIH.HVKLE....G.......L..EPGT.RYY.......Y..KC...............GDS...SI................................pAMS.QE..HFFET...........................................
A0A0S6XU45_9FUNG/37-124                ....................................................PVQIRLSY.....QG.-...-....PT..................AM..VVSWN..T...F...............................K..................Q.........L..EHP.......................TVYYG.LE.....P.YV.....................................L..Y.DR........A.S..S.D......NS....-.YT-.........................................................................YPTA.L..TYIN.HVNLT....N.......L..LPDT.TYY.......Y..LP...............AHS...N-.................................-AT.KP..LSFRT...........................................
D2W3L7_NAEGR/22-122                    ....................................................PSQVHLAL.....TR.-...N....SR..................EM..IVSFH..T...Egy...........................dkD..................V.........L..GKA.......................QVMYS.TN.....E.NF.....................................Q..D.YQ........V.AhlG.S......VS....T.TYG.........................................................................ESAK.T..GYEH.HVLLV....D.......L..EYST.KYY.......Y..KC...............GFT...KSt...............................dIQS.EV..YYFHT...........................................
A0A0G0EZ74_9BACT/579-666               .............................................iskisak--------.....--.I...T....KN..................TV..TVRWI..T...N...............................L..................L.........-..SSS.......................KIIYS.RQ.....S.SD.....................................L..L.SN........S.T..T.S......--....-.---.........................................................................SDLN.L..VKNH.ALTIN....Y.......L..TPNT.KYW.......Y..KV...............VST..pENg..............................keIES.AI..YSFKT...........................................
A0A0G0PFY8_9BACT/43-128                ................................................pkdi----RISN.....I-.-...D....NS..................SA..TISWI..T...D...............................K..................E.........-..TFS.......................FVSWG.EG.....Q.TS.....................................L..N.KI........E.R..-.-......--....-.---.........................................................................EGNE.K..LSIH.TISLT....G.......L..KPGT.KYF.......Y..KI...............NSG...GT.................................---.--..-----mfdnkgipwqfst..............................
V4MED8_EUTSA/58-148                    ....................................................PQQVHITQ.....GD.V...E....GK..................AV..IVSWV..T...Q...............................S..................K.........-..GSN.......................TVLYW.KE.....N.SS.....................................K..K.LK........A.H..G.K......TN....T.YKF.........................................................................YNYT.S..RYIH.HCTIR....H.......L..EYDS.KYY.......Y..VV...............GVG...E-.................................-TE.R-..-----kfwfft.....................................
M4B968_HYAAE/134-239                   ....................................................PKQGHIAF.....TE.-...N....ED..................EM..SVMFN..S...A...............................S..................Q.........-..EIP.......................VVKYG.LD.....A.SA.....................................L..D.QQ........A.E..G.K......SK....T.YTAahlcsyp...........................................................anhssqqWFRD.P..GYMH.RVVLK....G.......L..NLGT.RYF.......Y..KF...............GSD...KD.................................GWS.SV..YSF--ms.........................................
V9GH45_9BACL/51-148                    ...................................................v-SKVTVTF.....HG.D...T....TT..................SK..GFTWY..T...S...............................Q..................Q.........V..TGS.......................DLQVI.EK.....T.SA.....................................A..P.DF........M.N..A.N......SF....S.GRRt......................................................................psTNSP.T..ELVH.KAEAT....K.......L..KPNT.TYY.......F..RV...............GDA...SL................................nVWS.DV..GTFQT...........................................
A0A0M3C9T5_9SPHI/32-142                ...........................................ithlpyiqg--------.....--.V...T....NS..................SV..HIIWT..T...N...............................K..................P.........-..ATG.......................WVELA.PD.....D.SS....................................hF..Y.HT........A.R..P.K......FF....A.TEY.........................................................................GFKK.V..GTVH.QVTLT....N.......L..KPGT.VYR.......Y..RI...............YSQ...E-.................................---.--..-----vlkhvgvqveygkivatnvykekplsfrt..............
K3WGB9_PYTUL/43-152                    ....................................................PSQIHIAL.....AD.A...H....RNgglnpt......nemqrvGM..TISWA..T...A...............................M..................K.........T..KTS.......................VVKFG.QN.....P.AN.....................................L..T.RE........V.R..A.Ei....pCE....Q.YEF.........................................................................CEYT.S..PWFH.HVTID....Gd.....lL..VSGT.TFY.......Y..QC...............GDE...DA.................................GWS.DV..HSFTT...........................................
A0A0K9NP95_ZOSMR/73-186                ....................................................PEQISVSL.....SA.-...K....YH..................SA..WISWI..T...G...............................Efqigdd......ikpldpS.........S..VAS.......................VVRYS.ER.....K.DM.....................................S..S.RR........V.A.iG.N......SL....I.YNQsyp..................................................................feglMNYT.S..GIIH.HVRIT....G.......L..RPRK.KYY.......Y..SC...............GDP...SI................................nSMS.DV..FVFRT...........................................
W5B898_WHEAT/142-247                   ....................................................PEQVHLAF.....AD.-...R....AD..................EM..RVMFV..C...A...............................D..................A.........-..GKR.......................AVRYG.LE.....K.EG....................................eK.gW.TE........V.G..T.E......VR....T.YEQkhmcda.............................................................pandsvGWRD.P..GFVF.DGLMN....G.......L..EPGR.RYF.......Y..KV...............GSD...PG.................................GWS.ET..YSF--is.........................................
Q2QLL9_ORYSJ/59-150                    ....................................................PQQVHITL.....GD.Q...T....GT..................AM..TVSWV..T...A...............................N..................E.........L..GSN.......................TVRYG.SS.....P.EK.....................................L..D.RA........A.E..G.S......HT....R.YDY.........................................................................FNYT.S..GFIH.HCTLT....G.......L..THAT.KYY.......Y..AM...............GFD...H-.................................-TV.RT..FSFTT...........................................
W4XDN4_STRPU/115-208                   ....................................................PEQIHIAY.....GD.-...M....PS..................EM..VIVWS..T...P...............................S..................P.........-..GSS.......................EVLYG.MA.....P.NN.....................................F..S.LK........A.S..G.D......YE....E.LVDw......................................................................egPFEG.V..KFIH.RVKLE....G.......L..SPGA.SYS.......Y..KV...............QTN...G-.................................EQS.QT..YTFT-a..........................................
A0A151UAS9_CAJCA/1-90                  ....................................................--------.....--.-...-....--..................-M..RVMYV..T...G...............................G..................H.........-..DET.......................YVRFG.ER.....E.EE.....................................L..Q.GV........A.V..A.R......VG....R.YERdhmcda.............................................................panssvGWRD.P..GYVH.DALLT....G.......L..KKGH.KYY.......Y..RV...............GND...KG.................................GWS.AT..HSFV-s..........................................
A0A0P1B5P9_9STRA/91-188                ....................................................PQQLHLAY.....AG.V...E...aGT..................AM..TVSWA..T...Y...............................A..................D.........V..TDC.......................AVWIG.ET.....E.DT.....................................L.kR.VK........A.P..I.V......SQ....S.YYS.........................................................................DKEY.F..MLHH.HATIS....G.......L..KPRT.KYF.......Y..KV...............GSK...GDe...............................kYTS.DI..NTFIT...........................................
A0A0L8H5Z7_OCTBM/1-84                  ...................................................m--------.....--.-...-....--..................--..---WS..S...V...............................V..................N.........-..CSS.......................SVKYG.DT.....M.WN.....................................K..N.YK........A.E..P.T......TV....F.FNL.........................................................................TNSLaR..HYYY.HAVLK....N.......L..KPNA.TYY.......Y..SI...............VNS...K-.................................-MV.TP..AYFKTppkgnewsps.................................
U2Q764_9CLOT/55-142                    ....................................................PKQVNVHV.....GD.D...A....ST..................SA..NFTYT..T...I...............................E..................E.........-..SPS.......................KVVLN.KV.....G.DS.....................................N..K.IT........F.E..G.T......SG....V.---.........................................................................-GTG.N..KYFH.GISTT....G.......L..QPNT.KYE.......Y..TV...............GDG..vN-.................................TF-.-N..GT---fkta.......................................
A0A0B2QG87_GLYSO/100-187               ....................................................PQQVHISL.....VG.-...-....KE..................KM..RVSWI..T...E...............................D..................K.........H..TES.......................VVEYG.TK.....A.GE.....................................Y..R.EK........A.T..G.L......HT....S.YQY.........................................................................FLYN.S..GKIH.NVVIG....P.......L..QPGT.TYF.......Y..RC...............GGS...G-.................................---.PD..FSFKT...........................................
A0A061G610_THECC/170-278               ................................................plyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Di.......dE..AEP.......................FVEWG.RK.....G.NL.....................................Q..-.LR........S.P..A.G......TL....T.FKQnsmcg..............................................................spartvGWRD.P..GFIH.TSFLK....N.......L..WPNY.EYT.......Y..RM...............GHLl.sNGs...............................iVWS.KI..YSFK-s..........................................
M4BKT0_HYAAE/50-165                    ....................................................PSQIHVAF.....AS.E...V....NVksysvirtsdsapeemrlGM..TISWS..T...A...............................Q..................K.........T..RTS.......................RVRFG.LS.....R.DD.....................................L..S.MM........Q.Q..A.Ee....rCE....Q.YDF.........................................................................CSYT.S..PWFH.HVTIP....Gd.....kL..EAAT.TYY.......Y..QC...............GDD...GG.................................GYS.RV..YSFKT...........................................
A0A0E0R4B3_ORYRU/171-259               ....................................................PQQVHISM.....VG.-...-....EK..................NM..RISWV..T...D...............................D..................L.........N..APS.......................VVEYG.TS.....P.GK.....................................Y..T.AS........A.T..G.D......HT....T.YRY.........................................................................FLYK.S..GAIH.HATIG....P.......L..EAST.TYH.......Y..RC...............GKA...GD.................................---.--..-----eftlrtp....................................
A0A0G0Y948_9BACT/44-132                ..............................................pqevki--------.....VN.T...T....DI..................SF..VVSWI..T...D...............................I..................S.........-..TSG.......................FIQYN.EA.....G.KN.....................................P..N.LT........V.S..D.D......-R....D.LEK.........................................................................GSIG.N..YFTH.FVTVR....G.......L..KPAT.KYN.......F..KI...............GSG...S-.................................---.--..-----klyeagtgvt.................................
R0G5E0_9BRAS/48-135                    ....................................................PEQVHISL.....AG.-...-....DK..................HM..RVTWV..T...S...............................D..................K.........S..SPS.......................FVEYG.TS.....P.GK.....................................Y..S.YL........G.Q..G.E......ST....S.YSY.........................................................................ILYR.S..GKIH.HTVIG....P.......L..EADT.VYY.......Y..RC...............GGE...G-.................................---.PE..F----hlkt.......................................
A0A0P7XBX9_9BACT/279-360               ..........................................nrkpyvqqvg--------.....--.-...-....TE..................DA..WISWQ..S...L...............................D..................A.........-..VVG.......................RIEIG.VE.....K.DS.....................................Y..S.RV........L.-..-.-......--....-.---.........................................................................STQG.S..GQFH.RIHVD....G.......L..QPDT.RYY.......Y..RV...............YSG...DI.................................PVS.DG..YSFKT...........................................
M0S360_MUSAM/55-146                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...E...............................S..................E.........P..GTS.......................EVWYG.AV.....E.HE.....................................F..E.HK........A.E..G.K......NT....N.YTF.........................................................................YNYK.S..GYIH.HCLVD....G.......L..EYNT.KYY.......Y..RI...............GTG...A-.................................-TA.RE..FWFQT...........................................
A0A0Q0VFN3_9SPHI/38-136                ....................................................PDRIILTW.....SQ.D...P....TT..................TQ..SVTWR..T...D...............................S..................T.........V..AKS.......................FAQIL.VE.....D.SSpkl...............................ekpA..A.KE........Y.V..A.S......IS....S.LKG.........................................................................KDYG.T..ANYH.SVTFS....D.......L..QPDQ.LYT.......Y..RV...............GDG...T-.................................NWS.EW..FQFRT...........................................
A0A0V2F806_CAUVI/46-142                ....................................................PDRVVLTA.....GA.D...P....SR..................EM..AVAWR..T...D...............................P..................R.........Q..ASA.......................EIQLA.PA.....I.DGp...................................sL..E.YR........A.K..T.L......SG....L.--Tka.....................................................................idSANG.P..ALYH.QARLT....G.......L..SPDT.AYV.......Y..RV...............KGA...D-.................................GWS.EW..LQFHT...........................................
W2PP21_PHYPN/100-198                   ....................................................PQQFHLAF.....AG.E...E...aGT..................GM..AISWT..S...F...............................A..................L.........E..ESP.......................AVWIG.TS.....E.AKv...................................aL..V.KD........A.K..I.E......TK....S.YYK.........................................................................DEKY.E..LYSY.HAVVS....G.......L..EPYT.EYF.......Y..KV...............GSA...TEk...............................kFQS.SV..SSFKT...........................................
A0A067G3U1_CITSI/176-284               ................................................pvyp----RLAQ.....GK.-...T....WN..................EM..TVTWT..S...G...............................Y..................Gi.......nE..AEA.......................FVQWG.RK.....G.GD.....................................R..T.HS........P.A..G.T......L-....T.FDRgsmcg..............................................................apartvGWRD.P..GYIH.TSFLK....E.......L..WPNA.MYT.......Y..KV...............GHRl.fNSt...............................yIWS.SE..YQFK-a..........................................
A0A0K9RS91_SPIOL/1-75                  ....................................................--------.....--.-...-....--..................-M..RISWV..T...D...............................D..................S.........Y..VPS.......................IVEYG.TS.....P.GH.....................................Y..S.AK........S.E..G.E......ST....S.YSY.........................................................................LLYK.S..GEIH.HTVIG....P.......L..NPGT.VYF.......Y..RC...............GGE...G-.................................---.--..-----pefqlrt....................................
D1BNN2_VEIPT/55-146                    ..............................................ryirqi-------V.....AQ.D...N....ST..................SR..TIMWQ..S...D...............................S..................S.........E..ADA.......................VIEYR.LV.....G.SD.....................................T..T.QT........I.R..A.T......DK....A.FT-.........................................................................DDGS.T..TYIH.EGTLT....G.......L..APNT.KYE.......Y..RV...............GYG...SD.................................RRS.AW..YSLET...........................................
A0A150ARJ3_9BACT/7-99                  ..................................................te--KYRLTL.....RD.N...P....AT..................TI..TIGWN..Q...V...............................S..................G.........-..SNP.......................VVYYG.TT.....D.YG.....................................T..N.YS........Y.Y..S.N......SK....T.VDR........................................................................sVYYK.G..MNNQ.FARLT....G.......L..KPNT.AYY.......F..VI...............RDS...Q-.................................GTS.KR..YWFKT...........................................
A0A0L0LFB6_9BACT/316-401               ...........................................issiytlei--------.....--.-...S....SN..................SA..IVTWK..T...D...............................R..................P.........-..TNS.......................KLEYG.KT.....D.NY.....................................E..S.NA........Q.V..-.-......--....-.---.........................................................................-NNS.L..ATSH.SVTLT....N.......L..SPET.VYH.......Y..RI...............RST...DEsg.............................nlTLS.ND..KTFTT...........................................
M0WQ43_HORVD/176-285                   ................................................pvfp----RLSQ.....GK.-...Q....WD..................EM..AVTWT..S...G...............................Y..................Tm.......dE..AYP.......................FVEWR.MK.....G.EE.....................................T..S.KR........T.P..A.G......TL....T.FTRghlcg..............................................................dpargqGYRD.P..GFIH.TAFLK....D.......L..WPNR.EYS.......Y..QI...............GHE..lQDg..............................tvAWG.KA..ATFR-a..........................................
A0A061FJT8_THECC/836-939               ................................................plyg----HLSS.....ID.S...T....GT..................SM..RLTWI..S...G...............................D..................K.........-..EPQ.......................QVKYG.NG.....K.SQ.....................................T..S.QV........A.T..F.S......QD....D.MCSsilip..............................................................spakdfGWHD.P..GYIH.TAVMT....G.......L..QPSS.TSY.......Y..KY...............GSD...AV.................................GWS.DR..IEFRT...........................................
A0A0K9PZS7_ZOSMR/54-146                ....................................................PQQVHITQ.....GD.D...V....GE..................GV..IVMWI..T...Q...............................D..................E.........P..GSS.......................TVLYG.TM.....E.DD.....................................L.dR.RS........T.D..G.S......FR....T.YRF.........................................................................FNYT.S..GYIH.HCHLR....N.......L..KYNT.KYY.......Y..MV...............GIG...--.................................---.--..-----lttrmfcfit.................................
T0R9R0_9STRA/191-284                   ....................................................PTRVHAAY.....GA.-...S....PS..................TF..TIQWA..T...P...............................P..................E........cT..NGR.......................HVLVV.RE.....E.AA.....................................I..D.DA........Q.A..S.R......TF....V.ANS.........................................................................IVFG.A..RYEH.VALAV....Q.......L..KSNT.RYA.......Y..YV...............GND...AY.................................SRS.IL..YSFTT...........................................
R4KH61_9FIRM/48-140                    ...................................................s-EHIILSW.....TE.D...P....GT..................TQ..TITWS..T...G...............................D..................A.........-..TRD.......................RMQYQ.PA.....A.GF.....................................S..G.S-........F.D..G.A......LE....V.IADg.......................................................................sGSNN.G..LFHF.EATIR....G.......L..TPGT.GYV.......Y..RI...............GKE...G-.................................AWS.AP..ATFTT...........................................
B4NC50_DROWI/33-137                    ....................................................PEQVHLSF.....GE.I...S....AS..................EI..VVTWS..T...L...............................S..................Lp.......pN..ASS.......................IVEYG.LL.....R.ETgqnl.............................asvpL..S.QR........A.E..G.Q......AI....K.FVDg.......................................................................gHKRA.T..QYIH.RVTLR....E.......L..KLNS.SYA.......Y..HC...............GSS..fG-.................................-WS.VL..FQFRT...........................................
G4KSE0_OSCVS/43-140                    ..................................................yt--KVSLTP.....GK.-...D....AT..................QL..NFAWY..S...K...............................D..................E........gK..ATP.......................VVHFG.TS.....K.SA.....................................L..K.PY........-.T..G.T......SA....A.VDAs.......................................................................lTGDT.A..YVYN.HTTVT....G.......L..KENT.AYY.......Y..TV...............EKN...G-.................................EQT.AV..ETYKTgsfe.......................................
U5FI45_POPTR/63-154                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...P...............................D..................E.........P..GSI.......................SVKYG.TS.....E.NS.....................................Y..D.FS........A.E..G.T......VT....N.YTF.........................................................................YKYK.S..GYIH.HCLVD....G.......L..EYDS.KYY.......Y..KI...............GEG...D-.................................-SS.RV..FWFQT...........................................
A0A087G9Y9_ARAAL/171-279               ................................................pvyp----RLSL.....GK.-...N....WD..................EM..SVTWT..S...G...............................Y..................Ni.......gE..AVP.......................FVEWS.GK.....G.IP.....................................S..R.RS........P.A..G.T......LT....-.FTRnsmcg..............................................................apartvGWRD.P..GFFH.TAFLK....D.......L..WPNL.KYT.......Y..RM...............GHEl.vNGs...............................iIWS.KN..YTFK-s..........................................
H2WND8_CAEJA/59-152                    ....................................................PEQVHLAY.....GG.-...H....PS..................AY..SLTWM..T...Y...............................D..................D.........T..LKS.......................IVEYG.TE.....I.SD.....................................L..K.WS........S.E..G.R......CA....V.FLD.........................................................................GQKH.SvwRYVH.RVNLT....G.......L..VPGT.RYY.......Y..HV...............GSE...H-.................................GWS.PI..FFFT-p..........................................
M7Z1G0_TRIUA/47-134                    ....................................................PQQVHLSV.....VG.-...-....AN..................HM..RVSWI..T...D...............................A..................K.........H..GHS.......................VVEYG.RA.....S.GN.....................................Y..T.TS........A.T..G.E......HT....S.YRY.........................................................................YLYS.S..GKIH.HVTIG....P.......L..DPDA.VYY.......Y..RC...............GMV...G-.................................---.--..-----deftlkt....................................
A0A0M0J785_9EUKA/224-336               ....................................................PFHTHVAY.....GGeD...T....QH..................SM..IVSFT..T...N...............................S..................S.........M..YGDgg...................yvSVMVG.TV.....P.GM.....................................Y..S.FN........A.T..D.I......ES....T.TYGaadlcna..........................................................panttsvdFWQW.P..GVFH.HATIR....G.......L..APST.RYY.......A..RA...............VAG...E-.................................---.--..-----fagdeitfvt.................................
A0A143Z131_9LACT/49-141                ..................................................af--HIAFAP.....GA.-...D....ET..................ER..TFSWH..T...R...............................G..................M.........D..KKA.......................VVELN.RL.....D.EK.....................................D..N.VL........S.S..E.T......FE....A.TVE.........................................................................GILR.G..QSRH.KATIT....G.......L..EQNQ.LYA.......Y..RF...............GDG...QR.................................AWS.QT..YTFRT...........................................
A0A0G0XUH2_9BACT/175-266               ..........................................viglaraidi--------.....--.-...T....AT..................EA..KIIWA..T...S...............................R..................D.........-..SNS.......................IVRFS.RE.....G.QW.....................................N..G.TD........Y.A..Q.T......VA....V.---.........................................................................-LED.S..TKSH.EVLIT....G.......L..SPAT.TYH.......F..QV...............ESE...DEfg.............................lsGAG.ED..TTFT-t..........................................
R7C4M5_9FIRM/65-191                    ...................................................w-TQISLSP.....GS.-...N....AT..................EL..NFAWY..T...P...............................K..................Q.........T..NDNnsnadveakvqaispdqkdsnvpKLIIG.EG.....R.NM.....................................K..N.AK........VyE..A.E......QT....E.VKDe......................................................................qdSNGG.T..YNSN.KVTAT....G.......L..KENK.TYY.......Y..SY...............DNG...NG.................................-YT.KP..-----aayttkskkdfsf..............................
A0A0F7TXJ3_9EURO/35-122                ....................................................PMQAHLAY.....SG.-...-....DR..................GM..TVSWN..T...Y...............................S..................K.........L..HHP.......................YVRYG.QH.....P.NA.....................................L..S.QW........A.E..S.D......VS....V.T--.........................................................................YPTS.S..TSNN.HVKIT....G.......L..EPNT.MYY.......Y..QP...............QCG...N-.................................-ST.QI..YTMKT...........................................
L1JM98_GUITH/263-382                   ....................................................PTQVRLSM.....TS.-...E....PT..................EM..RVMWV..S...E...............................A..................C.........P..GKPfg...................gaVVLFS.EE.....S.CVseage..........................evphcrY..E.HR........V.K..P.S......FT....T.YTAddlcgap...........................................................anteraqNFLD.P..GYIY.DAVMT....S.......L..EPGR.RYF.......Y..RV...............GCQ...DAp...............................gGWS.A-..-----as.........................................
M5XBB0_PRUPE/169-276                   ...............................................pvypr-----LAQ.....GK.-...L....WN..................EM..TVTWT..S...G...............................Y..................Di.......tE..ATP.......................FVEWG.SK.....G.EL.....................................V..R.SS........A.-..G.T......L-....N.FDRnslcg..............................................................apartvGWRD.P..GFIH.TAFLK....E.......L..WPNT.VYT.......Y..KV...............GHR..lSNd..............................ssILS.QE..YQFR-a..........................................
L1KYG0_9ACTN/87-192                    ....................................................PFGRHLAF.....GA.D...P....RT..................QM..RISWQ..V...P...............................L..................A.........V..KKP.......................YVRIG.LK.....P.DD.....................................L..S.RK........V.E..A.E......VR....D.LHTpgv...................................................................egvRLEL.D..QYYL.HAALD....G.......L..LPGT.TYY.......Y..GV...............GHE...GFdpa...........................spgRRA.TI..ESFR-t..........................................
A0A0B3VMH1_9FIRM/45-131                ...................................................f-TQICLTP.....GK.-...N....ET..................ML..NFSWY..S...K...............................F..................S.........D..GVS.......................KIKIC.EK.....G.GK.....................................E..-.II........Y.Q..G.K......SV....S.M--.........................................................................--GN.G..FISN.KVTVE....N.......L..KANT.TYI.......Y..SY...............ECD...G-.................................RWS.KP..LEYE-t..........................................
A0A0D9Y0R6_9ORYZ/965-1073              ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Si.......kE..AIP.......................FVEWG.HK.....G.GD.....................................Q..I.VS........P.A..G.T......-L....T.FNRnsmcg..............................................................spartvGWRD.P..GYIH.TSFLK....E.......L..WPDS.LYT.......Y..RL...............GHKl.lDGt...............................hIWS.KS..YSFR-a..........................................
A0A0D2T8X0_GOSRA/108-219               ....................................................PEQIALAL.....CT.-...-....PT..................SM..WVSWV..T...G...............................Daqigpn......vtaldpT.........S..VAS.......................EVWYG.KE.....S.GK.....................................Y..S.SK........K.R..G.N......AT....V.YSQlyp..................................................................feglFNYT.S..AIIH.HVRID....G.......L..EPET.KYY.......Y..RC...............GDS...SL................................pAMS.EE..HVFET...........................................
A0A0B0P6P7_GOSAR/61-152                ....................................................PQQVHITQ.....GD.H...L....GN..................AV..IVSWV..T...P...............................D..................E.........P..GSN.......................SVFYW.AE.....N.SE.....................................L..K.NS........A.Q..G.I......VL....T.YKY.........................................................................FNYT.S..GFIH.HCTIR....D.......L..EFDT.KYY.......Y..EV...............GIG...N-.................................-SS.RR..FWFVT...........................................
E0VL88_PEDHC/34-125                    ....................................................PTQIHIAF.....GN.-...T....VS..................DI..VVTWV..T...T...............................S..................K.........T..KHS.......................VVEYG.LN.....G.--.....................................L..I.DR........A.E..G.N......QT....L.FRDg.......................................................................gKLKR.K..FYIH.RVLLP....N.......L..IENA.TYE.......Y..HC...............GSN...L-.................................GWS.EL..LFFRT...........................................
A0A0W8C7E9_PHYNI/189-294               ....................................................PKHGHIAL.....TE.-...N....VD..................EM..SVMFN..S...A...............................S..................R.........-..ETP.......................VVKYG.LD.....P.AA.....................................L..N.KR........A.E..G.K......SK....T.YTAahlcnrp...........................................................anlssqqWFRD.P..GNMH.TVILK....G.......M..KLGT.RYF.......Y..KF...............GSD...KD.................................GWS.SV..YSFV-s..........................................
A0A0C2T9S2_AMAMU/1-87                  ...................................................m--QLRLAY.....AG.-...-....ST..................GM..VVSWN..T...Y...............................A..................Q.........L..SQP.......................KVFYG.RH.....P.WL.....................................L..K.ST........A.S..S.N......VS....V.T--.........................................................................YPSS.T..TYNN.HVKIT....G.......L..HPNT.QYY.......Y..LP...............ENS...N-.................................-AT.TP..YTFKT...........................................
A0A0G1S0K6_9BACT/152-238               ................................................pais----NIQI.....TG.I...T....DS..................EA..VISWE..T...N...............................E..................S.........-..GDS.......................FVEYG.VD.....T.GF.....................................G..S.TS........-.-..-.-......--....-.---.........................................................................GQEE.G..KTAH.SVKLA....G.......L..KGNT.LYH.......F..LV...............KSK...DIsg.............................niGQS.AN..QSFTT...........................................
A0A0G1ASL4_9BACT/43-131                .................................................pks-----LAL.....AN.L...S....ET..................GA..SIYWQ..T...D...............................Q..................P.........-..TTG.......................FIQAG.PS.....A.AL....................................gL..T.FR........D.E..R.D......IQ....-.---.........................................................................-APE.P..HQLH.FVTLN....S.......L..TPNT.IYY.......Y..KI...............GSG...GLt...............................yPPG.EP..FSFRT...........................................
M7Z6I1_TRIUA/141-254                   .................................................pvf---PRLAQ.....GK.-...T....HD..................EM..AVTWT..S...G...............................Y..................D.........V..GDAy.....................pFVEWG.MV.....T.SGtg.................................agN..P.TR........S.P..A.G......TL....T.FNRgsmcg..............................................................apartiGWRD.P..GFIH.TAFMR....G.......L..WPNK.EYF.......Y..KI...............GHEl.pDGt...............................vVWG.KP..YTFR-a..........................................
A0A0A0LL67_CUCSA/68-181                ....................................................PEQISVSL.....SV.-...D....YD..................SV..WISWI..T...G...............................Dfqigdd......iqpldpE.........E..VAS.......................IVMYG.KF.....S.MP.....................................M..D.NQ........A.E..G.Y......SL....I.YNQlyp..................................................................feglRNYT.S..GIIH.HVRLT....G.......L..EPDT.LYQ.......Y..QC...............GDP...SVa...............................eEMS.DV..YFFRT...........................................
D8QZ61_SELML/197-298                   ................................................plyg----HLSL.....ED.S...S....GT..................SM..VLAWV..S...R...............................S..................F.........-..DIH.......................YVEFD.HG.....R.KS.....................................-..-.-M........D.E..V.T......SF....Q.IGDlcdavp.............................................................gpakdfGWHD.P..GFIH.IARMQ....N.......L..RPGT.RYS.......Y..RY...............GSD...NS.................................GWS.NL..KMFTT...........................................
A0A0D5VKG6_9BURK/55-151                ....................................................PEQIHLTW.....GN.D...P....TS..................EV..TVSWS..S...P...............................A..................P.........A..VNP.......................RVRLN.GA.....G.EK.....................................-..A.QT........V.H..G.V......QS....T.YTD........................................................................gINGE.V..VFTY.HARLR....G.......L..KPDT.GYQ.......Y..EV...............SAD...NDs..............................naA--.--..-----qpftasfht..................................
D1BCR8_SANKS/243-337                   ..................................................ht--DVVMTV.....GS.-...D....ET..................SR..SITWY..T...N...............................V..................D.........-..SPQ.......................QVQLA.PA.....A.AV.....................................V..D.GQ........M.P..A.S......AT....T.VLAt......................................................................ggPTSS.G..EFRR.SATLA....D.......L..AAST.DYV.......Y..RV...............GSD...TD.................................GWS.AT..YPFST...........................................
W6RWG7_9CLOT/63-151                    ....................................................PTEIVLTP.....GK.-...D....ET..................EI..NFAWY..S...K...............................K..................D.........E..KKP.......................EFKVS.ES.....E.DM.....................................I..N.SK........KiD..V.K......SE....-.---.........................................................................KATK.G..YLSN.KVTVK....N.......L..NSKK.EYY.......Y..SY...............TID...D-.................................KWS.DP..LKIST...........................................
A0A0G0YV40_9BACT/233-316               ..............................................psmvfa--------.....--.-...-....-K..................EV..KISWR..T...N...............................L..................I.........-..ARC.......................RVRYG.NG.....S.EQ.....................................Y..D.KE........L.E..A.N......D-....-.---.........................................................................--EE.R..LLEH.IITIT....G.......L..EPAA.TYY.......Y..KL...............DCY...DSfy............................dksKES.KE..YTFTT...........................................
V6K1W2_STRRC/74-179                    ....................................................PFGRHLAY.....GN.D...P....RT..................EM..TVSWQ..V...P...............................V..................A.........V..KNP.......................FIRIG.AH.....P.WD.....................................L..S.RK........I.E..A.E......VR....S.LYTpag...................................................................vgaSGDH.T..QYYL.HAQLT....H.......L..RPGR.TYY.......Y..GV...............GHE...G-.................................---.--..-----fdpaerhllgtlgtftt..........................
A0A0D2XTT0_FUSO4/28-116                ....................................................PVQQRLSL.....DG.-...-....PN..................SV..TIGWN..T...Y...............................A..................K.........Q..AKP.......................CVQYG.SS.....K.DN.....................................L..D.KQ........A.C..S.D......IS....L.T--.........................................................................YPTS.R..TWAN.AVTLG....N.......L..SPAT.KYY.......Y..KI...............VSQ...NS.................................---.--..-----vidqflspr..................................
A0A0D3EKQ3_9ORYZ/57-148                ....................................................PQQVHITQ.....GN.H...D....GT..................AM..IISWV..T...T...............................I..................E.........P..GSS.......................TVLYG.TS.....E.DN.....................................L..N.FS........A.D..G.K......HT....Q.YTF.........................................................................YNYT.S..GYIH.HCTIK....K.......L..EFDT.KYY.......Y..AV...............GIG...Q-.................................-TV.RK..FWFRT...........................................
R0FNL8_9BRAS/48-135                    ....................................................PQQVHVSL.....AG.-...-....KD..................HM..RVTFI..T...E...............................D..................K.........H..VES.......................VVEYG.KQ.....P.GK.....................................Y..D.GK........A.T..G.E......CT....S.YKY.........................................................................FFYK.S..GTIH.HVKIG....P.......L..QPNT.TYY.......Y..RC...............GCN...G-.................................---.PE..FSFKT...........................................
A0A0W8C569_PHYNI/61-158                ....................................................PQQLHLAY.....AG.K...S...aGT..................AM..TVSWS..T...Y...............................A..................K.........V..DDS.......................SVWIG.RS.....E.DT.....................................L..E.LV........D.T.pV.T......QX....S.YYH.........................................................................DATY.N..MFHH.HAMVS....G.......L..TPHT.KYY.......Y..KV...............GSK...ANm...............................sYTS.DV..FSFVT...........................................
C5XWK4_SORBI/144-251                   ....................................................PAQLHLAF.....TD.-...E....VD..................EM..RVLFV..C...G...............................D..................D.........-..GGR.......................FVRYG.LA.....G.RRe...................................eE..W.EE........V.P..A.E......AR....T.YEQrhmcdy.............................................................pandsvGWRH.P..GFVF.DAVMK....G.......L..QPGT.RYF.......Y..KV...............GNG...NDs...............................gGWS.ET..YSF--is.........................................
A0A165Y458_DAUCA/63-154                ....................................................PQQVHITQ.....GD.R...E....GK..................GV..IISWV..T...P...............................D..................E.........L..GSS.......................TVLYW.AE.....D.SK.....................................V..K.NI........A.N..S.T......VV....T.YKY.........................................................................YDYN.S..GYIH.HCTIE....N.......L..EYDT.KYI.......Y..EI...............GDG...SN.................................---.--..-----arrfwfit...................................
A0A096T6R9_MAIZE/174-282               ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Di.......tE..AVP.......................FVEWG.EK.....G.GR.....................................-..R.FL........A.P..A.G......TL....T.FDRnsmcg..............................................................apartvGWRH.P..GYIH.TSYLK....D.......L..WPDS.RYT.......Y..RL...............GHRl.mNGt...............................rVWS.KS..YSFR-a..........................................
H6RSK7_BLASD/44-132                    ......tpvvepdasgtsatlrvstdidmacavvfgrdeslgdgiatdadmg--------.....--.-...-....--..................--..-----..-...-...............................-..................-.........-..---.......................-----.--.....-.--.....................................-..-.--........-.-..-.-......--....-.---.........................................................................--GG.A..HAEH.QAVMR....G.......L..EPDT.EYF.......Y..RVq............gsGA-...-Dg..............................nlYRS.EL..MSFRT...........................................
D3AU75_9CLOT/157-251                   ..................................................ik--SVSLGV.....GA.-...D....ES..................ET..MVTWY..S...D...............................S..................K.........-..LPG.......................KVQLV.KK.....S.DL.....................................A..N.GV........F.P..E.T......AA....E.FAAek.....................................................................esANEE.G..FFTN.QAVIR....G.......L..ESAT.EYA.......Y..RV...............GDG...T-.................................AWS.DV..YDLT-v..........................................
A0A194YKI3_SORBI/55-145                ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IVSWV..T...P...............................E..................E.........P..GPS.......................EVFYG.KE.....K.-Q.....................................Y..D.QK........S.E..G.T......TT....N.YTF.........................................................................YDYK.S..GYIH.HCLVD....G.......L..EYNT.KYY.......Y..KI...............GSG...D-.................................-SA.RE..FWFET...........................................
S3D410_OPHP1/34-119                    ...................................................p-VQQRIAV.....SG.-...-....PS..................SI..SVGWN..T...F...............................E..................Q.........V..ANP.......................CVEYG.TA.....A.DR.....................................L..V.YT........A.C..G.S......SV....T.Y--.........................................................................-ASS.R..TYSN.AASLN....N.......L..KPAT.RYY.......Y..KI...............VST...N-.................................--S.TV..EHF--ms.........................................
A0A0B0PGL6_GOSAR/60-151                ....................................................PQQVHITQ.....GD.H...V....GK..................AV..IVSWV..T...Q...............................D..................E.........P..GSN.......................TVVYW.SE.....G.SK.....................................E..K.MK........A.V..G.K......IS....T.YKY.........................................................................YNYT.S..GFIH.HCTVK....N.......L..EYNT.KYY.......Y..VV...............GEG...A-.................................-SM.RK..FWFTT...........................................
A0A061GP98_THECC/62-153                ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...A...............................D..................E.........P..GPS.......................KVQYG.TS.....E.KN.....................................Y..E.FT........A.D..G.K......MT....N.YTF.........................................................................YKYN.S..GYIH.HVFVD....G.......L..EYDT.KYY.......Y..KI...............GTG...D-.................................-SA.RE..FWFQT...........................................
A0A0L8GF81_OCTBM/45-135                ....................................................PEQIHIAY.....GE.-...-....DY..................SM..IITWS..T...F...............................K..................S.........G..LNT.......................IVKYG.TD.....S.--.....................................L..S.HV........A.Y..G.K......AQ....R.FINp.......................................................................dLYFH.T..QYIH.VVTVP....N.......L..QPGV.KYI.......Y..RC...............GSP...Q-.................................GWS.EQ..FSFT-a..........................................
A0A0S7Y8C6_9BACT/843-932               ..........................................sevhceniga--------.....--.-...-....-D..................MC..DVCWM..T...S...............................K..................N.........-..TNS.......................TVHYG.TD.....P.GN.....................................L..N.QT........A.A..I.E......SL....-.---.........................................................................----.Y..CIPH.RVRVA....G.......L..NAKT.TYY.......Y..DV...............ESE...DFy...............................gN--.--..-----wahddnggqhysftt............................
A0A0B2PTW0_GLYSO/15-96                 .................................................pld--------.....--.-...-....--..................--..-----..-...-...............................P..................K.........T..VSS.......................VVQYG.TS.....T.FE.....................................L..V.HE........A.R..G.Q......SL....I.YNQlyp..................................................................feglQNYT.S..GIIH.HVQLK....G.......L..EPST.LYY.......Y..QC...............GDP...SL................................qAMS.DI..YYFRT...........................................
B8BMN4_ORYSI/164-272                   ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Di.......kE..AVP.......................FVEWG.AK.....G.GR.....................................S..F.LS........P.A..G.-......TL....T.FDRnsmcg..............................................................apartvGWRH.P..GYIH.TSYLK....D.......L..WPDS.LYT.......Y..RL...............GHRl.pNSt...............................lIWS.KS..YSFK-a..........................................
I1RKT7_GIBZE/34-123                    ...................................................p-VQQRIAF.....SG.-...-....PN..................SI..TVGWN..T...Y...............................A..................K.........Q..AKP.......................CVQYG.TS.....Q.NA.....................................L..D.KQ........A.C..S.D......IS....T.T--.........................................................................YPTS.R..TWVN.SVTLS....G.......L..SPAT.TYY.......Y..KI...............VSK...NS.................................---.--..-----tidhflsprt.................................
A0A151DZ89_9EURY/47-128                ........................................iivgpypqrasf--------.....--.-...-....-D..................SI..IIAWE..T...S...............................I..................E.........T..QNN.......................SVHFG.LT.....P.DC.....................................E..K.II........-.-..-.-......--....-.---.........................................................................YNNY.S..NYFH.KIEIC....D.......L..TPSM.KYY.......Y..KV...............KSD...F-.................................VES.KI..YSFYT...........................................
I1GKW0_BRADI/63-176                    ....................................................PEQIAVAP.....SA.-...S....PT..................SA..WVSWV..T...G...............................Eyqigda......vkplnpA.........T..INS.......................VVRYG.LA.....A.DA.....................................L..T.HT........A.T..G.V......AM....V.YSQlyp..................................................................feglLNYT.S..GIIH.HVRLH....G.......L..EPAT.KYY.......Y..QC...............GDP...AAa...............................gGMS.AV..NAFRT...........................................
A0A1B6PKN0_SORBI/90-178                ....................................................PQQVHVSA.....VG.-...-....GK..................HM..RVSWV..T...D...............................D..................D........kH..APS.......................VVEYG.KA.....S.RN.....................................Y..T.MS........A.T..G.D......HT....S.YRY.........................................................................FLYS.S..GRIH.HVTIG....P.......L..EPGT.VYY.......Y..RC...............GNA...GR.................................EFS.--..-----lrt........................................
W1SJF4_9BACI/485-593                   .............................................eegkyia--------.....--.-...-....--..................--..RFNWV..T...P...............................V..................A.........T..KTT.......................QLYYA.KK.....S.DFesn...............................ggkF..T.NV........V.V..G.-......--....-.--Tnntvdlsdai....................................................seanyngagteYSVA.P..VQSH.KAETA....V.......L..EPGT.KYV.......Y..AV...............GDG...AK.................................NVS.SV..ES---pasfkt.....................................
A0A0P1AG99_9STRA/189-295               ....................................................PKHGHLSL.....TD.-...D....DS..................AM..AIMFN..S...G...............................S..................S.........-..KTP.......................MVKYG.EN.....A.QD.....................................L..K.FH........A.T..G.T......TT....T.YGAddlchap...........................................................anvlgqkSFRD.P..GYMH.TVIMT....D.......L..KPGT.YYY.......Y..QY...............GHE...EE................................hAWS.HV..RRFK-s..........................................
A0A0G0NC38_9BACT/42-125                ...................................................p-DQVKITN.....IS.-...-....DR..................NI..TISWT..T...D...............................K..................Q.........-..TSG.......................FIAYG.KS.....D.-N.....................................L..G.AT........V.N..-.-......--....-.---.........................................................................-QPN.P..SLIH.YITLD....N.......L..TPET.KYY.......F..KI...............GSG...KN.................................---.--..-----lydnnglpyevkt..............................
A0A0N1NFS7_9ACTN/74-179                ....................................................PFGRHLAF.....GN.D...P....RT..................EI..TVSWQ..V...P...............................A..................A.........V..KKP.......................FIRIG.AH.....P.WD.....................................L..S.RK........I.E..A.E......VR....T.LYTpag...................................................................vgaSGDL.T..QYYL.HAKLT....H.......L..RPGK.TYY.......Y..GV...............GHA...G-.................................---.--..-----fdpcaphllgtlgtftt..........................
A0A059DFE8_EUCGR/1-85                  ....................................................---VHVSL.....VG.-...-....QD..................KM..RISWI..T...Q...............................D..................S.........-..APP.......................TVEYG.KS.....P.GV.....................................Y..Q.NS........S.T..G.T......TS....S.YKY.........................................................................TLYT.S..GKIH.EAVIG....P.......L..ETNT.VYY.......Y..RC...............SSD...S-.................................--S.RE..FSLKT...........................................
A0A0B8PU02_9VIBR/64-150                .............................................tpylqhp--------.....--.-...A....TD..................GM..TVMFE..P...E...............................S..................L........tS..TDS.......................VVYYR.EQ.....G.NE.....................................G..P.YQ........S.L..V.S......HS....-.--T.........................................................................DYDE.L..GLVQ.RVRID....G.......L..KSDT.KYD.......Y..FV...............RTE...Q-.................................GDS.KV..YNFRT...........................................
A0A168F9L9_CORDF/34-120                ....................................................PMQVRIAV.....SG.-...-....AN..................SM..SVGWN..T...Y...............................Q..................Q.........S..GSP.......................CVSYG.TS.....A.NL.....................................L..T.HK........S.C..S.T......KS....-.-DT.........................................................................YPSS.R..TWFH.TVYLN....N.......L..TPAT.KYY.......Y..KI...............EST...N-.................................--S.TV..EQF--ls.........................................
A0A0L0NG60_9HYPO/23-113                ...................................................t-SQIRLAY.....HG.-...-....DD..................GM..MVSWN..T...A...............................G..................H.........V..ERP.......................TVRWG.AS.....A.DK.....................................L..H.NT........A.S..S.N......VS....V.T--.........................................................................YPTS.T..TYNN.HVLIS....G.......L..APGH.TYF.......Y..--...............---...--.................................---.--..-----lpsplphaedakpynftt.........................
K0JZC5_SACES/44-134                    ...................................................v-SRVILTP.....TA.T...P....ND..................SQ..NFTWR..S...T...............................D..................A.........-..GGG.......................TVQLR.PA.....G.GD.....................................A..V.TI........A.A..-.H......AV....D.TSN.........................................................................LAGV.D..YTHY.SATAT....G.......L..SADT.AYE.......Y..RV...............GTG...D-.................................EWS.RW..RAFR-s..........................................
I4DHV7_ORYSJ/173-281                   ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Si.......kE..AIP.......................FVEWG.HK.....G.GN.....................................Q..M.LS........P.A..G.T......L-....T.FSRnsmcg..............................................................spartvGWRD.P..GYIH.TSFLK....E.......L..WPDS.LYT.......Y..RL...............GHRl.lDGt...............................hIWS.KS..YSFR-a..........................................
A0A0D3FKI8_9ORYZ/68-155                ....................................................PQQVHISL.....AG.-...-....EK..................HM..RVTFV..T...D...............................D..................N.........S..VPS.......................VVDYG.TE.....A.GT.....................................Y..T.ST........S.Q..G.E......ST....S.YSY.........................................................................LMYS.S..GKIH.HVVIG....P.......L..NDNT.VYY.......Y..RC...............GGH...G-.................................---.PE..FQFKT...........................................
M5VU99_PRUPE/66-156                    ....................................................PQQVHITQ.....GD.H...K....GK..................AM..IVSWV..T...V...............................D..................E.........K..GSS.......................KVLFW.SE.....G.QK.....................................K..-.RM........A.E..G.K......AK....T.YTY.........................................................................HDYT.S..GYIH.HSTIR....N.......L..EYNT.KYY.......Y..MV...............GIG...H-.................................-TE.RL..FW---fvt........................................
A8J3E9_CHLRE/67-186                    ...................................................a-EQVVVTY.....QS.-...-....AG..................EV..VISWV..V...Ghsavcnd................ltcaavpmA..................P.........A..GSD.......................VVRYG.TS.....R.SS.....................................L..K.AR........A.Y..G.A......GG....Y.YTQdyyfpasln.......................................................vtgvsdntqFNYT.S..GRIY.SARLT....G.......L..KSAT.RYY.......Y..SL...............GDD...DL.................................AW-.--..-----pga........................................
D0NUN3_PHYIT/111-208                   ....................................................PQQIHLAF.....AG.K..kP....GT..................AM..TVSWA..T...F...............................E..................D.........V..TDS.......................SVWLG.DS.....E.DS.....................................L..E.LV........E.T.pV.S......SE....S.YYS.........................................................................NKEY.N..LFHH.HAKIT....G.......L..KPRT.KYF.......Y..KV...............GSR...GDe...............................kYKG.DV..GSFVT...........................................
E3JBW9_FRASU/51-145                    ..................................................vs--PVNLEL.....VT.L...T....ET..................SA..VLTWY..S...Gipgtdd...................gtkrmlP..................K.........P..ADG.......................QVSYG.TS.....P.SR.....................................L..T.KT........A.H..D.K......G-....-.---.........................................................................---G.L..TPYH.YVELT....G.......L..EPGQ.TYY.......Y..RA...............ASA...G-.................................---.--..-----ktaaptal...................................
G0RHA2_HYPJQ/34-120                    ...................................................p-VQQRIAV.....NG.-...-....PN..................SV..SIGWN..T...Y...............................Q..................Q.........L..SQP.......................CVAYG.TS.....A.TS.....................................L..T.QQ........A.C..S.Q......SS....V.T--.........................................................................YQTS.R..TWSN.AVTLS....N.......L..SPAT.TYY.......Y..KI...............VST...N-.................................--S.SV..DHF--ls.........................................
A0A0D9XP48_9ORYZ/219-308               ....................................................PQQVHISI.....VG.-...-....EK..................NM..RISWV..T...D...............................D..................L.........K..APS.......................IVEYG.KS.....P.GK.....................................Y..T.AS........A.T..G.E......HV....T.YRY.........................................................................FLYK.S..GAIH.HVTIG....P.......L..EPST.TYH.......Y..RC...............GNA...GD.................................---.--..-----eftlrtpp...................................
PPA11_ARATH/54-130                     ....................................................PEQVHITQ.....GD.N...A....GR..................AM..IISWV..M...P...............................L..................N........eD..GSN.......................VVTYW.IA.....S.SDg...................................sD..N.KN........A.I..A.T......TS....S.YRY.........................................................................FNYT.S..GYLH.HATIK....K.......L..EYD-.---.......-..--...............---...--.................................---.--..-----ps.........................................
C4Q6M8_SCHMA/41-132                    ....................................................PEQVHIAL.....GE.-...Q....PS..................TI..SITWV..T...Q...............................E..................N.........T..ESS.......................TVLYG.TK.....L.LN.....................................M..K.ST........G.Y..V.K......EF....I.DGG.........................................................................REQR.K..MYVH.RVILS....D.......L..IAGT.IYY.......Y..KC...............GSL...D-.................................GWS.DV..LNFR-a..........................................
A0A0F4K506_9ACTN/78-183                ....................................................PFGRHLAF.....GA.D...P....QR..................QM..RISWQ..V...P...............................F..................A.........V..KRP.......................YVRIG.VK.....P.WD.....................................L..S.HK........I.E..A.E......VR....G.LHTpal...................................................................skkLPAV.D..QVYL.HAALD....N.......L..RPGQ.TYY.......Y..GV...............GHD...GFdpa...........................dprHFS.TI..GTFRT...........................................
A0A0H2KT56_9MICO/235-329               ..................................................vr--DVALNV.....GA.-...D....ET..................QA..NVAWF..S...T...............................L..................P.........-..GAG.......................EVQWT.RA.....D.AAg..................................geV..D.WQ........A.A..A.T......SS....S.RDG.........................................................................TAAD.G..STYH.HATIT....G.......L..EEDS.AYA.......Y..RV...............GSA...ST.................................GWS.AP..TTFTT...........................................
V4AHM2_LOTGI/25-117                    ....................................................PQQVHIAL.....GV.-...T....ID..................KI..SVTWS..T...R...............................Y..................D.........T..VES.......................IVVYG.ID.....N.LE.....................................S..G.NE........T.I..G.T......SS....K.FVD........................................................................aTGKN.V..QYLH.HVTLS....G.......L..KPAT.KYT.......Y..IC...............GSK...G-.................................QWS.PV..YTFTT...........................................
G9MZW9_HYPVG/34-121                    ...................................................p-VQQRIAV.....NG.-...-....PN..................SV..SIAWN..T...Y...............................K..................Q.........L..SQP.......................CVTYG.SS.....A.TS.....................................L..T.QQ........T.C..S.Q......SS....V.T--.........................................................................YQSS.R..TWSN.VVTIN....N.......L..SPAT.TYY.......Y..KI...............VST...N-.................................--S.SV..DHF--fsp........................................
L0G1G5_ECHVK/29-116                    .............................................qidiqpy-------L.....QD.V...T....PH..................SA..VVMWQ..T...D...............................F..................G.........-..DES.......................TVEWG.ET.....V.-D.....................................L..G.NT........S.Q..G.E......SL....D.V--.........................................................................-NFT.E..ARVH.EVRVE....G.......L..KKFT.TYY.......Y..RV...............RTG...D-.................................AVS.DV..FQFKT...........................................
X8FM88_MYCUL/63-157                    ..................................................vg--GLHLQY.....GK.N...A....AT..................EV..VVSWH..S...V...............................D..................A.........V..QNP.......................RVMLG.TP.....A.SG.....................................F..G.RV........V.S..A.E......TR....T.YRD........................................................................aKSNT.E..VRVN.HARLT....N.......L..TPDS.DYV.......Y..AA...............VHD...G-.................................---.--..-----adpqlgtvrta................................
D7MBM6_ARALL/51-147                    ....................................................PEQVHIIQ.....GD.Y...N....GR..................GM..IISWV..T...P...............................L..................N........lA..GSN.......................VVTYW.KA.....V.SGdv.................................ksE..K.KR........A.H..A.S......TS....S.YRF.........................................................................YDYT.S..GFLH.HATIK....G.......L..KYDT.KYI.......Y..EV...............GTD...E-.................................-SV.RQ..FSFTT...........................................
A0A0G0EKL6_9BACT/1908-1996             ................................................piis----NINV.....AA.K...T....SS..................TA..TINWN..T...D...............................E..................N.........-..ATS.......................FVEYS.KT.....D.GF.....................................G..T.GA........L.F..-.-......--....-.---.........................................................................GNYT.L..TTSH.SVVVP....S.......L..EANA.TYY.......F..KV...............HSK...DAsn.............................neSVS.SQ..SSFVT...........................................
W5FLX6_WHEAT/174-282                   ................................................pvyp----RLAQ.....GK.-...S....WD..................EM..TITWT..S...G...............................Y..................Di.......kE..AVP.......................FVEWG.AK.....G.GS.....................................Q..F.LS........P.A..G.T......-L....T.FNRnsmcg..............................................................apartvGWRH.P..GYIH.TSFLK....D.......L..WPDS.KYT.......Y..RL...............GHRl.pNGt...............................hIWS.KL..YNFK-a..........................................
F6W4G5_ORNAN/8-147                     ....................................................PSDVHVSR.....VG.D...L....ED..................QL..SVRWS..S...P...............................P..................Alkd...flfQ..AKY.......................QIRYR.VE.....D.SVewklp..........................qsqnprE..-.--........-.-..-.-......--....-.--Ggawwfrvergsedrvg.........................................qipparlltsslpigqLVDD.V..SNQT.SCRLA....G.......L..KPGT.VYF.......V..QVrcnp.......fgiyGSK...KA................................gIWS.EW..SHP--ta.........................................
A0A0D2P079_GOSRA/169-277               ................................................plyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Di.......dE..AVP.......................FVEWG.RK.....G.DL.....................................Q..V.RS........P.A..G.T......-L....T.FKQnsmcg..............................................................spastvGWRD.P..GFIH.TSFLK....D.......L..WPNF.VYM.......Y..RI...............GHLl.yNGs...............................vVWS.KT..YSFK-s..........................................
U7PSI1_SPOS1/25-116                    ...................................................t-SQVRVAY.....HG.-...-....DD..................GM..VVSWN..T...F...............................K..................H.........L..LRP.......................TVLYG.LS.....A.DT.....................................M..I.HR........A.T..S.H......VS....V.--T.........................................................................YPTS.L..TYNN.HVLID....G.......L..LPDT.TYY.......Y..QP...............QDLl.aNE.................................TVY.GP..YTFKT...........................................
A0A0G1WBG5_9BACT/256-348               .................................................die---VNVAS.....TT.A...S....ST..................DA..TVTWE..T...D...............................E..................D.........-..ADS.......................TVWYS.TD.....E.DF.....................................E..T.DD........A.D..T.E......EE....-.---.........................................................................TDSD.L..VTNH.SVDLS....G.......L..TAST.TYY.......F..MV...............GSE...DEag.............................nqATS.SV..DSFIT...........................................
A0A0M2Y1G6_9SPHI/28-128                ............................................hlpfiqgl--------.....--.-...T....EQ..................SV..SIIWT..T...D...............................K..................P.........-..ATG.......................WVELA.PD.....D.SS....................................hF..Y.FK........E.R..P.K......YY....A.AAY.........................................................................GFKK.V..GTLH.QVTLN....D.......L..KPGT.RYR.......Y..RV...............YSQ...EV.................................---.--..-----lkhvgvnvqygkvvasdvyq.......................
C9KKM6_9FIRM/74-162                    ...............................................lrqvi--------.....AT.D...N....AH..................AR..TIMWQ..S...D...............................V..................K.........W..QDA.......................VVEYR.LK.....G.AK.....................................D..I.AA........S.P..A.E......RE....T.FS-.........................................................................DDGV.T..VELY.TARLA....D.......L..EAGE.AYE.......Y..RI...............KAD...G-.................................QCD.DW..H----alqt.......................................
A0A0G0BSZ4_9BACT/84-171                ...............................................isdli-------V.....SS.N...K....GS..................KA..TLKWN..T...D...............................V..................R.........-..SNS.......................FVWYS.TT.....S.PV.....................................D..T.SL........S.P..N.M......--....-.---.........................................................................KRND.R..VLKH.KFEIK....K.......L..QPNT.KYY.......V..IV...............GGA...NNk..............................gmVKS.SV..VSFTT...........................................
B3MQN7_DROAN/40-144                    ....................................................PEQVHLAF.....GE.R...T....AS..................EM..VVTWS..T...R...............................Slpp............dlqV.........G..MTT.......................IVEYG.LL.....E.ASgq.................................skL..S.QT........A.R..G.T......AT....K.FVDg.......................................................................gRKKA.T..QFIH.RVTLR....N.......L..KPNS.TYV.......Y..HC...............GSS...Y-.................................GWS.SV..FQFRT...........................................
R4KAZ7_9FIRM/35-142                    .............................................kpylltl--------.....--.N...P....SN..................EM..NVVWI..S...K...............................E..................S.........-..GEG.......................FVEFG.LT.....E.DL.....................................G..-.TT........V.A..A.T......QY....E.IEGlrtsitpe.........................................................gydpdpakNPEL.N..VFQQ.IATLQ....N.......L..KPNT.IYY.......Y..QA...............TTK..vGDk...............................iEKS.KV..YNFKT...........................................
Q9VZ58_DROME/38-132                    ....................................................PEQVHLSF.....GD.-...N....LR..................DI..VVTWS..T...R...............................S..................S.........P..NAS.......................VVKFS.RN.....Y.LK....................................dE..P.IM........V.N..G.T......WQ....R.FVDg.......................................................................gKKAR.T..QYIH.NVELK....D.......L..EPDT.RYE.......Y..SC...............GSP...L-.................................GWS.AV..FNFKT...........................................
K3Z5V8_SETIT/66-157                    ....................................................PQQVHITL.....GD.Q...T....GT..................AM..LVSWV..T...V...............................E..................A.........E..GNS.......................TVLYG.RA.....A.DR.....................................L..D.LA........A.E..G.T......TT....R.YTF.........................................................................YNYT.S..GFIH.HCTLT....G.......L..DHGT.RYY.......Y..AM...............GFG...D-.................................-TV.RT..FWFTT...........................................
A0A0B8N0F6_9EURO/36-123                ....................................................PYQQRLAV.....YG.-...-....PG..................AV..SVGWN..T...Y...............................A..................Y.........Q..SSA.......................CVQYG.RS.....S.SN.....................................L..N.SQ........A.C..S.T......IN....S.TT-.........................................................................YASS.R..TYSN.VVILS....D.......L..APAT.TYY.......Y..KI...............VST...N-.................................--S.TV..GHF--ls.........................................
D7U5K3_VITVI/63-154                    ....................................................PQQVHITQ.....GD.H...E....GR..................GV..IVSWV..T...V...............................D..................E.........P..GSN.......................TVLYW.SE.....N.SK.....................................R..K.NR........A.E..G.I......MV....T.YKF.........................................................................YNYT.S..GYIH.HCTIK....N.......L..EFNT.KYY.......Y..VV...............GIG...H-.................................---.--..-----tprkfwfvt..................................
W9SND1_9ROSA/52-148                    ....................................................PEQVHITQ.....GD.Y...V....GR..................SV..IISWV..T...P...............................I..................K.........K..YPN.......................TVRYW.ED.....G.KHgh................................ghkH..K.HI........A.R..A.I......TT....T.YRY.........................................................................YNYT.S..GFIH.HATVK....R.......L..KYDT.LYF.......Y..EL...............GRG...N-.................................-VT.RH..FSFKT...........................................
V9EDV8_PHYPR/95-193                    ....................................................PQQFHLAF.....AG.K...V...aGT..................GM..TISWT..T...F...............................A..................L.........E..KNP.......................AVWIG.TS.....E.SK.....................................L..T.IV........K.D..A.T......IE....T.KSYy.......................................................................kDDHY.E..LYSY.HAVVG....G.......L..KPNK.EYF.......Y..KV...............GSG...SEt...............................kFQS.AV..SSFTT...........................................
A0A0Q9JDI3_9BACL/33-121                ..............................................kgpyll-------F.....EG.-...S....NT..................SM..SVLWQ..T...S...............................V..................N.........-..ESN.......................VISWG.TD.....T.TY.....................................S..M.GQ........A.T..-.-......V-....-.---.........................................................................GTYN.S..AYQH.KYTIT....G.......L..TPGT.KYY.......Y..NV...............DDH...AG.................................---.--..-----sfrtapastatsvkf............................
A0A074KWP3_9BACT/38-123                .................................................gwf-----LTW.....KE.D...P....TS..................SM..VVDWH..S...F...............................G..................E.........-..EGQ.......................TFKIR.KE.....G.EA.....................................E..W.RE........E.K..G.K......VL....E.FPF.........................................................................-TSP.K..RWIH.RVELK....G.......L..EPDS.RYD.......I..QL...............EGQ...E-.................................---.--..-----aifyfrt....................................
A0A0G0E6A2_9BACT/1779-1863             ...........................................ssiqavlig--------.....--.-...-....KN..................QA..LINWT..T...N...............................E..................V.........-..STS.......................KVRYG.KT.....E.NY.....................................S..S.TM........T.E..-.-......--....-.---.........................................................................-NTD.M..VTNH.NVLLE....D.......L..DSGT.TYH.......Y..QV...............VSK...DAsa.............................nsDES.GD..YTFKT...........................................
A0A0G3GWR7_9CORY/33-122                ..................................................vg--RIILGA.....GA.-...D....QT..................QS..TVSWR..A...K...............................G..................F.........-..SAQ.......................SLKFY.PT.....S.DP.....................................S..N.AT........V.V..P.A......QE....Q.--D.........................................................................NRAL.L..YRSF.EATIT....G.......L..KPQT.SYT.......Y..LV...............GSD...QG.................................GWS.EP..HSFTT...........................................
C5XMG6_SORBI/208-311                   ................................................plyg----HLSS.....TD.S...T....AT..................SM..RLTWV..S...G...............................D..................R.........-..RPQ.......................QVQYG.VG.....K.SA.....................................T..S.QV........A.T..F.T......QN....D.MCSspllp..............................................................spakdfGWHD.P..GYIH.TAVMT....G.......L..QPSQ.SYT.......Y..RY...............GSD...SV.................................GWS.ST..NKFR-m..........................................
I0RXD7_MYCXE/66-159                    ..................................................vr--GLHLQF.....GQ.N...A....ST..................QV..VVSWH..T...T...............................D..................A.........V..RNP.......................RVMVG.AP.....G.SG.....................................F..G.RT........V.P..A.E......TR....T.YRD........................................................................aKSNT.E..VRVN.HAVLD....N.......L..TPDT.DYV.......Y..AA...............VHD...G-.................................-AS.P-..-----elgtart....................................
D8RHK7_SELML/1-96                      ....................................................PEQVFISQ.....AD.H...T....GT..................AF..TISWS..S...N...............................R..................T.........-..MGS.......................RVFYS.NQ.....P.SS.....................................Y..D.LS........A.T..G.G......SS....T.YSY.........................................................................ADYT.S..GNLH.HVTIS....N.......L..TYST.RYY.......Y..RI...............GEG...GS.................................---.--..-----ddrhlvfasefvt..............................
L8HCK0_ACACA/307-409                   ....................................................PCHVYLTF....pPG.N...M....SS..................SI..IVHFH..A...S...............................D..................La.......pS..CAS.......................TVYYD.TQ.....S.RKngt...............................ladY..R.FN........T.T..G.T......HF....K.YE-.........................................................................TKDF.T..RYIH.WVRID....T.......L..EPDT.VYF.......F..RA...............GCG...AHp...............................qLFS.PE..KRF--l..........................................
A0A0R0AZW9_9GAMM/39-134                ....................................................PDRIVASP.....AQ.D...A....AH..................GF..AVAWR..T...D...............................A..................T.........V..RAP.......................QLQIV.VA.....G.DSpd.................................vgK..P.RV........V.N..A.R......TQ....E.LR-.........................................................................SENG.T..SLHH.RADID....G.......L..QPDT.LYA.......Y..RV...............QGK...D-.................................TWS.AW..NHFRT...........................................
A0A059A6Z4_EUCGR/185-293               ................................................plyp----RLSQ.....GK.-...S....WD..................EM..TVTWT..S...G...............................Y..................Ni.......dE..VTP.......................FVEWG.VK.....G.ET.....................................Q..T.RS........P.A..G.T......LT....-.FQQnsmcg..............................................................ppartvGWRD.P..GFIH.TSFLK....D.......L..WPNA.EYT.......Y..RL...............GQRl.aNNs...............................yVWS.KA..YSFK-s..........................................
A0A075K9Z9_9FIRM/34-127                .................................................vgh---IMHVV.....TT.D...M....KH..................EH..TISWK..T...S...............................N..................F.........G..EPG.......................NLEIR.PK.....Q.SK.....................................N..I.TK........V.N..A.E......AV....E.LPT........................................................................yNGGK.H..FGLY.TAHVT....N.......L..MAGT.DYE.......Y..RI...............SVG...K-.................................RQS.AW..MEFKT...........................................
A0A0D9Y1T8_9ORYZ/777-873               ....................................................PEQVHITQ.....GD.L...T....GN..................AM..IVSWV..T...P...............................K..................L.........P..DSN.......................TVRFG.LR.....P.DN.....................................L..S.ST........V.S..G.S......FR....R.YTFg......................................................................rsNIYR.S..GFIH.HATIS....G.......L..THST.KYH.......Y..SV...............GTP...SP.................................ATS.RV..FSFTT...........................................
A0A0G1ZVJ1_9BACT/237-327               ..............................................vpavei--------.....--.-...E....AN..................KA..TIKWR..T...N...............................K..................M.........-..ANS.......................IIALA.PQ.....S.DY.....................................D..A.QA........K.D..S.Y......TL....Q.V-G.........................................................................QAQE.E..VKDH.AVTIP....D.......L..KPST.VYH.......F..QI...............RSK...AKvg.............................peGRS.RD..FVFET...........................................
R5XZJ1_9CLOT/60-148                    ....................................................PTQMSLSP.....GE.-...D....ET..................QL..NFAWY..S...K...............................S..................C.........D..VKP.......................NLKIS.DN.....P.KM.....................................E..D.AK........A.L..Q.V......IT....-.--T.........................................................................KASD.E..YKTN.KATAT....N.......L..KPNT.RYY.......Y..SY...............TIN...G-.................................KWT.EP..A----lykt.......................................
G7JA61_MEDTR/71-183                    ....................................................PEQISLSL.....ST.-...S....HD..................SV..WISWI..T...G...............................Efqigen......iepldpE.........T..VDS.......................IVQYG.RF.....G.RS.....................................M..N.VQ........A.V..G.Y......SL....V.YSQlyp..................................................................feglQNYT.S..GIIH.HVRLT....G.......L..KPNT.LYQ.......Y..QC...............GDP...SL................................pAMS.DV..HYFRT...........................................
Q24GM0_TETTS/267-369                   ....................................................PCHLYATL.....PE.N...T....AN..................DV..FINIH..T...N...............................K..................A.........I..NNV.......................TVYYD.LE.....E.YY.....................................L..N.NK........T.A..Q.L......RN....Q.QSSvlfe.................................................................ldyvESKG.Q..RNVH.SALIS....G.......L..TPKT.KYV.......I..QI...............KYA...GD.................................---.--..-----dtvqathfyrt................................
A0A067DIL4_CITSI/86-198                ....................................................PEQISVSL.....SS.-...A....HD..................SV..WISWI..T...G...............................Efqignn......lkpldpK.........S..VVS.......................VVRYG.TR.....R.SQ.....................................L..N.RK........A.T..G.R......SL....V.YSQlyp..................................................................flglQNYT.S..GIIH.HVRLT....G.......L..KPDT.LYH.......Y..QC...............GDP...SI................................pAMS.GT..YCFRT...........................................
U6Q3A1_9CLOT/987-1097                  ....................................................PSNILFGT.....TE.D...A....KT..................QK..SISWM..S...N...............................P..................Lt.......sK..DKV.......................VVQYI.MK.....S.KYnskgl...........................lrnkiN..T.KE........V.E..G.E......YT....N.LTFsgn...................................................................sdiNLNG.V..VRSN.QIKIT....G.......L..EPGT.TYM.......C..RV...............GDG...E-.................................NWS.EF..MEFTT...........................................
A0A0L0LK32_9BACT/160-246               .............................................psissis-------A.....RT.P...D....ST..................EV..TIRWT..T...D...............................E..................S.........-..SDS.......................AVAYG.TT.....A.SY.....................................G..A.TT........T.S..-.-......--....-.---.........................................................................--SS.L..VTSH.SVDLS....N.......L..LPLT.TYH.......Y..RV...............RSA...DGsg.............................naSFS.SD..QTFTT...........................................
M4EDN0_BRARP/178-286                   ................................................pvyp----RLAL.....GK.-...E....WD..................TM..TVTWT..S...G...............................Yg................lK.........I..AEP.......................VVEWG.VK.....G.GE.....................................R..K.LS........P.A..G.T......LT....F.ARNtmcga...............................................................partvGWRD.P..GYIH.TAFLK....E.......L..WPNA.KYT.......Y..RV...............GHR..lTNd..............................afVWS.KE..YQFK-s..........................................
H2K9C5_STRHJ/71-176                    ....................................................PFGRHLAF.....GA.D...P....RT..................RM..RISWQ..V...P...............................L..................A.........V..KRP.......................YVRVG.TR.....P.DD.....................................L..G.HR........V.P..A.E......IR....P.LRTpgv...................................................................edvRPAL.E..QYYV.HASVD....G.......L..TPGT.TYY.......Y..GV...............GHD...G-.................................-WE.PT..-----apahraaiasfrt..............................
A0A0D3HIB6_9ORYZ/56-143                ....................................................PEQVHISA.....VG.-...-....SD..................KM..RVTWI..T...G...............................G..................D.........-..APA.......................TLEYG.TT.....S.GQ.....................................Y..P.FS........A.T..G.S......TN....T.YSY.........................................................................VLYH.S..GNIH.DVVIG....P.......L..QPST.TYF.......Y..RC...............SND...T-.................................--S.RE..LSFRT...........................................
A0A0L9TR24_PHAAN/53-144                ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...P...............................D..................E.........P..GPS.......................HVQYG.TS.....K.SR.....................................L..R.TS........K.E..G.T......VA....N.YTF.........................................................................YNYK.S..GYIH.HCLVE....G.......L..KYNT.KYY.......Y..RI...............GSG...D-.................................-SA.RD..FW---fet........................................
Q4WE06_ASPFU/69-173                    ...........................................knnvnvisl--------.....-S.Y...L....PD..................GM..HVHYQ..T...P...............................F..................G........lG..VRP.......................SVKWG.KD.....P.KH.....................................L..D.RV........A.H..G.Y......TH....T.YDRtppc................................................................saikaVTQC.S..QFFH.EVSLD....K.......L..ESGT.TYY.......Y..QI...............PAA...NG................................tTQS.EV..LSFKT...........................................
A0A162NQH5_9BACT/48-146                ................................................agpy-----LQV.....VS.-...-....ST..................SM..SIRWI..T...E...............................V..................P.........-..SYS.......................WVEYG.ET.....A.-E.....................................L..G.KK........A.H..A.V......T-....-.-DG.........................................................................LVDA.Y..NRVH.EIILE....D.......L..EPGK.TYW.......Y..RI...............VSK...AI.................................---.--..-----ldfqpyklvygeqlnsdvytlst....................
Q6ZI95_ORYSJ/177-288                   ................................................pvyp----RLAQ.....GK.-...S....YD..................EM..TVTWT..S...G...............................Y..................Di.......sE..AYP.......................FVEWG.MV.....V.AGa..................................aaP..T.RT........A.A..G.T......-L....T.FNRgsmcg..............................................................epartvGWRD.P..GFIH.TAFLR....D.......L..WPNK.EYY.......Y..KI...............GHE..lSDg..............................siVWG.KQ..YTFR-a..........................................
A0A0D6TIB4_9FLAO/20-110                ...............................................tlypy-------L.....QN.A...T....PT..................SI..YINWK..T...S...............................N..................N.........-..SET.......................IVEYG.TD.....S.SS.....................................L..T.VT........V.T..G.N......TN....I.LTD.........................................................................VGYPgN..YYYH.SAKLT....N.......L..NPNT.KYY.......Y..KI...............KTG...S-.................................DVS.NI..YSFKT...........................................
R7C6Z3_9CLOT/1-91                      ...................................................m------TP.....GA.-...T....EK..................DL..NFCWY..S...K...............................T..................K.........-..GLA.......................KVKLG.KK.....E.DL.....................................S..D.AK........V.Y..D.G.....tVT....D.INRs.......................................................................nSVET.Y..KASN.KVSIK....G......aL..EKNT.TYY.......Y..SY...............SND...GT.................................TWS.KA..EKYQT...........................................
N1RV39_FUSC4/28-116                    ....................................................PVQQRLSL.....DG.-...-....PN..................SV..TIGWN..T...Y...............................A..................K.........Q..AKP.......................CVQYG.IS.....K.DK.....................................L..D.KQ........A.C..S.D......IS....L.T--.........................................................................YPTS.R..TWAN.AVTLD....N.......L..SPAT.KYY.......Y..KI...............VSQ...NS.................................---.--..-----vidqflspr..................................
A0A0Q4H5Z5_9MICO/247-338               ....................................................PSRVILTP.....TA.T...P....ET..................SQ..SFSWL..A...G...............................D..................A.........T.qTTG.......................HVEIR.PT.....A.GG.....................................D..I.RS........I.D..A.Y......AA....G.--S.........................................................................VNGN.P..LQHF.SATVD....G.......L..AAGT.AYT.......Y..RV...............GTD...T-.................................GWS.PW..TEFTT...........................................
E6U7F2_ETHHY/48-185                    ....................................................PYNINACF.....GT.-...D....AT..................KL..NFNWF..S...Q...............................S..................Snk.....ttG..TTS.......................QIQYT.LA.....G.NYtngtw...........................pttgvT..-.-T........V.N..A.T......QK....T.VTAtenisanapgfvlpgtn.......................................gsadgygdgvtngtapqNKVT.G..EYQN.MATAT....G.......L..AANT.KYA.......Y..RV...............SDG...T-.................................NWS.PV..YTIST...........................................
A0A0S4JC58_BODSA/177-271               ...................................................p-QEIFINF.....PD.S...T...dLT..................QM..RATWI..T...L...............................N..................E.........T..TGA.......................AVQWW.LE.....G.SS.....................................N.iV.HV........A.K..E.T......PR....T.YT-.........................................................................AGGW.I..GVIH.SAKMT....N.......L..IPDS.TYV.......Y..RV...............GGD...VT.................................GWS.QN..ITFKT...........................................
A0A0N0A428_9NOCA/41-155                ................................................plgr----RITF.....GA.D...P....AT..................QV..VISWQ..Q...L...............................E..................K.........V..TGP.......................YVRIA.TG.....A.SG.....................................F..G.AP........V.A..A.E......LR....T.LRSeldwqeg..........................................................dhsfpphgPDPM.Y..QYYL.HARLD....G.......L..KPDT.TYH.......Y..VV...............GHR...DHdpa...........................tstRPG.EI..ASFR-t..........................................
A0A0D2U3R3_GOSRA/58-149                ....................................................PQQVHITQ.....GD.M...D....GS..................GV..IISWI..T...P...............................D..................E.........P..GSN.......................MVYYW.SE.....N.SN.....................................H..K.YK........A.E..G.I......FV....R.YKF.........................................................................FNYT.S..GYIH.HCTIN....N.......L..EYNT.KYM.......Y..EI...............GRG...DS.................................--I.--..-----rqfwfvt....................................
A9S5K7_PHYPA/49-138                    ..................................................nl--QVHVSL.....AG.-...-....AK..................HM..RVSWM..S...P...............................A..................Ng.......kN..KTP.......................VVQYG.LT.....S.GN.....................................Y..T.ST........A.I..G.T......SE....S.YSF.........................................................................FLYT.S..GLMN.HVVIG....P.......L..EDST.IYY.......Y..KC...............GGA...G-.................................---.KE..YKFKT...........................................
R5IK64_9PORP/43-137                    ...............................................tcqpy-----LQQ.....VS.-...-....GT..................EA..TIMWA..T...N...............................K..................D.........-..AVS.......................WVEIA.PN.....D.TL.....................................H..F.YA........A.E..R.P......QF...fD.TNF.........................................................................GRKK.I..GKLH.KIRIT....G.......L..TPAT.SYR.......Y..RI...............FSK...EI.................................---.--..-----thkehqdirygrt..............................
A0A167G2Z7_9BACL/35-133                ....................................................PKSLVMTF.....ID.D...A....KT..................SR..AFTWY..T...D...............................N..................S.........N..VSS.......................VLQIV.KG.....S.ELkf................................dkeL..V.TT........I.T..G.I......TS....T.IA-.........................................................................SSQQ.V..QGVH.KAKVS....N.......L..EPGT.TYS.......Y..RV...............GSG...GD................................kDWS.KP..AIFTT...........................................
Q0AVJ0_SYNWW/46-138                    ....................................................PEQIILSW.....TS.D...P....LS..................SQ..TITWL..G...A...............................D..................D.........-..SLG.......................QLQYQ.AK.....S.SF.....................................N..G.SF........D.S..A.Q......QV....K.AEA........................................................................tKFDS.R..YYHY.SINIR....N.......L..TPDT.DYI.......Y..RL...............GKE...G-.................................CWT.EP..YFFST...........................................
J3NEE8_ORYBR/176-284                   ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Si.......kE..AMP.......................FVEWG.HK.....G.GS.....................................L..T.LS........P.A..G.T......LT....-.FSRnsmcg..............................................................spartvGWRD.P..GYIH.TSFLK....E.......L..WPDT.LYT.......Y..RLvh...........rlQDG...TH.................................IWS.KS..YSFR-a..........................................
A0A0G0JA05_9BACT/1103-1196             ...............................................ptias-----TTT.....AN.T...A....VT..................SA..TITWQ..T...N...............................E..................A.........-..ASS.......................YVQYA.TS.....A.EA.....................................M..V.LE........Y.K..-.-......EV....-.---.........................................................................GTDQ.L..STAH.EVVLE....G.......L..TQGQ.LYY.......Y..RV...............KSA...DSsgn..........................esqdPAS.EL..YSFTT...........................................
A0A1B6PIK2_SORBI/205-323               .................................................pvf---PRLAQ.....GK.-...S....HD..................EM..TVTWT..S...G...............................Y..................Di.......sE..AYP.......................FVEWG.AL.....L.VAaaga............................aappqQ..T.TR........A.P..A.G......TL....T.FNQgsmcg..............................................................epartvGWRD.P..GFIH.TAFLR....D.......L..WPNK.EYY.......Y..RI...............GHE..lHDg..............................svVWG.KP..YSFR-a..........................................
A0A0T6LTE4_9ACTN/82-187                ....................................................PFGRHLAF.....GA.D...P....RT..................QV..RVSWQ..V...P...............................V..................A.........V..RRP.......................FARIG.LR.....P.WE.....................................L..D.RR........L.P..A.R......VC....A.LHTpal...................................................................gpkAGPV.E..QYYL.HVAVD....G.......L..RPGT.TYF.......Y..AV...............GHD...GFdpa...........................sspALG.AI..GSFT-t..........................................
A0A0V0YRR7_9BILA/3-70                  ..................................................ep--------.....--.-...-....--..................--..-----..-...-...............................-..................-.........-..GSS.......................EVLFG.KS.....E.NK.....................................Y..N.LS........A.Q..G.T......LR....N.YTF.........................................................................YNYK.S..GYIH.HCLLS....G.......L..EYNT.RYY.......Y..KI...............GVG...S-.................................-SA.RE..FWFDT...........................................
W5H5P4_WHEAT/74-166                    ....................................................PQQVHISL.....SG.-...-....EK..................HM..RITWV..T...D...............................D..................N.........S..VPS.......................VVDYG.TK.....S.NA.....................................Y..T.SS........S.N..G.E......ST....S.YSY.........................................................................LMYS.S..GKIH.HVVIG....P.......L..EDNT.IYY.......Y..RC...............GGR...GS.................................---.--..-----efqlktppsqf................................
A0A099WB08_9LIST/222-319               ....................................................PSKIAVTF.....FG.N...T....QT..................QK..GVTWH..T...K...............................S..................D.........-..AGS.......................DLQYV.KA.....V.GTgvp...............................sfaG..A.QT........V.T..G.K......--....-.--Se......................................................................anDAAI.G..GFSH.QVAAK....Y.......L..DSGT.TYW.......Y..RV...............GDK...TR................................dKWS.EP..AKFTT...........................................
W2YSW4_PHYPR/243-349                   ....................................................PKHVHTAY.....GR.-...T....PG..................SL..SVQWM..T...K...............................Qf................cA.........E..GDT.......................QLKLV.EG.....Y.HAhieve..........................gpkatpV..A.AW........A.N..T.T......LF....E.DEG.........................................................................EAQS.K..RWMH.VVRLE....G.......L..KPDT.RYT.......Y..VV...............GNA...HY................................sSWS.IP..YVTKT...........................................
A0A0N1KM94_9BURK/55-151                ....................................................PEQVHLTW.....GN.D...P....TS..................EV..TVSWA..S...P...............................A..................P.........A..VNP.......................QVRLS.GG.....G.GA.....................................R..-.VT........V.H..G.V......QS....T.YTD........................................................................gINGE.V..VFTY.HARLR....G.......L..KADT.SYE.......Y..EV...............SAD...NDs..............................naAQP.FT..ASFR-t..........................................
H0WY64_OTOGA/32-125                    ....................................................PEQVHLSY.....PG.-...E....PG..................SM..TVTWT..T...W...............................V..................P.........-..TRS.......................EVQFG.MQ....lA.GH.....................................L..P.LR........A.Q..G.T......FS....T.FVDg.......................................................................gVLRR.K..FYIH.RVTLR....G.......L..LPGA.EYV.......Y..RC...............GSA...Q-.................................GWS.RR..FRFR-a..........................................
R0HJI3_9BRAS/44-135                    ....................................................PEQVHISL.....VG.-...-....PD..................KM..RISWI..T...K...............................D..................P........iI..PFP.......................SVVYG.TA.....S.GK.....................................Y..E.GL........A.N..G.T......SS....S.YHY........................................................................lMIYR.S..GQIN.EVVIG....P.......L..KPNT.VYY.......Y..KC...............GRP...G-.................................-ST.QE..FSFRT...........................................
F4KTN8_HALH1/29-118                    .................................................vqp----YLQF.....ST.-...-....QT..................GM..YVLWE..T...K...............................E..................P.........-..ATT.......................LVQFG.EA.....R.SN.....................................V..D.QV........V.L..D.R......EV....R.L--.........................................................................--EG.Q..RLMH.EVLLD....N.......L..KPET.NYF.......W..QV...............TTV...TQsg.............................erIQT.PV..YTFKT...........................................
Q2QLL6_ORYSJ/66-131                    ....................................................PQQVHITL.....GD.Q...T....GT..................AM..TVSWV..T...M...............................E..................E.........A..GNS.......................TVLYG.LA.....M.DK.....................................L..D.MA........A.D..A.T......VT....T.YTY.........................................................................YNYT.S..GFIH.HCT--....-.......-..----.---.......-..--...............---...--.................................---.--..-----p..........................................
A0A0G1TBW8_9BACT/278-373               ................................................peis----AVSI.....SE.L...K....GE..................SA..VITWN..T...A...............................N..................E.........K..ANS.......................LVMYS.LD.....G.SD.....................................F..N.KI........A.G..D.S......TV....L.TS-.........................................................................-SEN.Y..TTAH.SVTIS....D.......L..IPAS.KYV.......F..TA...............ISS...DAag.............................niSQS.VQ..SSFTT...........................................
M0WKF8_HORVD/63-176                    ....................................................PEQIAVAL.....SA.-...A....PT..................SA..WVSWI..T...G...............................Dfqmgga......vkpldpG.........T..VGS.......................VVRYG.LA.....A.DS.....................................V..V.RE........A.T..G.D......AL....V.YSQlyp..................................................................feglQNYT.S..GIIH.HVRLQ....G.......L..EPGT.KYY.......Y..QC...............GDP...AIp...............................gAMS.AV..HAFRT...........................................
W9R991_9ROSA/54-165                    ....................................................PEQIALAI.....SS.-...-....PT..................SM..WVSWV..T...G...............................Daqigln......vtpldpK.........T..VAS.......................EVWYG.KK.....S.GK.....................................Y..T.NV........Q.R..G.I......ST....V.YSQlyp..................................................................fkglLNYT.S..GIIH.HVKLD....G.......L..EPGT.KYF.......Y..KC...............GDS...SF................................qALS.KV..HSFE-s..........................................
L7F9E2_9ACTN/77-182                    ....................................................PFGRHLAW.....GN.D...P....RT..................EI..TVSWQ..V...P...............................V..................A.........V..KKP.......................FIRIG.AH.....P.WD.....................................L..S.RK........I.E..A.E......VR....T.LYTpag...................................................................igaSGDH.T..QYYL.HAELT....H.......L..RPGR.TYY.......Y..GV...............GHA...G-.................................---.--..-----fdpaeahllgtlgtftt..........................
R6E1I5_9BACE/25-132                    ...............................................wlcdm--------.....--.-...T....ED..................AV..TVVWK..T...D...............................V..................P.........-..STA.......................WVECA.ED.....N.GQ.....................................H..F.YS........E.E..H.E......-R....I.YEAr......................................................................fgRRLT.H..ETIH.SVRLT....G.......L..KPGT.KYM.......Y..RI...............FSQ...AV................................tGW-.--..-----nhsddakfgeiassvvykkepyrfkt.................
A0A067S7A9_9AGAR/38-128                ....................................................PVQVRLAY.....AG.-...-....PT..................GM..QISWN..T...F...............................S..................K........lP..SAP.......................TVRYG.FT.....P.SF.....................................L..P.FVs.....spE.N..A.E......SV....T.---.........................................................................YATS.L..TFSN.HVRLV....H.......L..FPNT.NYY.......Y..QP...............VHA...N-.................................-SS.VV..YSFKT...........................................
A9PF43_POPTR/77-192                    ....................................................PEQISLSL.....SA.-...T....YD..................SV..WISWI..T...G...............................Efqmsnhn...knitpldpK.........S..VAS.......................VVRYG.TL.....R.NP.....................................L..N.HE........A.K..G.Y......SL....V.YSQlyp..................................................................feglQNYT.S..GIIH.HVRLT....G.......L..KPDK.LYY.......Y..RC...............GDP...SI................................gALS.DV..YSFKT...........................................
A0A0S2TEK9_9GAMM/575-676               ...............................................aavsd-----LAT.....TN.P...T....ST..................SV..ALTWT..A...P...............................G..................Ddgl...mgtA..SSY.......................DIRYS.TS.....A.IN.....................................D..G.NW........A.S..A.T......QA....S.GEP.........................................................................TPSA.A..GSNQ.SFTVT....G.......L..SPGT.TYY.......F..AI...............KTS...DN.................................-AS.--..-----ntsalsnsps.................................
A0A0M2YZ16_9ACTN/74-179                ....................................................PFGRHLAY.....GN.D...A....GT..................EM..TISWQ..V...P...............................V..................A.........V..KRP.......................FVRIG.TH.....A.SH.....................................L..S.VK........I.D..A.E......VR....S.LYTpag...................................................................igaSGDH.T..QYYV.HAKLA....N.......L..KPGK.TYY.......Y..GV...............GHD...GF.................................---.--..-----dpaspkfagtigtftt...........................
D3F6U4_CONWI/47-163                    ....................................................PDRVALIP.....TE.D...P....AR..................SQ..RVSWR..S...N...............................A..................T.........-..-AP.......................KAQII.EA.....P.AAfgdtmmdrl...................tpidgtdytR..I.VT........V.E..A.T......TS....T.VDP.........................................................................RTGY.T..NRYH.AVEFR....D.......L..KPGT.RYA.......Y..RV...............GDG...TDpng..........................wpvtNWT.AW..EDFTT...........................................
A0A0D1WYJ2_9EURO/69-172                ................................................tnni----NVIQ.....LS.Y...L....PT..................GI..NVHYQ..T...P...............................F..................G........iG..CSP.......................IVKWG.TS.....A.SN.....................................L..N.ET........A.T..G.Y......SR....T.YDRtppc.................................................................slvaVTQC.S..EFFH.DISIT....K.......L..KSGA.TYY.......Y..QI...............PAA...NG................................tTAS.PV..MSFKT...........................................
A0A0C9MZ00_SPHPI/45-138                ..................................................va--GLHLQF.....GE.D...A....TS..................QI..VVSWH..A...L...............................E..................S.........V..QRP.......................QVVLG.HP.....D.GT.....................................L..L.RT........V.D..A.V......ER....S.YVD........................................................................aKSGQ.R..VHAF.HARLD....T.......L..TPDT.EYM.......Y..AA...............VHD...G-.................................AGP.EF..GNFRT...........................................
A0A087H7R4_ARAAL/74-186                ....................................................PEQISLSL.....SS.-...D....HD..................SI..WVSWI..T...G...............................Efqigkn......vkpldpT.........S..IDS.......................IVQFG.TL.....R.HS.....................................L..S.HE........A.K..G.H......SL....I.YSQlyp..................................................................fdglLNYT.S..GIIH.HVRIT....G.......L..KPST.VYY.......Y..RC...............GDP...SL................................hAMS.KI..HHFRT...........................................
A2WW15_ORYSI/85-186                    ...............................................kplhg----HLSS.....--.-...V....DS..................KM..RLTWV..S...G...............................D..................A.........-..RPQ.......................QVQYG.TG.....K.TA.....................................T..S.VA........T.T..F.T......HK....D.MCSiavlp..............................................................spakdfGWHD.P..GYIH.SALMT....G.......L..QPSQ.SYN.......Y..RY...............GSD...SV.................................GWS.NT..TEFRT...........................................
A0A089IRM8_9BACL/316-426               ....................................................PKSINMTF.....NG.D...P....KT..................SI..ALAWY..T...D...............................A..................M.........-..TDT.......................VVQVI.EA.....S.KV.....................................M..G.NI........F.P..E.N......GA...lT.YQGeaeeietf.........................................................msksdrstNHKT.K..FISH.KVIAD....Q.......L..QPGT.AYK.......F..RA...............GNG...KS................................gDWS.SI..GSFTT...........................................
A0A194RHJ9_PAPMA/33-124                ....................................................PEQVHISF.....GE.-...K....TN..................DI..VATWS..T...F...............................N..................D.........T..GES.......................RAQYG.VG.....Q.MD.....................................Q..E.AS........G.R..S.T......LF....V.DGG.........................................................................HERR.A..QFIH.RVLMK....D.......L..KHDT.TYV.......Y..HV...............GSE..fG-.................................-WS.EE..FWFKT...........................................
A0A074XFE4_AURPU/71-174                ........................................tnnvnvislayi--------.....--.-...-....PG..................GM..NIHYQ..T...P...............................F..................G........lG..SAP.......................QVQWG.TQ.....Q.DN.....................................L..C.NV........A.T..G.Q......SN....T.YARtppc.................................................................slapVTQC.S..EHFH.EVQIT....G.......L..KPNT.KYW.......Y..RI...............PAA...NG................................tTES.QT..LSFRT...........................................
J1K108_9RHIZ/72-218                    ....................................................PNRITSTL.....KE.P...T....DT..................SR..SFRWF..T...S...............................E..................E.........A..QSP.......................VVRID.TH.....K.DM....................................kN..A.QS........F.P..A.Q......TK....I.VNShflernedgffiykviddkntvvryf.....................tdagiddvkwepknevknknetvaidIIPV.K..EITY.SADIQ....G.......L..NPGT.VYY.......Y..QV...............GDE...NG.................................ELS.DV..GQFKT...........................................
D7MHN1_ARALL/53-144                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...P...............................D..................E.........P..GSS.......................KVYYG.AV.....Q.GK.....................................Y..E.FV........A.E..G.T......YH....N.YTF.........................................................................YKYK.S..GFIH.HCLVS....G.......L..EHDT.KYY.......Y..KI...............ESG...D-.................................-SS.RE..FWFVT...........................................
F7W6U3_SORMK/27-101                    ...........................................talpglils--------.....--.-...-....--..................--..-----..-...-...............................-..................-.........-..-SS.......................SVYWG.LS.....K.DR.....................................L..H.NV........A.M..S.N......IS....V.T--.........................................................................YSTS.T..TYNN.HVLIS....G.......L..WPDT.TYF.......Y..HP...............SPL..mKS.................................TST.DI..FNFTT...........................................
S8EB77_9LAMI/171-279                   ................................................plyp----RLAQ.....GK.-...S....WD..................EM..TVTWT..S...Gy.............................gT..................A.........E..SQP.......................FVEWG.PK.....G.RE.....................................Q..R.L-........S.P..A.V......TL....T.FDRsslcg..............................................................ppartvGWRD.P..GFIH.TSFMK....E.......L..WPNS.WYS.......Y..RL...............GHEl.lDGt...............................lIWS.EV..HQFK-s..........................................
R6XFP2_9FIRM/227-328                   ..................................................af--NIMTGF.....GD.N...A....AT..................DI..EINYH..T...H...............................N..................T.........-..-LT.......................TIEYT.LA.....S.DV.....................................E..F.KN........A.T..V.V......SP....T.TGYyfasg...............................................................pekvlVDFT.P..RNVM.RASIK....G.......L..KPNT.DYI.......Y..RI...............NKG...ND.................................TYS.EV..YHVKT...........................................
A0A0P1AWD5_9STRA/1-83                  ....................................................--------.....--.-...-....--..................-M..TISWS..T...K...............................L..................K.........T..ATS.......................IVRFG.LT.....K.NDl...................................lT..M.QQ........S.E..E.P......CE....Q.YKF.........................................................................CSYT.S..PWLH.HVTIP....Gd.....kL..KPNT.LYF.......Y..QC...............GDE...AG.................................GWS.DI..YTFT-a..........................................
V9EGJ3_PHYPR/20-120                    ...................................................s-SQFHLSL.....VE.K...E....DNg...............qvHY..MVDWV..T...A...............................S..................T.........V..NSS.......................RLIVG.TS.....A.DD.....................................L..S.SA........V.D..G.K......RA...gL.VRE.........................................................................AADE.D..VACW.SALLS....N.......L..EPGS.TIF.......Y..AL...............ESD...AT.................................---.--..-----qqttssldfdels..............................
M1BIV5_SOLTU/218-320                   ................................................plyg----HLSS.....ID.S...T....AT..................SM..RVTWV..S...G...............................D..................K.........-..APQ.......................QLQYG.EG.....K.SQ.....................................T..S.QV........S.T..F.T......QK....D.MCSsilks...............................................................pakdfGWHD.P..GFIH.SAIMT....G.......L..NPST.TNS.......Y..TY...............GSD...SS.................................GWS.EK..ITFKT...........................................
M7YZ57_TRIUA/181-284                   ...................................................p-LNGHLSS.....TD.S...S....AT..................SM..KITWV..S...G...............................D..................G.........-..RPQ.......................QVQYA.GG.....R.AA.....................................A..S.VA........T.T..F.T......QK....-.--Dmcsapll...........................................................pspakdfGWHD.P..GYIH.SAVMT....G.......L..QPSQ.SYA.......Y..RY...............GSD...SV.................................GWS.DT..VKFRT...........................................
A0A0F4Z5N0_TALEM/29-116                ....................................................PMQIRLAY.....AG.-...-....ST..................GM..VVSWN..T...Y...............................S..................K.........L..DRP.......................TVRYG.LT.....P.WA.....................................L..T.KT........A.S..S.N......VS....V.T--.........................................................................YPTS.T..TYNN.HVTIT....G.......L..EPDT.VYY.......Y..QP...............QNS...N-.................................-SS.VP..YSFKT...........................................
A0A101HIM7_9PORP/220-317               ...............................................ipylq--------.....-N.P...A....AD..................EM..TVMWL..T...N...............................V..................P.........-..ARS.......................WVEYG.TN.....P.DN.....................................L..K.RV........R.T..F.L......EG....V.---.........................................................................-MVA.N..NKIN.QVRLT....G.......L..QPGT.KYY.......Y..RV...............VSQ...EItryssy....................ykefgdtVRS.DI..KSFTT...........................................
W5I3D6_WHEAT/55-146                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...P...............................S..................E.........P..APS.......................QVFYS.KE.....E.NR.....................................Y..D.QK........A.Q..G.T......MT....N.YTF.........................................................................YDYK.S..GYIH.HCLVD....G.......L..EYNT.KYY.......Y..KI...............GTG...D-.................................-SA.RE..FLF--qt.........................................
Q9VZ57_DROME/38-131                    ....................................................PEQVHLSF.....GE.-...T....VL..................DI..VVTWN..T...R...............................D..................N.........T..NES.......................ICEFG.ID.....G.LH.....................................Q..R.VK........A.T..Q.M......PT....K.FVDg.......................................................................gAKKA.T..QYIH.RVTLS....H.......L..KPNS.TYL.......Y..HC...............GSE...L-.................................GWS.AT..YWFRT...........................................
A0A0S7X283_9BACT/212-302               ...............................................visdi------AA.....TS.T...T....AT..................ST..RITWT..T...D...............................E..................E.........-..ADS.......................KVWYD.TT.....T.SF.....................................V..I.AT........S.T..A.V......VS....-.---.........................................................................-SST.L..ETTH.DLTLT....D.......L..TAST.TYY.......Y..LV...............VSA...DAsg.............................ntATS.TE..QLFTT...........................................
A0A072VTY2_MEDTR/194-297               ................................................plyg----HLSS.....ID.S...T....AT..................SM..RLTWV..S...G...............................D..................K.........-..EPQ.......................QVQYG.DG.....K.TV.....................................T..S.EV........T.T..F.S......QD....-.--Dmcssvvl...........................................................pspakdfGWHD.P..GFIH.SAIMK....G.......L..EPSS.TYS.......Y..RY...............GSN...SV.................................DWS.EQ..IKFST...........................................
S8C1Q7_9LAMI/57-149                    ....................................................PQQVHITQ.....GD.S...L....GT..................SM..IVSWI..T...P...............................D..................I........pE..TAS.......................IVSYW.SD.....P.AP.....................................L..V.KP.......fA.T..G.T......CT....Q.YTY.........................................................................YNYT.S..GYIH.HTNIT....D.......L..EPNT.KYY.......Y..TV...............GEL...T-.................................--E.RT..FWFTT...........................................
L5KMS2_PTEAL/35-128                    ....................................................PEQVHLSY.....PG.-...E....PG..................SM..TVTWT..T...W...............................V..................P.........-..THS.......................EVQFG.MQ....lT.GP.....................................L..P.LR........A.Q..G.T......VS....P.FVDg.......................................................................gLLRR.K..LYMH.RVTLR....G.......L..LPGV.QYV.......Y..RC...............GSS...R-.................................GWS.RR..FRFR-a..........................................
A9URA5_MONBE/27-126                    ....................................................PTQVHINL.....GD.N...E....GT..................SM..VVSWI..T...N...............................A..................A.........-..TDG.......................YVQFG.TD.....P.DH.....................................L..D.SS........A.D..Q.M......EK....A.YRYnfrs.................................................................tyspEVYT.S..GLIH.HANMT....G.......L..EPNT.QYF.......Y..RC...............GGK...Q-.................................GTS.TT..FNFTT...........................................
W2PUM3_PHYPN/243-349                   ....................................................PKHVHTAY.....GR.-...T....PG..................SL..SVQWM..T...K...............................Qf................cA.........E..GDT.......................QLKLV.EG.....Y.HAhieve..........................gpkatpV..A.AW........A.N..T.T......LF....E.DEG.........................................................................EAQS.K..RWMH.VVRLE....G.......L..KPDT.RYT.......Y..VV...............GNA...HY................................sSWS.IP..YVTKT...........................................
A0A0L0N0Z7_9HYPO/39-128                .................................................pvq---QRIAI.....HG.-...-....PN..................DV..SIGWN..T...Y...............................K..................Q.........L..SQP.......................CVQYG.TS.....D.DA.....................................L..L.SQ........A.C..S.S......SS....V.T--.........................................................................YPTS.R..TWSN.SVTLK....E.......L..KPAT.TYY.......Y..KI...............VST...N-.................................--S.SV..DHF--msprt......................................
K4CBX6_SOLLC/187-295                   ................................................plyp----RLAL.....GK.-...S....WD..................IM..TVTWT..S...G...............................Y..................Ni.......dE..AVP.......................FVEWG.WK.....G.QE.....................................Q..K.RS........P.A..G.T......LT....F.H-Rnsmcg..............................................................tparsvGWRD.P..GFIH.TSFLK....D.......L..WPNM.EYT.......Y..KL...............GHM..lNNg..............................siVWS.KQ..YSFK-s..........................................
W6QHE1_PENRF/33-122                    ....................................................PFQQRLTV.....YG.-...-....PN..................AV..SVGWN..T...Y...............................E..................Q.........L..NQS.......................CVNYG.LS.....E.TN.....................................L..N.TK........A.C..S.S......SS....T.T--.........................................................................YDPS.R..TWSN.VAVLT....G.......L..TPAT.TYY.......Y..KI...............DST...N-.................................--S.TI..GHF--lsprt......................................
A0A0N5BAV9_STREA/79-175                ...................................................h-EQVHISL.....AK.-...D....PR..................TM..VISWT..T...F...............................F..................Dms.....kmN..NNP.......................TVKYG.LN.....S.SN.....................................L..A.LT........E.T..G.S......TK....I.FKH........................................................................iTGNI.T..RYFH.RVYLT....D.......L..LFDT.TYY.......Y..KV...............GDD...Q-.................................TWS.KI..FYFHT...........................................
H3HAI8_PHYRM/71-168                    ....................................................PQQVHLAY.....AG.E...T...aGT..................GM..TVSWA..T...Y...............................E..................A.........V..SDS.......................SLWVG.SS.....K.DS.....................................L..T.LV........D.T..TvE......SA....N.YYH.........................................................................DDTY.D..MYHH.HAKVS....G.......L..SPHT.KYY.......Y..KV...............GSK...AQt...............................tYQS.DV..HSFVT...........................................
A0A1B6PDP5_SORBI/168-276               ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Ni.......kE..AVP.......................FVEWG.PK.....G.GD.....................................R..T.LS........P.A..G.T......LT....F.GRNsmcgs...............................................................partvGWRD.P..GYIH.TSFLK....E.......L..WPDA.LYT.......Y..RL...............GHR..lSDg..............................thIWS.KS..YSFR-a..........................................
G8TEK4_NIAKG/34-115                    ................................................rgpy-----LQV.....AS.-...-....ST..................SI..VIRWR..T...D...............................A..................L.........-..QRS.......................VVNYS.AD.....D.KK.....................................L..T.GL........A.S..D.P......ML....-.---.........................................................................----.-..TFEH.KVTIT....G.......L..TPRT.KYY.......Y..AI...............GGG...A-.................................---.--..-----gdtlqkgtdnyf...............................
A0A0E0ACE9_9ORYZ/54-145                ....................................................PQQVHITQ.....GD.Y...N....GK..................AV..IVSWV..T...V...............................A..................E.........P..GTS.......................EVLYG.KN.....E.HQ.....................................Y..D.QR........A.E..G.T......VT....N.YTF.........................................................................YDYK.S..GYIH.HCLVD....G.......L..EYNT.KYY.......Y..KI...............GSG...D-.................................-SA.RE..FWFET...........................................
G9YFZ7_9FIRM/29-124                    ..............................................eyvlqv-------V.....GA.D...G....AV..................SR..SVTWQ..D...A...............................E..................G.........R..SDY.......................RFIYR.KR.....K.DA.....................................Q..E.IQ........V.P..V.T......EQprppR.YNA.........................................................................DWQQ.A..PYTY.SAAMH....D.......L..EPET.VYE.......F..RI...............GSA...A-.................................EMK.EW..QSFKT...........................................
H2SPA2_TAKRU/408-499                   ............................................savsiihq--------.....VN.R...S....PT..................SI..TLSWS..Q...P...............................D..................Q.........P..NGV.......................ILEYE.LQ.....Y.YE.....................................K..Q.NQ........A.E..W.N......AS....-.---.........................................................................--LT.K..SQTN.TAVIR....G.......L..KSGT.IYV.......F..QV...............RAR...TVag.............................fgRFS.GK..MYFQT...........................................
A0A0D3DXG6_BRAOL/145-248               ....................................................PEQIHLAF.....ED.-...K....VN..................RM..QVTFV..A...G...............................D..................G.........-..EER.......................FVRYG.EG.....K.DA.....................................L..A.NS........A.A..A.R......GI....R.YERehmcna.............................................................panstiGWRD.P..GWIF.HTVMK....N.......L..NGGV.RYF.......Y..QV...............GSD...SK.................................GWS.EI..HSF--ia.........................................
H3NKV8_9LACT/94-260                    ....................................................PNRISTNL.....SE.D...P....ST..................SM..LFQWH..T...T...............................D..................P.........D..DAA.......................RLYVW.KE.....G.ES.....................................L..E.DA........V.E..F.T......PE....L.VEIkdaiysqetedghhifaimwdeeedepytddddpgypinnpdkvlgyytdeaftadnllwldkgfdeyslilpYPEF.T..ETAY.KAEAT....D.......L..EPAT.TYH.......Y..VV...............GNK...EG.................................ELS.AE..GQFTT...........................................
B9S512_RICCO/79-191                    ....................................................PEQISVSL.....SS.-...S....FD..................SV..WISWI..T...G...............................Dfqigys......itpldpA.........R..VAS.......................IVRYG.TL.....R.YP.....................................L..S.RE........A.S..G.Y......SL....V.YSQlyp..................................................................fdglQNYT.S..GIIH.HVRLT....G.......L..KPDR.VYY.......Y..RC...............GDP...SI................................kAMS.GI..RSFKT...........................................
A0A0D9VVS2_9ORYZ/92-179                ....................................................PQQVHISL.....AG.-...-....EK..................HM..RITFV..T...D...............................D..................N.........T..VPS.......................VVDYG.TE.....T.GT.....................................Y..T.ST........S.E..G.E......ST....S.YNY.........................................................................LMYS.S..GKIH.HVVIG....P.......L..NDNT.VYF.......Y..RC...............GGH...G-.................................---.PE..FQFKT...........................................
A0A0D9ZFS8_9ORYZ/8-89                  ................................................ldpt--------.....--.-...-....--..................--..-----..-...-...............................-..................-.........A..VAS.......................VVRYG.LA.....A.DS.....................................L..V.RR........A.T..G.D......AL....V.YSQlyp..................................................................fdglLNYT.S..AIIH.HVRLQ....G.......L..EPGT.EYF.......Y..QC...............GDP...AIp...............................aAMS.DI..HAFRT...........................................
A0A101SSU4_9ACTN/78-183                ....................................................PFGRHLSF.....GA.D...P....RT..................GM..RISWQ..V...P...............................A..................A.........V..RAP.......................YVRIG.TR.....P.DD.....................................L..G.GT........V.E..A.E......VR....A.LHTpgv...................................................................egvRKAL.D..QYYV.HASVT....D.......L..LPGT.TYY.......Y..GV...............GHD...GFdpa...........................daeHRA.TI..TSFRT...........................................
A0A0C1FDP5_9SPHI/44-143                ..............................................vgpylq--------.....-T.N...F....NN..................SM..TILWL..T...N...............................K..................N.........-..AAG.......................WVEFG.EQ.....A.DQ.....................................L..N.QK........A.Y..G.K......AE....L.G--.........................................................................LMQA.N..SKLS.AVTLN....H.......L..KPGT.KYY.......Y..KI...............VSK...EI.................................---.--..-----kdfqpykltygetvssnvesfl.....................
B8BJ51_ORYSI/56-144                    ....................................................PEQVHISA.....VG.-...-....SD..................KM..RVTWI..T...G...............................G..................D.........-..APA.......................TVEYG.TT.....S.GQ.....................................Y..P.FS........A.T..G.S......TN....T.YSY.........................................................................VLYH.S..GNIH.DVVLG....P.......L..QPST.TYF.......Y..RC...............SND...TS.................................---.--..-----relrarea...................................
V7AD87_PHAVU/217-319                   ................................................plyg----HLSS.....TD.S...T....GT..................SM..RLTWV..S...G...............................D..................K.........-..EPQ.......................QIQYA.NG.....K.AV.....................................T..S.TV........S.T..F.S......QA....D.--Mcssalp.............................................................spakdfGWHD.P..GYIH.SALMT....G.......L..KPSS.AFS.......Y..KY...............GSD...SV.................................GWS.KQ..NQFST...........................................
W5BR98_WHEAT/1-43                      ...................................................s--------.....--.-...-....--..................--..-----..-...-...............................-..................-.........-..---.......................-----.--.....-.--.....................................-..-.--........-.-..-.-......--....-.YRY.........................................................................YLYS.S..GKIH.HVTIG....P.......L..DPDT.VYY.......Y..RC...............GTV...GD.................................---.--..-----eftlktpp...................................
A0A0D3H8N5_9ORYZ/178-289               ................................................pvfp----RLSQ.....GK.-...G....WN..................EM..AVTWT..S...G...............................Y..................Nv.......dE..AYP.......................FVEWR.MN.....G.KEn...................................aR..A.RR........S.P..A.D......TL....T.FTRnhlcg..............................................................kpanaeGYRD.P..GFIH.TAFLK....N.......L..WPNR.EYS.......Y..QM...............GHEl.lDGt...............................iVWG.KS..STFR-a..........................................
A0A0K9QJ04_SPIOL/176-284               ................................................plyp----RLAI.....GK.-...S....WD..................EM..TVTWT..S...G...............................Y..................Ni.......dE..AVP.......................FVQWG.PP.....D.-L.....................................I..P.KR........A.P..A.G......TL....T.YTRktlcg..............................................................apartvGWRH.P..GFIH.TSFLK....D.......L..WPNQ.LYM.......Y..RM...............GHIl.sNGs...............................yVWS.KT..YSFK-a..........................................
A0A0K9PN95_ZOSMR/57-149                ....................................................PQQVHVSL.....SG.-...-....EK..................YM..RITWI..T...D...............................D..................E.........T..SPS.......................IVNYG.TS.....S.GN.....................................Y..T.ST........S.K..GgE......TT....S.YKY.........................................................................LFYK.S..STIH.YAIIG....P.......L..ESNT.LYF.......Y..QC...............GDQ...S-.................................---.PE..FH---lktppsq....................................
B8BN70_ORYSI/57-151                    ....................................................PEQVHITL.....GD.Q...T....GR..................AM..TVSWV..T...P...............................K..................L.........P..DSN.......................VVRYG.LR.....A.DN.....................................L..T.HT........A.N..G.T......FR....R.YSF........................................................................gRKYL.S..GFIH.HATLT....G.......L..DYGT.KYH.......Y..AV...............GSG...DT.................................ASA.RS..FSFTT...........................................
M4EZR4_BRARP/60-151                    ....................................................PQQVHITQ.....GN.H...E....GN..................GV..IISWV..T...P...............................S..................A.........P..CSN.......................TVRYW.SE.....N.GK.....................................S..K.KL........A.E..A.T......MN....T.YRF.........................................................................FNYT.S..GYIH.HCLID....D.......L..EFDM.KYY.......Y..EI...............GSW...K-.................................-WR.RR..FWFFT...........................................
U7PSG6_SPOS1/72-176                    .........................................tnnvnvislay--------.....--.-...V....PG..................GI..NIHYQ..T...P...............................F..................G........lG..EAP.......................SVAWG.TS.....A.AA.....................................L..T.NT........A.T..G.A......SH....S.YERtppc................................................................slvaaVTQC.S..QFFH.EVQLT....G.......L..KPDT.TYY.......Y..QI...............PAA...NG................................tTAS.EV..LHFTT...........................................
A0A0C1VKH4_9ACTN/81-187                ....................................................PFGRHLQY.....GA.D...P....KT..................QM..RVSWQ..V...P...............................F..................A.........V..GKP.......................YLRVG.TS.....P.WA.....................................L..G.VK........V.D..A.E......VR....H.LSTpvl..................................................................nggkIAAA.E..QFYL.HAALD....R.......L..RPGQ.TYY.......Y..GV...............GHD...GF.................................---.--..-----dpadhrnvgtlgtftt...........................
A0A0P0XZH6_ORYSJ/100-189               ....................................................PQQVHISM.....VG.-...-....EK..................NM..RISWV..T...D...............................D..................L.........N..APS.......................VVEYG.TS.....P.GK.....................................Y..T.AS........A.T..G.D......HT....T.YRY.........................................................................FLYK.S..GAIH.HATIG....P.......L..EAST.TYH.......Y..RC...............GKA...GD.................................---.--..-----eftlrtpp...................................
A0A0J9V2D1_FUSO4/50-138                ....................................................PVQQRLSL.....DG.-...-....PN..................SV..TIGWN..T...Y...............................A..................K.........Q..AKP.......................CVQYG.SS.....K.DN.....................................L..D.KQ........A.C..S.D......IS....L.T--.........................................................................YPTS.R..TWAN.AVTLG....N.......L..SPAT.KYY.......Y..KI...............VSQ...NS.................................---.--..-----vidqflspr..................................
M0SF11_MUSAM/170-278                   ...............................................pvypr-----LAQ.....GK.-...L....WN..................EM..SVTWT..S...G...............................Y..................Gi.......nE..AEP.......................FVEWG.AR.....G.DS.....................................Q..V.RS........P.A..G.T......L-....T.FSRnsmcg..............................................................apartvGWRD.P..GFIH.TSFLK....D.......L..WPNK.MYT.......Y..KL...............GHKl.iNDs...............................yVWS.RS..YSFK-a..........................................
J1L4T2_9EURY/29-106                    ..................................................py-------V.....TG.T...T....DD..................SA..VVSWR..T...D...............................L..................P.........-..AKG.......................SVLYG.PA.....G.GG.....................................L..T.LT........V.A..-.-......--....-.---.........................................................................-DGQ.A..ADLH.HLTLT....G.......L..SPGT.EYT.......Y..LI...............SLN...G-.................................TTG.PS..GQFRT...........................................
A0A0N8K3V1_9RHOB/241-340               ....................................................PDHIIQTW.....QG.D...P....RE..................EI..TIQWR..T...R...............................A..................G.........T.aSDP.......................VLWYA.IE.....G.DD....................................dS..L.AY........A.R..A.E......TT....T.LTSr......................................................................qlVDDP.A..VDLH.RVRMT....G.......L..QPGT.SYT.......F..GV...............SAD...GG................................eNWS.ES..RDFHT...........................................
D3IJN0_9BACT/35-123                    ................................................icdm--------.....--.-...D....ST..................GT..TIVWV..T...D...............................V..................P.........-..GMS.......................WVEIA.PD.....S.TDh...................................fY..G.RA........R.Q..R.Y......YD....V.LAG.........................................................................RKVL.T..DSVH.RVRIE....G.......L..KPDT.KYR.......Y..RV...............FTQ...E-.................................-VA.E-..-----wryddwvtl..................................
B4M7R1_DROVI/46-140                    ....................................................PEQVHLAF.....GE.-...T....VL..................DI..VVTWN..T...R...............................D..................N.........T..NES.......................ICEYG.ID.....G.IA.....................................E.qR.IK........A.P..H.G......PS....A.FVDg.......................................................................gAKKA.K..QYIH.RVTLA....E.......L..RPNT.TYH.......Y..HC...............GSQ...L-.................................GWS.AI..YWFHT...........................................
A0A0D1AMG7_9SPHN/53-149                ....................................................PDRIVLTP.....GA.D...P....TQ..................AM..AVSFR..T...D...............................L..................R.........Q..PGA.......................EAQIV.EA.....V.DSp...................................tL..D.RN........A.R..A.L......SG....T.NTKa.......................................................................dTSSG.A..AIYH.HVDFT....G.......L..KPDT.VYA.......Y..RL...............KGA...G-.................................GWS.EW..LQFRT...........................................
A0A0U3PNR7_9ACTN/80-185                ....................................................PFGRHLAF.....GA.D...P....KT..................QM..RVSWQ..V...P...............................L..................A.........V..HGP.......................YVRLG.VR.....P.DD.....................................L..G.RR........V.P..A.E......VR....G.LHTpgv...................................................................tgvRPAL.Q..QYYL.HAALD....G.......L..LPGT.TYY.......Y..GV...............GHE...GFdpa...........................apaHRS.TI..ASFRT...........................................
A0A059DG26_EUCGR/56-143                ....................................................PQQVHISL.....AG.-...-....SD..................HM..RVTWV..T...E...............................D..................H.........R..SHS.......................TVEYG.TA.....P.GQ.....................................Y..T.TR........I.R..G.K......HT....S.YTF.........................................................................FSYT.S..GKIH.HVKIG....P.......L..EPET.TYY.......Y..RC...............GAS...D-.................................---.PE..FSFKT...........................................
A0A152A5S8_9MYCE/29-129                ....................................................PQTIKLSL.....TS.-...V....AS..................EM..QISWF..T...V...............................N..................P.........I..GES.......................FVQFS.QY.....Q.GA.....................................L..E.KKats.giyiA.N..G.T......TT....Q.YDS.........................................................................QSQW.I..GYTH.IVVLS....N.......L..SPNT.VYY.......Y..QC...............GGS..vSK.................................VLS.VT..NQFTT...........................................
D8RMJ0_SELML/62-153                    ....................................................PEQVHLTQ.....GD.Y...I....GQ..................TT..TVSWV..T...W...............................A..................N.........S..SGN.......................IVQYG.KS.....K.DS.....................................Y..T.SS........V.Q..S.D......VT....T.YTY.........................................................................GDYT.S..GFIH.HAKLE....G.......L..DYGT.TYF.......Y..KV...............GDG...S-.................................-SS.RE..FSFTT...........................................
U4U327_DENPD/26-117                    ....................................................PQQVHIAF.....GD.-...N....IH..................QI..VVTWS..T...Y...............................N..................P.........T..DDS.......................IVEYG.IG.....G.--.....................................L..I.NT........A.T..G.Q......SR....L.FVDg.......................................................................gPEKH.S..QYIH.RVVLS....D.......L..APDS.RYE.......Y..HC...............GGS...D-.................................GWS.DL..FWFKT...........................................
A0A0G1BZF4_9BACT/1790-1877             ................................................ltdv------KV.....SS.I...T....QT..................EA..IISWK..A...N...............................E..................A.........-..SDG.......................VVEYG.YA.....Q.GT.....................................Y..D.SS........A.I..D.-......--....-.---.........................................................................VPLI.D..KTDH.RVQLY....D.......L..TPLR.TYY.......Y..RV...............SSE...DGsn.............................nrSAY.SS..GSFTT...........................................
D3B6U1_POLPA/32-129                    ....................................................PSSIKLSL.....TQ.-...K....VS..................EM..RVTWY..T...P...............................S..................K.........G..SSP.......................IVLFG.TS.....P.FV.....................................A..N.NS........I.Y..E.Q......SV....V.ATIed.....................................................................liSVDW.S..GYTN.TALLS....G.......L..LPLT.TYF.......Y..AV...............GEK...NE................................qLFS.DV..YNFTT...........................................
W5F9N2_WHEAT/17-108                    ....................................................PQQVHITL.....GD.Q...T....GT..................AM..TVSWV..T...A...............................S..................E.........L..GNG.......................TVRYG.PS.....P.DK.....................................M..E.MS........A.Q..G.T......HT....R.YDY.........................................................................FNYT.S..GFIH.HCVLR....N.......L..KHGV.KYY.......Y..AM...............GFG...H-.................................-TV.RT..FSFT-a..........................................
A0A0D3HIB4_9ORYZ/171-260               ....................................................PQQVHISM.....VG.-...-....EK..................NM..RISWV..T...D...............................D..................L.........N..APS.......................VVEYG.TS.....P.GK.....................................Y..T.AS........A.T..G.D......HT....T.YRY.........................................................................FLYK.S..GAIH.HATIG....P.......L..EAST.TYH.......Y..RC...............GKA...GD.................................---.--..-----eftlrtpp...................................
A0A151TLN0_CAJCA/54-145                ....................................................PQQVHITQ.....GD.L...V....GR..................AV..IVSWV..T...V...............................D..................E.........P..GSS.......................EVRYW.RE.....N.SH.....................................R..K.KI........A.E..G.K......VV....T.YRY.........................................................................FNYS.S..GFIH.HTTIS....H.......L..EYNS.KYY.......Y..EV...............GLT...N-.................................-TT.RQ..FWFM-t..........................................
A0A0L9ULM6_PHAAN/50-142                ....................................................PQQVHITI.....GD.H...V....GR..................AM..IVSWV..T...M...............................D..................E.........P..GNS.......................LVRYW.SE.....D.SP....................................hK..K.EL........A.K..G.H......HV....T.YRF.........................................................................FNYS.S..GFIH.HCTLR....E.......L..EFNK.KYY.......Y..EI...............GMG...H-.................................---.--..-----tirqfwfmt..................................
D7KQJ7_ARALL/142-250                   ................................................plyp----RLAL.....GK.-...E....WD..................EI..TVTWT..S...G...............................Yg................lD.........I..AEP.......................VVEWG.IM.....E.GE.....................................R..K.FS........P.A..G.T......LT....F.GRNsmcgd...............................................................partvGWCD.P..GYIH.TAFLK....E.......L..WPNS.KYT.......Y..RV...............GHKl.fSGa...............................hIWS.KE..NQFK-s..........................................
A0A102CYR5_9BACT/32-121                ................................................vapy-----LQF.....GT.-...-....QT..................SM..VILWE..T...E...............................E..................P.........-..ATT.......................RVEYG.ES.....R.YG.....................................D..E.AP........N.L..-.-......SQ....T.A--.........................................................................TIDG.T..RTMH.EVVLT....G.......L..KPET.KYF.......W..RV...............VSVl.pDGr...............................eLAS.EP..STFRT...........................................
C5XLM4_SORBI/68-159                    ....................................................PEQVHITQ.....GN.H...D....GT..................AM..IISWV..T...T...............................S..................E.........P..GSS.......................TVIYG.TS.....E.DN.....................................L..N.YT........A.N..G.K......HT....Q.YTF.........................................................................YNYT.S..GYIH.HCTIK....K.......L..EFDT.KYY.......Y..AV...............GIG...Q-.................................-T-.--..-----vrkfwfmt...................................
A0A067GDK8_CITSI/59-150                ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...P...............................H..................E.........P..GPS.......................TVSYG.TS.....A.DK.....................................F..D.FT........A.E..G.T......VN....N.YTF.........................................................................YKYK.S..GYIH.QCLVD....G.......L..EYDT.KYY.......Y..KI...............GSG...D-.................................-SS.RE..FWFQT...........................................
D0N2Z3_PHYIT/189-293                   ....................................................PKHGHIAL.....TE.-...N....VD..................EM..SVMFN..S...A...............................S..................R.........-..NTP.......................VVKYG.LD.....P.AA.....................................L..N.KH........A.E..G.K......SK....T.YTAahmchrp...........................................................anltsqqWFRD.P..GNMH.TVILK....G.......L..KLGT.RYF.......Y..KF...............GSD...KD.................................GWS.SV..YS---lm.........................................
B4EKR2_BURCJ/53-150                    ....................................................PEQVHLTW.....GN.D...P....TS..................EV..VISWA..S...L...............................A..................P.........A..VNP.......................RARIV.AD.....G.EP.....................................-..A.RT........V.H..G.V......QR....L.YTD........................................................................gLNGE.T..VFAY.HARVH....G.......L..KPDT.RYR.......Y..EI...............TAD...NDgn............................aaqPFS.A-..-----hfsta......................................
A0A103DWK7_9BURK/36-132                ....................................................PEQIHLTW.....GN.G...D....AS..................EV..IVSWA..T...L...............................A..................A.........A..VNP.......................RVRFM.GP.....-.DS.....................................A..W.RT........A.H..G.V......QR....T.YTD........................................................................gLNGE.V..VFTY.HARLH....G.......L..KPGA.VYR.......Y..EV...............TAD...ND.................................---.--..-----gnaaqpfaarfrt..............................
A0A0A2VQD4_BEABA/34-123                ....................................................PMQVRIAV.....SG.-...-....AN..................SI..SVGWN..T...Y...............................Q..................Q.........L..GSP.......................CVSYG.AS.....A.DS.....................................L..T.QK........S.C..S.S......--....K.SDT.........................................................................YPSS.R..TWFH.TVYLN....N.......L..TPAT.KYF.......Y..KI...............EST...NS.................................TVE.EF..-----lsprt......................................
C5LTK3_PERM5/11-144                    ..............................................pdkvtd-----LTD.....TG.S...T....SN..................SV..ALNWT..A...P...............................A..................D.........N..GAM.......................ILRYI.IS.....E.GD.....................................N..T.YT........V.D..G.H......DT....S.YTTpfsdgvsvswskannpqcd...................................lpvtayrvidddgnelcqvAAND.D..DGAL.WCDVT....G.......L..QPST.SYN.......I..RV...............QAK...NSa...............................aGWS.TK..-----sssp.......................................
I1PI45_ORYGL/166-274                   ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Df.......kE..AVP.......................FVEWG.AK.....G.GQ.....................................R..V.LS........P.A..G.T......L-....T.FDRnsmcg..............................................................apartvGWRH.P..GYIH.TSYLK....E.......L..WPDS.LYT.......Y..RL...............GHRl.pNGt...............................nIWS.KS..YSFK-a..........................................
L8GNJ7_ACACA/1-75                      ....................................................--------.....--.-...-....--..................-M..NVGWY..T...Q...............................D..................R.........T..ATS.......................TVQFG.TK.....P.PF.....................................T..G.N-........A.T..G.V......A-....-.-NE.........................................................................WFSG.Y..GFNH.FAVLR....D.......L..LPGT.RYY.......Y..RC...............GDA...SG.................................GWS.AV..YSFVT...........................................
R5R2S1_9FIRM/239-333                   .................................................qka---LNLTI.....GE.-...D....ET..................KM..NLTWY..A...N...............................T..................N.........-..TSG.......................TVQLA.KA.....G.AM.....................................I..N.GE........F.P..S.Q......FT....T.VEAtn.....................................................................nqANDK.G..FYYN.QATLA....N.......L..EENT.KYV.......Y..RV...............VNG...D-.................................QVS.KI..YDFTT...........................................
L1QCP3_9CLOT/62-149                    ....................................................PKQVNVHM.....GE.N...P....ST..................EV..NFTYT..T...I...............................N..................S.........D..LET.......................KVVLN.KV.....G.DS.....................................E..K.IT........V.L..G.E......NS....-.---.........................................................................IGNA.D..KYFH.KISVN....N.......L..EPNT.QYE.......Y..TV...............GTG...ES.................................TFS.GK..-----fkt........................................
D7T9W8_VITVI/229-337                   ...............................................pvypr-----LAQ.....GK.-...V....WN..................EM..TVTWT..S...G...............................Y..................Gi.......nD..AAP.......................FIEWG.LK.....G.GD.....................................K..V.RS........P.A..G.T......L-....T.FDRrsmcg..............................................................apastvGWRD.P..GYIH.TSFLK....E.......L..WPNL.VYS.......Y..KL...............GHRl.fNGt...............................yIWS.QQ..YQFR-a..........................................
A0A117RZF8_9ACTN/90-195                ....................................................PFGRHLAF.....GA.D...P....KT..................QM..RISWQ..V...P...............................V..................A.........V..RRP.......................YVRIG.LR.....P.DD.....................................L..G.RK........I.E..A.E......VR....D.LHTpel...................................................................kgiRAAL.E..QYYL.HAALD....T.......L..RPGT.TYY.......Y..GV...............GHE...GFdpa...........................speHRA.TI..HSFRT...........................................
A0A078FT75_BRANA/145-248               ....................................................PEQIHLAF.....ED.-...K....VN..................RM..QVTFV..A...G...............................D..................G.........-..EER.......................FVRYG.EG.....K.DA.....................................L..A.NS........A.A..A.R......GI....R.YERehmcna.............................................................panstiGWRD.P..GWIF.HTVMK....N.......L..NGGV.RYF.......Y..QV...............GSD...SK.................................GWS.EI..HSF--ia.........................................
A0A0D3H8N6_9ORYZ/157-265               ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Di.......kE..AYP.......................FVEWG.MK.....W.SP.....................................P..T.RT........A.A..G.T......IT....-.FDReslcg..............................................................epartvGWRD.P..GFIH.TAFLT....D.......L..WPNK.EYY.......Y..KI...............GHMl.pDGk...............................iVWG.KF..YSFK-a..........................................
A0A0L0QLN7_VIRPA/700-799               ....................................................PEKVTLTW.....TK.D...P....KT..................TQ..HVTWR..T...N...............................T..................T.........A..VNP.......................VLEVV.AK.....G.DKagfd.............................sehvL..-.-R........F.K..A.D......TK....L.VS-.........................................................................DETG.E..FLQH.NVEAT....K.......L..TPST.TYQ.......Y..RV...............GDG...TE................................eVWS.EV..STFTT...........................................
A0A0G1C6K6_9BACT/34-119                ...............................................isdis-------V.....ST.-...S....GD..................SA..TITWT..T...D...............................V..................P.........-..AES.......................DVDWG.TN.....P.DD.....................................N..D.FT........T.G..N.D......HT....-.---.........................................................................----.F..VTSH.SVTIS....S.......L..LPST.VYY.......I..KI...............FNR...NEag.............................yeTIS.DI..QSFT-s..........................................
A0A074L068_9BACT/44-144                ....................................................PDRILLTI.....SS.A...D....AK..................QT..TVTWR..V...G...............................S..................Psd.....kgS..NKG.......................LLEIS.PK.....G.KTvt................................fykN..P.VR........L.Q..A.I......SS....D.FTT.........................................................................FMKE.R..VIYH.KVILK....D.......L..IEDQ.PYV.......Y..RV...............GNG...K-.................................IWS.EW..FD---la.........................................
A0A0G1BZF4_9BACT/1655-1745             ...........................................pptitvatt------TL.....V-.-...S....DT..................KA..LITWT..T...D...............................E..................G.........-..SSS.......................QVFYG.TA.....A.DS.....................................L..D.NE........T.T..V.D......--....-.---.........................................................................--TA.S..NRSH.RVIIS....G.......L..SAST.RYY.......Y..IV...............QSA...DAng............................ntaTST.SA..SSFTT...........................................
A0A0G0RIB3_9BACT/43-129                ....................................................PKNVRVSN.....LS.-...-....DS..................SA..TVSWI..T...E...............................D..................Q.........-..TTD.......................FISYG.TS.....P.NT.....................................S..T.IV........N.E..S.E......--....-.---.........................................................................-GNQ.K..FFTH.SITIT....G.......L..NPET.NYY.......F..EI...............NSN...GT.................................---.--..-----ahdnngipwqfst..............................
T0S7S1_9STRA/25-119                    ....................................................PSQVHLAI.....AG.D...D....FS..................GM..AFSWV..T...P...............................T..................A.........-..SAS.......................SVKYG.RD.....A.AA.....................................L..D.GR........A.T..A.Tt....pSA....Q.YTF.........................................................................CNYT.S..GYLH.HVVVP....T.......L..SPRS.TYF.......Y..VV...............GSD...ES.................................GWS.VP..TAFKT...........................................
A0A0B4HKR0_9HYPO/69-171                ..............................................nnvnvi----SLSY.....AG.-...-....-N..................GV..NIHYQ..T...P...............................F..................G........lG..ASP.......................SVAWG.TS.....A.GS.....................................L..T.SI........A.T..G.S......SR....S.YDRtppc.................................................................srvaVTQC.S..QFYH.DVQIR....D.......L..SPDT.TYY.......Y..KI...............PAA...NG................................tTAS.EV..LSFKT...........................................
A0A0L9V8E0_PHAAN/54-146                ....................................................PQQVHITQ.....GD.Y...V....GR..................GM..IVSWV..T...M...............................D..................E.........P..GSS.......................AVRYW.SE.....N.SG.....................................K..K.MI........A.E..G.K......IV....T.YRF........................................................................lNNYS.S..GFIH.HTTIR....H.......L..EYNT.KYY.......Y..EV...............GLG...N-.................................-TT.RQ..FWFVT...........................................
A0A0U1LZV7_9EURO/330-416               ....................................................PYQQRLAV.....TG.-...-....PK..................TV..SVGWN..T...Y...............................Q..................K.........L..NQS.......................CVQYG.TS.....A.DN.....................................L..E.SK........A.C..S.T......IS....T.T--.........................................................................YNTS.R..TYSN.AVNLT....D.......L..TPAT.TYY.......Y..KI...............VSG...N-.................................--S.TV..GHF--ls.........................................
Q2TY95_ASPOR/68-171                    .........................................nnvnvislsyi--------.....--.-...-....PD..................GI..HIHYQ..T...P...............................F..................G........lG..QSP.......................AVKWG.TS.....P.YH.....................................L..V.NV........A.R..G.F......SH....T.YDRtpsc................................................................sqmkaVTQC.S..QFFH.EVSLP....H.......L..ESGK.TYY.......Y..QI...............PAA...NG................................tTES.EV..LSFTT...........................................
A0A061EAS8_THECC/171-279               ...............................................pvypr-----LAQ.....GK.-...V....WN..................EM..TVTWT..S...G...............................Y..................Gi.......gE..AVP.......................FVEWS.WK.....G.GL.....................................P..I.HS........P.A..G.T......L-....T.FDSnsmcg..............................................................epamtvGWRD.P..GFIH.TSFLK....E.......L..WPNT.LYT.......Y..RL...............GHV..lSDg..............................tyVWS.QQ..YSFK-a..........................................
A0A023BX03_9FLAO/21-112                .................................................gky----RLTL.....RD.N...P....AT..................SI..VIGWD..Q...T...............................S..................G.........-..NNP.......................VVYYG.TT.....D.YG.....................................T..N.YS........S.Y..P.N......SK....T.PDR........................................................................tVSYK.G..MNNN.FARLT....G.......L..SPNT.AYY.......F..VI...............KDS...Q-.................................GTS.ER..FWFKT...........................................
M0YS06_HORVD/47-135                    ....................................................PQQVHLSV.....VG.-...-....AN..................HM..RVSWV..T...D...............................A..................K.........H..GHS.......................VVEYG.RA.....S.GN.....................................Y..T.SS........A.T..G.E......HS....S.YRY.........................................................................YLYS.S..GKIH.HVTIG....P.......L..DPDT.VYY.......Y..RC...............GMV...G-.................................---.--..-----deftlktp...................................
M7Z1C7_TRIUA/53-140                    ....................................................PQQVHVSA.....VG.-...-....PD..................KM..RVTWI..T...D...............................D..................D.........-..APA.......................TVDYG.TA.....S.GQ.....................................Y..P.FS........A.T..G.T......TA....G.YSY.........................................................................LLYH.S..GNIH.DAVVG....P.......L..KPST.TYY.......Y..RC...............SSD...T-.................................--S.RE..FSFRT...........................................
G0LAW7_ZOBGA/29-113                    ...............................................vspyl--------.....QD.A...T....PN..................SI..KIMWQ..T...S...............................S..................G.........-..EES.......................IVEWG.TT.....Q.-K.....................................L..G.KK........T.K..G.K......AF....D.---.........................................................................VNFT.D..SRIH.EVQLE....N.......L..KRFT.TYF.......Y..RV...............RTG...K-.................................TVS.DI..FQFKT...........................................
A0A059CXQ5_EUCGR/63-154                ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IVSWV..T...T...............................D..................T.........P..VLS.......................VVHFG.TS.....P.GR.....................................Y..T.LS........A.K..G.T......AT....N.YTF.........................................................................HNYK.S..GYVH.HCLLE....G.......L..KYDT.KYY.......Y..KI...............GEG...D-.................................-SS.RE..FSFQT...........................................
W5G2V5_WHEAT/174-282                   ................................................pvyp----RLAQ.....GK.-...S....WD..................EM..TITWT..S...G...............................Y..................Ni.......kE..AVP.......................FVEWG.AK.....G.GP.....................................R..F.LS........P.A..G.T......LS....-.FNRnsmcg..............................................................apartvGWRH.P..GYIH.TSFLK....D.......L..WPDS.KYT.......Y..RL...............GHRl.pNGt...............................qVWS.KI..YSFK-a..........................................
W7YV21_9BACL/102-198                   ...................................................i-TKVTVTF.....NG.D...T....KT..................AK..GFTWY..T...S...............................L..................E.........S..EKS.......................DVQVV.EQ.....K.GSpd.................................ftN..A.QR........F.E..G.R......SS....V.A--.........................................................................KNSN.K..ERLH.KAEAT....G.......L..APDT.SYY.......F..RV...............GDA...DL................................nIWS.EV..GTFRT...........................................
M0T9R0_MUSAM/43-130                    ....................................................PQQVHISL.....VG.-...-....SN..................KM..RVTWI..T...K...............................N..................D.........-..GES.......................VVNYG.TI.....A.GK.....................................Y..T.DS........S.V..G.S......AS....S.YTY.........................................................................FLYR.S..GHIH.DVVIG....P.......L..KPDT.VYY.......Y..RC...............GSN...S-.................................--T.RE..FSFKT...........................................
A0A133ZMJ6_9CORY/34-120                ................................................frtl-----LQP.....GA.-...D....ET..................QA..IVSWR..T...N...............................A..................H.........G..AAE.......................KLEVT.GP.....D.GT.....................................Q..T.FD........A.Q..E.K......NA....-.---.........................................................................-GAL.L..YKSN.YATAT....G.......L..KENT.TYS.......Y..RV...............GSD...EG.................................GWS.EP..QDYTT...........................................
B8AAW1_ORYSI/206-309                   ....................................................PLHGHLSS.....VD.S...K....AT..................SM..RLTWV..S...G...............................D..................A.........-..RPQ.......................QVQYG.TG.....K.TA.....................................T..S.VA........T.T..F.T......HK....D.MCSiavlp..............................................................spakdfGWHD.P..GYIH.SALMT....G.......L..QPSH.SYN.......Y..RY...............GSD...SV.................................GWS.NT..TEFRT...........................................
M4ELF6_BRARP/71-183                    ....................................................PEQISLSL.....SS.-...D....YD..................SV..WVSWI..T...G...............................Efqigkn......vkpldpT.........S..IDS.......................IVRFG.TL.....R.HS.....................................L..S.HE........A.K..G.T......SL....V.YSQlyp..................................................................fdglLNYT.S..GIIH.HVRIT....G.......L..KPST.VYY.......Y..RC...............GDP...SR................................hAMS.KI..HHFRT...........................................
A0A0D9V6F3_9ORYZ/55-146                ....................................................PQQVHITQ.....GD.H...D....GT..................AM..IISWV..T...P...............................I..................E.........P..GSS.......................TVHYG.TS.....E.DN.....................................L..N.FS........A.D..G.K......HT....Q.YTF.........................................................................YNYT.S..GYIH.HCTLK....K.......L..KFDT.KYY.......Y..AV...............GIG...Q-.................................-TV.RK..FWFRT...........................................
A0A0D1JZU6_9MYCO/53-146                ..................................................vm--GLHTQF.....GA.D...A....AT..................EA..VVSWH..T...A...............................A..................A.........V..KNP.......................RITVG.TP.....D.GG.....................................F..G.NA........V.A..A.E......TV....T.YRD........................................................................aASRT.E..IRVH.HARLT....G.......L..APDT.DYV.......Y..AA...............VHD...G-.................................-AS.P-..-----elgtvrt....................................
B4JMN4_DROGR/15-112                    ....................................................PEQVHLSF.....GE.R...T....AS..................EI..VVTWS..TrglP...............................P..................T.........S..ADS.......................VVEYG.LS.....E.DL.....................................T..Q.RA........T.G..Q.Q......AI....K.FVDg.......................................................................gRKQM.T..QYIH.RVTLR....E.......L..KANS.SYI.......Y..HC...............GSE...L-.................................GWS.AK..YEFRT...........................................
A0A0G0GKE2_9BACT/48-141                ...............................................nirri------EV.....TN.L...S....PI..................QV..TIYWQ..G...Q...............................D..................K.........-..EMG.......................WIVYG.EK.....S.DA.....................................L..V.NI........A.L..D.N......RD....V.-N-.........................................................................EKKS.P..YLNH.YVTLR....N.......L..KPGV.HYY.......Y..AV...............ISQ...NQki.............................vrP--.--..-----dgsffeftt..................................
K3YLE6_SETIT/158-269                   ............................................pvfprlah--------.....GK.-...I....HD..................EI..AVTWT..S...G...............................Y..................Di.......aP..TYP.......................FVERG.AV.....G.CG.....................................T..Q.PS........L.A..A.A......RG....T.LTFnrgsmc............................................................gepartvGWRD.P..GFIH.TAFMK....G.......L..WPNK.EYY.......Y..KI...............GHE..lQDg..............................svVWG.KP..YTFR-a..........................................
R5BD39_9FIRM/59-157                    ..............................................vrqlit--------.....-P.D...M....TH..................SR..IIMWE..T...H...............................A..................P.........E..ADP.......................VVLYK.IAg...aS.DS.....................................T..I.ET........V.P..A.T......ME....R.FE-.........................................................................EDKT.V..RYIY.RAELT....G.......L..TPNS.TYE.......Y..QV...............GKNv.iTK.................................GW-.--..-----htlhtmdessfta..............................
A0A016V969_9BILA/12-97                 ....................................................PEQVHLAF.....HG.-...D....YS..................VM..AVVWT..T...F...............................Q..................Y.........-..DKA.......................EVAFG.ED.....P.NN.....................................L..N.RT........A.S..D.E......GV....K.KWA.........................................................................SGAS.V..RYSH.RAMMR....D.......L..KPST.EYY.......Y..QI...............GVR...R-.................................---.--..-----fsfkt......................................
M5VQF9_PRUPE/19-110                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...P...............................D..................E.........P..GTS.......................KVQYG.TS.....E.NG.....................................Y..E.LS........A.E..G.I......VT....N.YTF.........................................................................YKYK.S..GYIH.HCLVD....G.......L..EHDT.KYY.......Y..KI...............GSG...D-.................................-SS.RE..FWFTT...........................................
D8SLM4_SELML/62-153                    ....................................................PEQVHLTQ.....GD.Y...I....GQ..................TT..TVSWV..T...W...............................A..................S.........S..SGN.......................IVQYG.KS.....K.DS.....................................Y..T.SS........I.Q..S.D......VT....T.YTY.........................................................................GDYT.S..GFIH.HAKLE....G.......L..DYGT.TYF.......Y..KV...............GDG...S-.................................-SS.RE..FSFTT...........................................
A0A0G0I9G2_9BACT/120-217               ............................................ptisaets--------.....TS.A...S....SS..................SV..IITWL..T...D...............................D..................P.........-..STS.......................RVIYD.TV.....S.HA.....................................D..V.ST........A.P..N.Yg...ytNS....T.IET.........................................................................DSLA.M..VTSH.SVVLS....G.......L..TAET.TYY.......Y..RT...............VSH...GSp...............................eAVS.GE..KSFVT...........................................
R5AWN8_9BACE/257-354                   ................................................epyl--------.....QN.P...S....AN..................AI..SVMWQ..T...N...............................V..................P.........-..TQN.......................WIDFG.TD.....T.LN.....................................T..K.RA........R.T..L.I......H-....-.--G.........................................................................QELC.N..NKMH.KIRLD....S.......L..TPGK.KYY.......Y..RV...............NSR...EIlkyqgy....................ykafghtYTS.PW..YEFT-l..........................................
A0A176VHJ1_MARPO/220-329               .........................................psfmrlangfe--------.....--.-...-....WN..................EI..TVTWT..S...Dy.............................gQ..................D.........E..AMP.......................LVKWG.LL.....D.DK.....................................E..R.TL........T.A..A.M......TV....T.FSRddmcg..............................................................apattvGWRS.P..GYIH.TGHLK....E.......L..WPNK.KYF.......Y..QV...............AHK..lENgs............................yvwGRS.SV..-----fks........................................
A0A0K9RCQ9_SPIOL/218-326               ................................................plyp----RLAM.....GE.-...T....WD..................VM..TVTWT..S...G...............................Y..................Ni.......gE..SVP.......................FVEWG.AV.....D.GA.....................................T..I.-Q........S.P..A.A......TF....T.YTRnqmca..............................................................spartvGWRD.P..GFIH.TSYMK....E.......L..WPNT.MYS.......Y..RL...............GHKl.pNGs...............................yVWS.KK..YKFK-s..........................................
A0A0K1PZR4_9DELT/1144-1237             ..................................................pr--YLYLTP.....GQ.-...D....TR..................SV..NVTWY..T...S...............................T..................D.........V..TGS.......................QVRFG.TG.....S.LD.....................................Q..T.RE........G.T..S.T......IL....P.FFY........................................................................gTEAG.V..VRVH.HVTLD....N.......L..APGT.QYR.......Y..QV...............GDG...AA.................................NVA.TE..RRFTT...........................................
A0A098F3A5_9BACI/985-1090              ...............................................iknil-----SNP.....AG.D...P....YK..................MK..SFTWM..S...S...............................P..................L........tD..GKA.......................MVKYA.RK.....Q.DYerk...............................gedA..F.NS........A.T..G.T......SS....-.--Nqvfs................................................................geldiAKNG.I..VRVN.EVRLS....K.......L..QQGT.KYV.......Y..QV...............GDG...Q-.................................NWS.PI..EEFTT...........................................
A0A168C8H4_CORDF/26-115                ..................................................ag--QIRLAY.....HG.-...-....DD..................GM..VVSWN..T...F...............................E..................H.........V..AGP.......................EVKWG.LS.....K.DN.....................................L..N.NT........A.S..S.D......TS....I.--T.........................................................................YPTS.S..TYNN.HVLVA....G.......L..APGT.TYY.......Y..L-...............---...--.................................---.--..-----psplpqgnhepftftt...........................
B8MJR7_TALSN/36-123                    ..................................................pf--QQRLAA.....YG.-...-....PS..................SV..SVGWN..T...Y...............................A..................A.........Q..SSG.......................CVQYG.TS.....P.DN.....................................L..N.LK........S.C..S.T......IG....S.TT-.........................................................................YQSS.R..TYSN.VVILS....G.......L..APAT.TYY.......Y..KI...............VST...N-.................................--S.TV..GHFQ-s..........................................
A0A0W7VZQ8_9HYPO/34-120                ...................................................p-VQQRIAV.....NG.-...-....PN..................SV..SIGWN..T...Y...............................Q..................Q.........L..SQP.......................CVAYG.SS.....A.TS.....................................L..T.QQ........A.C..S.K......NS....V.T--.........................................................................YPTS.R..TWSN.SVTLN....N.......L..SPAT.TYY.......Y..KI...............VST...N-.................................--S.SV..DHF--ls.........................................
B2FLX5_STRMK/45-140                    ....................................................PDRIVASP.....AG.D...P....GH..................GF..AVAWR..T...D...............................G..................S.........M..QAP.......................LLEIA.LA.....G.DSpa.................................ieG..I.RQ........V.R..A.T......TR....A.LQ-.........................................................................TENG.L..SHHH.RADVS....G.......L..RPDT.LYV.......Y..RV...............QGN...G-.................................SWS.AW..NQLRT...........................................
A0A0J8BGM4_BETVU/219-321               ................................................pvyg----HISS.....VD.S...E....AT..................SM..RVTWV..S...G...............................S..................N.........-..ETQ.......................QVEYG.NG.....K.SV.....................................T..S.AA........A.T..F.T......QK....D.MCGglvks...............................................................paedfGWHD.P..GYIH.TAVIT....D.......L..RPSE.KFS.......Y..KY...............GSG...AV.................................GWS.DD..IEFRT...........................................
G2P277_STRVO/82-187                    ....................................................PFGRHLAF.....GA.D...P....RT..................QM..RISWQ..V...P...............................F..................A.........V..RKP.......................YVRIG.TS.....P.LE.....................................L..T.RK........V.E..A.E......VR....S.LHTpsl...................................................................sdkLPAV.E..QFYL.HAAVD....D.......L..RPGT.TYY.......Y..GV...............GHA...DRdpa...........................eprHFS.SV..GTFRT...........................................
U5FFI0_POPTR/63-154                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...P...............................D..................E.........P..GSI.......................SVKYG.TS.....E.NS.....................................Y..D.FS........A.E..G.T......VT....N.YTF.........................................................................YKYK.S..GYIH.HCLVD....G.......L..EYDS.KYY.......Y..KI...............GEG...D-.................................-SS.RV..FWFQT...........................................
A0A0G1AUX7_9BACT/1235-1330             ...............................................viaae-------Q.....AS.T...E....QT..................ST..VITWT..T...D...............................F..................P.........-..GTS.......................RVVYD.TV.....S.HP.....................................V..L.GS........A.P..N.Yg...yaNS....T.ATF.........................................................................DESP.K..VQNH.SVTIS....G.......L..TPGT.TYY.......Y..RV...............VSA...ASp...............................eSVS.GE..GSVTT...........................................
M0W2V5_HORVD/98-206                    ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Di.......kE..AVP.......................FVEWG.EK.....G.GR.....................................R..F.LS........P.A..-.G......TL....T.FDRnsmcg..............................................................apartvGWRH.P..GYIH.TSYLK....D.......L..WPDS.MYT.......Y..RL...............GHRl.pNGt...............................rIWS.KS..YSFK-a..........................................
D7LUA9_ARALL/44-133                    ....................................................PDQVHISL.....VG.-...-....PD..................KM..RISWI..T...Q...............................G..................S.........-..IMP.......................SVVYG.TV.....S.GK.....................................Y..E.GS........A.N..G.T......SS....T.YHY........................................................................lLIYR.S..GQIN.DVVIG....P.......L..KPNT.VYY.......Y..KC...............GGP...N-.................................-ST.QE..FSFRT...........................................
A0A0K9XCF4_9ACTN/82-187                ....................................................PYGRHLAF.....GA.D...P....KT..................QM..RISWQ..V...P...............................L..................A.........V..RKP.......................FVRVG.LH.....P.WD.....................................L..G.RR........I.E..A.E......VR....H.LHTpal...................................................................prkLPAV.D..QYYL.HAALD....N.......L..RPGT.TYY.......Y..GV...............GHT...GFdpa...........................darNLA.AT..GTFRT...........................................
G4YIT8_PHYSP/197-303                   ....................................................PKHVHTAY.....GL.-...K....PG..................RL..AVQWM..T...K...............................E..................Fc.......gE..GDA.......................QLQLV.EG.....Y.HArieve..........................gpnmtpV..T.AW........A.N..T.T......LF....E.DDG.........................................................................QKQS.K..RWLH.VVRLE....G.......L..KPDT.RYT.......Y..VV...............GNA...HY................................aSWS.IP..YVTKT...........................................
C7PUL7_CHIPD/51-147                    ....................................................PDRIILTV.....TQ.D...P....AT..................SV..TVNWR..S...A...............................A..................G.........I..TTA.......................YIEYT.TA.....D.AH.....................................P..E.FA........A.N..V.K......RL....T.ASSea.....................................................................frLEAL.D..VVYH.RITLT....G.......L..QAAT.LYT.......Y..RV...............GSD...N-.................................GWS.EW..LQFKT...........................................
I0GVQ5_SELRL/57-146                    ...............................................flrqm-------I.....TT.D...A....AT..................SR..VLMWQ..A...A...............................S..................R.........L..SQP.......................QVEYR.LS.....G.QH.....................................D..S.LT........I.D..A.Q......ED....F.FT-.........................................................................DDGV.E..NLQY.LARLD....N.......L..TPET.DYE.......Y..RL...............VSE...G-.................................HAS.DW..HSLKT...........................................
A0A059A641_EUCGR/185-293               ................................................plyp----RLSQ.....GK.-...S....WD..................EM..TVTWT..S...G...............................Y..................Ni.......dE..VTP.......................FVEWG.VK.....G.ET.....................................Q..T.RS........P.A..G.T......LT....-.FQQnsmcg..............................................................ppartvGWRD.P..GFIH.TSFLK....D.......L..WPNA.EYT.......Y..RL...............GQRl.aNNs...............................yVWS.KA..YSFK-s..........................................
A0A0M9ZMJ3_9ACTN/74-179                ....................................................PFGRHLAF.....GA.D...P....RT..................QM..RISWQ..V...P...............................A..................A.........V..RRP.......................YVRVG.VR.....P.DD.....................................L..G.HR........T.D..A.E......TR....D.LHTpel...................................................................pgvRAAV.E..QYYL.HAALD....G.......L..LPGT.TYY.......Y..GV...............GHE...GFdpa...........................sprHRS.AI..GSFRT...........................................
A0A132AKY9_SARSC/9-99                  ..............................................gtntsl------HW.....RY.P...H....LN..................ER..VVTWT..T...F...............................N..................S.........T..PQS.......................KVHFG.RM.....L.SD.....................................H..H.DT........P.H..I.A......IG....S.YEIft....................................................................dggNEKR.S..MFIH.RVYLR....E.......L..EPDT.LYW.......Y..RC...............GSS...K-.................................GWS.--..-----...........................................
A0A0D2TSP5_GOSRA/4-94                  ...................................................l--KVHITQ.....GD.H...L....GN..................AV..IVSWV..T...P...............................D..................E.........P..GSN.......................SVFYW.AE.....N.SE.....................................L..K.NS........A.Q..G.I......VL....T.YKY.........................................................................FNYT.S..GFIH.HCTVR....D.......L..EFDT.KYY.......Y..EV...............GIG...N-.................................-SS.RR..FWFVT...........................................
V4S1N1_9ROSI/86-198                    ....................................................PEQISVSL.....SS.-...T....HD..................SV..WISWI..T...G...............................Efqignn......lkpldpK.........S..VAS.......................VVRYG.TL.....R.SQ.....................................L..N.RR........A.T..G.H......SL....V.YNQlyp..................................................................flglQNYT.S..GIIH.HVRLT....G.......L..KPDT.LYH.......Y..QC...............GDP...SI................................pAMS.GA..YCFRT...........................................
A0A0B5EVH6_STRA4/81-186                ....................................................PFGRHLAF.....GA.D...P....RT..................QM..RVSWQ..V...P...............................L..................P.........V..RAP.......................FLRIG.LK.....P.WE.....................................L..S.RK........I.P..A.E......VR....A.LHTpal...................................................................sakLPAV.E..QLYL.HAALD....G.......L..RPGT.TYY.......Y..GV...............GHE...GFdpa...........................apeRLA.TL..GSFR-t..........................................
A0A0A1T6V4_9HYPO/73-174                .................................................inv---ISIAY.....AG.-...-....AD..................GV..NIHYQ..T...P...............................F..................G........lT..EEP.......................TVQWG.SD.....S.AK.....................................L..D.KK........A.T..G.A......SH....S.YDRtppc.................................................................seapVTQC.S..QHFH.EVQIR....G.......L..KQDT.TYY.......Y..KI...............QAS...NG................................tTAS.DV..LKFTT...........................................
J9R0E5_RIEAN/53-180                    ....................................................PFSINMVL.....NG.E...P....KT..................RL..GFCWF..T...N...............................Di................vE.........N..ENS.......................VVQIV.AK.....S.NA.....................................K..E.DD........F.V..N.A......IE....-.FSAlgekislnylnankntm.......................................vldylnfafpkyidiqnPATR.E..YISH.KAVAE....N.......L..TPDT.EYS.......F..RV...............GKP...G-.................................AWS.SI..GSFRT...........................................
R0FVU9_9BRAS/54-145                    ....................................................PQQVHITQ.....GN.H...E....GN..................GV..IVSWV..T...P...............................V..................K.........P..GSN.......................TVRYW.CE.....N.EK.....................................S..K.KQ........A.E..A.T......VN....T.YRF.........................................................................FNYT.S..GYIH.HCLID....D.......L..EFDT.KYY.......Y..EI...............GSG...K-.................................-WR.RQ..FWFFT...........................................
A0A0F4P0M9_PSEO7/24-112                ................................................dyyr-----LVW.....DT.S...P....ST..................SA..TIGFT..P...T...............................S..................G.........-..TNH.......................IVKYG.ST.....T.DE.....................................Q..S.WQ........S.A..A.V......SA....T.H--.........................................................................TFDG.G..LSSS.FVKLT....G.......L..TPDS.AVY.......Y..RV...............CDS...Q-.................................GCG.QR..LWFRT...........................................
Q82JN5_STRAW/105-210                   ....................................................PFGRHLAF.....GA.D...P....KT..................QM..RISWQ..V...P...............................L..................A.........V..QKP.......................YVRVG.LK.....P.TD.....................................L..S.RR........M.A..A.E......VR....D.LHTpgl...................................................................tgqRFAV.D..QYYL.HAALD....G.......L..RPGT.RYY.......Y..GV...............GHD...GFdpa...........................sreRLS.TV..GSFRT...........................................
A0A078BQP7_CAEEL/1-64                  ...................................................m--------.....--.-...-....--..................--..-----..-...-...............................-..................-.........-..---.......................---YG.LS.....K.DA.....................................L..R.WT........A.K..A.T......TT....S.WKDq.......................................................................gSHGY.V..RYTH.RATMT....K.......M..VPGD.TYY.......Y..KV...............GSS...Q-.................................DMS.DV..YHFH-q..........................................
A0A0L9U563_PHAAN/71-183                ....................................................PEQISLSL.....ST.-...T....HD..................SV..WISWI..T...G...............................Efqigfn......ikpldpK.........T..VAS.......................VVQYG.TS.....R.FD.....................................L..V.HE........A.R..G.E......SL....I.YNQlyp..................................................................fdglRNYT.S..GIIH.HVRLI....G.......L..EPST.LYY.......Y..QC...............GDP...SL................................qAMS.DI..NYFRT...........................................
R7I2U7_9CLOT/1-91                      ....................................................--------.....--.-...-....--..................-M..NFAWY..S...K...............................N..................D.........-..KQA.......................KIRIS.TS.....S.DLtktlekd.......................gantyleD..V.VE........F.E..G.T......AK....E.YKK.........................................................................IDET.T..YFAN.KVTAS....N.......L..KQNT.TYY.......Y..QY...............YLD...G-.................................EWS.EA..SSFTT...........................................
I0YTQ3_COCSC/127-219                   .......................................pndpqhvhlalgv--------.....--.-...-....--..................--..-----..-...-...............................-..................-.........T..EGP.......................AVRWG.GE.....P.GS.....................................L..G.QE........N.R..G.S......FS....T.YTRlqmcg..............................................................apanstGWVD.P..GWLN.YAALT....G.......L..QPGT.RYY.......Y..AV...............GDP...AW.................................GFS.RE..FSFVT...........................................
W2Z5X0_PHYPR/198-304                   ....................................................PKHVHTAY.....GR.-...T....PG..................SL..AVQWM..T...K...............................E..................Fc.......gK..GNA.......................QLQMV.EG.....Y.HArieve..........................gpnatpV..T.AW........A.N..T.T......LF....E.DDG.........................................................................EKQS.K..RWLH.VVRLE....G.......L..KPDT.RYT.......Y..VV...............GNA..yYT.................................SWS.IP..YVTKT...........................................
G7K8G7_MEDTR/49-138                    ....................................................PQQVHISL.....AG.-...-....DR..................HM..RITWI..T...D...............................D..................K.........H..SPS.......................FVEYG.TL.....P.GR.....................................Y..D.SI........S.E..G.E......FT....S.YNY.........................................................................MLYS.S..GKIH.HTVIG....P.......L..EYNT.MYF.......Y..RC...............GGQ...G-.................................---.--..-----pefklktpp..................................
R5CGX0_9FIRM/57-152                    ..................................................yt--KVSMTP.....GA.-...D....ET..................KL..NFAWM..T...K...............................K..................Ds......knA..ATP.......................VVLFG.TG.....K.KN.....................................L..K.-K........F.T..G.T......VE....N.ADSk.......................................................................lTGGV.Q..YVSN.KVTVT....G.......L..KANT.KYY.......Y..TV...............VKN...G-.................................KEA.PV..RSYTT...........................................
A0A0G1YKH6_9BACT/141-227               ...............................................psvfv-----VTS.....GT.-...G....TT..................TA..TITWF..T...T...............................E..................H.........-..ADS.......................QVAYG.TT.....T.SY.....................................G..S.VT........A.L..-.-......--....-.---.........................................................................-NSG.M..TFLH.SVTIT....G.......L..APAT.TYH.......F..QV...............KSR...DAsg.............................nlGTS.AD..GTFTT...........................................
A0A152A8H9_9MYCE/178-298               .................................................vcn---FLLTV.....PE.D...L....ST..................SV..IVNFH..S...N...............................D..................A.........P..DQTnlq................ypisFVLYD.VQ.....S.HSsyfndsls....................lssgnfqnpY..A.YL........S.N..S.T......VF....Q.MSN.........................................................................IKEE.D..RFVH.WADLS....S.......L..VPAT.TYF.......V..VC...............GYQ..fEGk...............................lYFS.SE..KKFRT...........................................
A0A183BKX1_GLOPA/58-150                ....................................................PEQVHLSY.....GG.-...E....TS..................KL..WVTWL..T...F...............................D..................D.........T..LDS.......................VVEWG.EQ.....Y.NQ.....................................L..T.RR........T.S..A.K......ID....Y.FVDg.......................................................................gTEKT.K..RYTH.RALLK....G.......L..KPGQ.RYF.......Y..RV...............GSQ..fG-.................................-WS.SI..FSF--v..........................................
W9ST17_9ROSA/71-183                    ....................................................PEQISVSL.....SA.-...N....YD..................SV..WISWI..T...G...............................Esqigcn......ikplepR.........S..VSS.......................IVRYG.ML.....K.HP.....................................L..M.HE........A.Q..G.Y......SL....V.YNQlyp..................................................................feglQNYT.S..GIIH.HVRLT....G.......L..KPST.RYY.......Y..RC...............GDP...SI................................hAMS.DV..YYLET...........................................
I1LP06_SOYBN/106-208                   ................................................plyg----HLSS.....ID.S...T....GT..................SM..RLTWV..S...G...............................D..................K.........-..EPQ.......................QIQYG.NG.....K.TV.....................................A..S.AV........T.T..F.S......QD....-.--Dmcssal............................................................pspakdfGWHD.P..GYIH.SALMT....G.......L..KPSS.TFS.......Y..RY...............GSG...WV.................................GWS.EQ..IKFST...........................................
W7YV21_9BACL/541-638                   ..................................................is--KVTVTF.....NG.D...T....KT..................AK..GFTWY..T...P...............................L..................A.........S..SGN.......................DLQVI.EK.....T.SS.....................................K..A.DF........N.Q..A.T......HF....S.GRSs......................................................................isTNSK.E..ERLH.KAEAT....G.......L..KPDT.SYY.......F..RV...............GDE...AL................................nSWS.EV..GTFRT...........................................
A0A0R0CMR0_9GAMM/32-127                ....................................................PDRIVASP.....AQ.D...A....AT..................GF..AVAWR..T...S...............................T..................L.........S..APP.......................LLELA.LA.....G.DSpdm...............................grlR..-.-Q........I.T..A.N......SR....-.ILQ.........................................................................SENG.T..SQHH.RADID....G.......L..QPDT.LYA.......Y..RV...............QGQ...G-.................................TWS.AW..NHFRT...........................................
U5FH15_POPTR/63-154                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...P...............................D..................E.........P..GSI.......................SVKYG.TS.....E.NS.....................................Y..D.FS........A.E..G.T......VT....N.YTF.........................................................................YKYK.S..GYIH.HCLVD....G.......L..EYDS.KYY.......Y..KI...............GEG...D-.................................-SS.RV..FWFQT...........................................
R5AJK2_9BACT/506-609                   ..............................................peavtd-----LSM.....AA.-...G....QD..................YI..ALSWT..I...P...............................A..................Ssd.....nvV..NNH.......................IIYYS.TL.....P.FT....................................aS..T.DV........A.T..L.S......SK....T.VDT.........................................................................KFFT.S..GDSY.SCEIT....G.......L..EPMT.TYY.......V..AV...............VAV...NRqg............................qasTMS.EV..KQIKT...........................................
A0A132AKG0_SARSC/1-80                  ....................................................--------.....--.-...-....--..................-M..YVTWI..S...H...............................R..................Rt......pyE..GSA.......................LVRYG.FN.....R.YN.....................................L..S.LI........A.F..G.R......TT....R.F--.........................................................................TTNY.T..RYVH.RVLLI....N.......L..RSNS.HYY.......Y..RC...............GWS...NG.................................LFS.ET..FKFKT...........................................
A0A0N1G342_9ACTN/79-185                ..................................................pf--ARHLQY.....GA.D...P....KT..................QM..RVSWQ..V...P...............................F..................A.........V..KRP.......................YLRVG.TS.....P.WA.....................................L..S.VK........M.D..A.E......VR....H.LSTpvl..................................................................nggkIAAA.E..QFYL.HVGLD....R.......L..RPGQ.TYY.......Y..GV...............GHD...GF.................................---.--..-----dpadhrnlgtlgtftt...........................
A0A0P9ETN2_RHOGW/1-80                  ....................................................--------.....--.-...-....--..................-M..TVSWS..T...F...............................N..................K.........Q..DSP.......................TVLYG.TS.....P.DK.....................................L..D.QS........A.S..S.N......LS....-.-ST.........................................................................YPTS.R..TYNN.HVKLE....G.......L..KPGT.LYY.......Y..KV...............TGT...NGy..............................eaAYL.PT..FKFRT...........................................
A0A0E0RKH4_ORYRU/59-150                ....................................................PQQVHITL.....GD.Q...T....GT..................AM..TVSWV..T...A...............................N..................E.........L..GSN.......................TVRYG.SS.....P.EK.....................................L..D.RA........A.E..G.S......HT....R.YDY.........................................................................FNYT.S..GFIH.HCTLT....G.......L..THAT.KYY.......Y..AM...............GFD...H-.................................-TV.RT..FSFTT...........................................
A0A176W2M9_MARPO/74-166                ....................................................PQQVHIHQ.....GD.F...E....GK..................AI..IISWI..T...P...............................D..................E.........A..GDS.......................KVLYG.KA.....P.GS....................................kY..T.TS........V.T..G.E......AS....T.YSF.........................................................................YTYK.S..GYIH.KAVIS....G.......L..EFRT.RYY.......Y..TL...............GTG...D-.................................-AA.RE..FTFVT...........................................
A0A150MDV3_9BACI/41-137                ..................................................at--DIALGV.....GS.-...D....ET..................EV..NLSWY..T...P...............................E..................T.........S..VPG.......................VIQIA.EK.....S.FM.....................................K..G.SE........F.P..V.D......RA....K.TVKal.....................................................................lsSASP.G..FSSH.KGTVT....G.......L..DSSA.EYV.......Y..RL...............GDG...KG.................................KWT.GP..FTFQT...........................................
K0YR79_9CORY/50-141                    ...................................................v-ENLVLNI.....GS.-...D....ET..................QR..NLAWY..S...E...............................N..................P.........-..DEQ.......................AVQLV.EA.....G.QE.....................................F..G.EA........A.V..T.V......PA....E.VQG.........................................................................ETTS.G..EYNH.FATLT....G.......L..KPNT.AYN.......Y..RV...............GSE...ES.................................GWT.EP..IPFHT...........................................
A0A0G0IC78_9BACT/584-684               .............................................psitdvv-------I.....SG.I...K....YN..................EA..TVSWE..T...D...............................N..................A.........-..SDS.......................RVEYI.TE.....T.GG.....................................D..F.SE........A.F..G.F......VS....N.SPK.........................................................................NNEA.D..LGLH.SVILS....G.......L..NSIT.TYY.......F..QV...............KST...NEeg............................ntsT--.--..-----lkegtngytftt...............................
V9DVT3_PHYPR/199-305                   ....................................................PLQIRLAL.....TG.-...K....KG..................EM..RVTWV..S...G...............................Q..................V.........-..FGP.......................NVEFG.TA.....T.SG....................................lL..E.RR........A.E..A.T......SG....S.YDAldmcdgl...........................................................arirssvYFRH.P..GYLH.DALMT....D.......L..VPGI.KYI.......Y..RV...............GSV...TG.................................VSS.PE..MEFT-f..........................................
V4M3T9_EUTSA/61-152                    ....................................................PQQVHITQ.....GD.V...E....GK..................AV..IVSWV..T...Q...............................E..................A.........K..GSN.......................TVLYW.KE.....N.SS.....................................K..K.LK........A.H..G.K......ST....T.YKF.........................................................................YNYT.S..GHIH.HCTIR....N.......L..EYDS.KYY.......Y..VV...............GVG...Q-.................................-T-.--..-----erkfwfft...................................
A0A0G1XQJ1_9BACT/550-650               ...............................................pviss-----VAA.....GT.L...T....DT..................TA..TISWV..T...A...............................T..................S.........-..SDS.......................YVYYA.TS.....S.AL.....................................T..N.PS........T.A..G.N......AT....M.VSA.........................................................................STTP.T..NFPH.SVTLS....G.......L..AVNT.RYY.......Y..YV...............KST...DS.................................---.--..-----ngdattyptaapynyfnt.........................
A0A061FD44_THECC/45-134                ....................................................PQQVHISL.....AG.-...-....EK..................HM..QISWV..T...D...............................D..................K.........S..APS.......................IVEYG.TS.....P.GI.....................................Y..T.SS........A.E..G.D......TT....S.YSY.........................................................................LFYS.S..GKIH.HTVIG....P.......L..EHDT.VYF.......Y..RC...............GGQ...G-.................................---.--..-----pefqlktpp..................................
A0A090LQY9_STRRB/27-122                ...................................................h-EQVHLSL.....LD.-...G....PH..................NI..AVSWV..T...F...............................Y..................Dlr.....klQ..RKP.......................TVKYG.TA.....T.GT.....................................G..Q.KK........T.G..F.T......RI....L.KVA.........................................................................KSTI.T..RYFH.TVVLK....N.......L..EANQ.RYY.......Y..KV...............GDG...E-.................................TWS.KI..FTFKT...........................................
A0A139WZN4_9CYAN/9-119                 .............................................dpflqlp--------.....--.-...T....EN..................SV..RVVWF..T...E...............................F..................A.........G..SGH.......................IVAYG.KN.....L.AHtata............................ktiklN..-.--........-.-..-.-......--....-.--Rvredqnsrvg....................................................nqtedgqiyqhPVVR.D..IWRH.EAEVT....D.......L..TPNT.RVS.......Y..RV...............TSV...REdg.............................esISS.SV..FS---la.........................................
W5FBI2_WHEAT/178-287                   .................................................pvf---PRLSQ.....GK.-...Q....WN..................EM..AVTWT..S...G...............................Y..................Ni.......gE..AYP.......................FVEWR.MK.....G.EE.....................................T..S.KR........T.P..A.G......TL....T.FTRghlcg..............................................................npargqGYRD.P..GFVH.TAFLK....D.......L..WPNR.EYS.......Y..QI...............GHE..lQDg..............................tvAWG.KA..ATFR-a..........................................
A0A0K9QN59_SPIOL/64-155                ....................................................PQQVHITQ.....GD.H...E....GK..................AM..IVSWV..T...M...............................E..................E.........P..GSD.......................KVVYW.RE.....K.SK.....................................D..K.RS........A.K..G.K......MS....K.YKY.........................................................................HNYT.S..GYIH.HCTLR....N.......L..KYDT.KYY.......Y..EV...............GVG...Q-.................................-TP.RT..FWFKT...........................................
G7XII2_ASPKW/70-173                    .........................................nnvnvislsyi--------.....--.-...-....PK..................GM..HIHYQ..T...P...............................F..................G........lG..QLP.......................AVRWG.KD.....P.RN.....................................L..N.ST........A.Q..G.Y......SH....T.YDRtpsc................................................................sqvkaVTQC.S..QFFH.EVSID....S.......L..EPDT.TYY.......Y..QI...............PAA...NG................................tTQS.EV..LSFKT...........................................
T0Q8K1_9STRA/70-169                    ....................................................PQQLHLAY.....AGvE...P....GT..................AM..TVSWT..T...Y...............................H..................R.........I..NDS.......................AVWVA.DH.....L.FH.....................................N..T.SR........L.T..A.Hm...atVA....S.YYA.........................................................................DEHY.T..LYTY.HVTLS....N.......L..LPKT.RYY.......Y..QV...............GSL...QNv...............................tRRS.SV..YHFRT...........................................
A0A0L0DMA7_THETB/28-118                ....................................................PQALHLAL.....GN.-...S....AD..................AY..VVSWL..T...L...............................D..................E.........T..RTS.......................TVKYG.TA.....P.GA.....................................L..D.KI........A.T..G.S......AR....I.YD-.........................................................................-HVG.G..GFNH.FVTLD....A.......L..PANA.KIY.......Y..LV...............GDA...EG.................................GFS.DV..FFFET...........................................
A0A0M2XZA0_9SPHI/30-126                ....................................................PDRITLTW.....SD.N...P....SN..................TQ..SVSWR..I...N...............................A..................D.........R..TKI.......................IGQIT.EE.....Q.SN.....................................P..E.LE........K.N..A.T......TI....N.GTAls.....................................................................leRGQQ.E..DAYG.QVTFR....D.......L..KPGT.VYA.......Y..RV...............GDG...S-.................................NWS.AW..NQFRT...........................................
A0A061GIQ7_THECC/63-154                ....................................................PQQLHITQ.....GD.Y...D....GK..................AV..IISWV..T...A...............................D..................E.........P..GPS.......................KVQYG.TS.....E.KK.....................................Y..D.LS........A.D..G.T......VT....N.YTF.........................................................................YNYK.S..GYIH.HCLVD....G.......L..EYET.KYY.......Y..KI...............GVG...A-.................................-SS.RE..FWFQT...........................................
A0A0D2RL65_GOSRA/60-151                ....................................................PQQVHITQ.....GD.H...V....GK..................AV..IVSWV..T...Q...............................D..................E.........P..GSN.......................TVVYW.SE.....G.SK.....................................E..K.MK........A.V..G.K......IS....T.YKY.........................................................................YNYT.S..GFIH.HCTVK....N.......L..EYNT.KYY.......Y..VV...............GEG...T-.................................-SM.RK..FWFTT...........................................
A0A0W8DVY2_PHYNI/107-222               ....................................................PSQIHVAF.....AE.E...V....EVkgysairtvntaaleirlGM..TISWA..T...N...............................M..................K.........T..RTS.......................SVRYG.LS.....K.DD.....................................L..S.MV........Q.Q..S.Me....pCE....Q.YDF.........................................................................CSYT.S..PWLH.HVTIP....Gd.....kL..EPNT.NYY.......Y..RC...............GDE...TG.................................GWS.AV..YSFKT...........................................
A0A059CL76_EUCGR/55-146                ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...S...............................D..................E.........P..GSS.......................EVQYG.TT.....T.GK.....................................Y..D.HS........A.E..G.K......SS....S.YSF.........................................................................YKYK.S..GYIH.HCLLD....G.......L..EYDT.KYY.......Y..KV...............GSG...G-.................................-SS.RE..FWFQT...........................................
A0A0D2VHQ3_GOSRA/56-147                ....................................................PQQVHITQ.....GN.Y...D....GN..................AV..IISWI..T...F...............................D..................E.........P..GSS.......................KVQYG.KS.....D.KN.....................................Y..E.FS........A.E..G.K......MT....N.YTF.........................................................................YKYN.S..GYIH.HVLVD....G.......L..EYDT.KYY.......Y..KT...............GDG...D-.................................-SA.RE..FWFQT...........................................
M0XWB1_HORVD/108-197                   ....................................................PQQVHIST.....VG.-...-....SD..................RM..RISWV..T...D...............................D..................R.........N..APS.......................VVEYG.KS.....R.GN.....................................Y..T.VS........T.T..G.G......HA....T.YRY.........................................................................FFYK.S..GAIH.HVTIG....P.......L..SPST.TYH.......Y..RC...............GKA...GD.................................---.--..-----eftlrtpp...................................
B9SRV6_RICCO/1-75                      ....................................................--------.....--.-...-....--..................-M..RITWI..T...K...............................N..................L.........-..APA.......................IVSYG.TS.....S.GQ.....................................Y..T.TS........V.N..G.V......TS....T.YRY.........................................................................LTYK.S..GHIH.DVVIG....P.......L..TPNT.VYY.......Y..RC...............SSN...S-.................................--A.RE..YSFKT...........................................
F4EW18_SELS3/47-137                    ................................................ffvr-----QIV.....TE.D...S....RT..................SR..MIAWE..S...T...............................V..................S.........E..VQA.......................VVDLR.LV.....G.AA.....................................G..F.SS........F.A..V.S......EK....L.L-D.........................................................................DGGE.R..LFSH.EALLT....G.......L..SPGA.SYE.......Y..RL...............RTG...D-.................................TSS.PW..FSLRT...........................................
A0A0G0XTJ7_9BACT/43-128                ....................................................PQNVRLSN.....FS.-...-....DS..................SV..TISWI..T...D...............................D..................K.........-..TAS.......................FVSYG.VN.....E.NV.....................................G..D.VI........S.E..T.-......--....-.---.........................................................................EDDQ.K..FSTH.SITIT....G.......L..NPET.NYY.......F..KI...............NSD...GT.................................---.--..-----tfdnngipwqfa...............................
D7L636_ARALL/64-176                    ....................................................PEQISLSL.....SS.-...D....HD..................SI..WVSWI..T...G...............................Efqigkk......vkpldpT.........S..IKS.......................VVQFG.TL.....R.HS.....................................L..S.HE........A.K..G.H......SL....V.YSQlyp..................................................................fdglLNYT.S..GIIH.HVRIT....G.......L..KPST.IYY.......Y..RC...............GDP...SR................................rAMS.KI..HHFRT...........................................
A0A096UEP2_MAIZE/174-282               ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Di.......tE..AVP.......................FVEWG.EK.....G.GR.....................................R..-.LL........A.P..A.G......TL....T.FDRnsmcg..............................................................spartvGWRH.P..GYIH.TSFLK....D.......L..WPDS.PYT.......Y..RL...............GHRl.mNGt...............................rVWS.KS..YSFK-a..........................................
A0A147JXI4_9EURY/520-604               ...............................................envds--------.....SN.I...T....TN..................SA..TITWD..T...D...............................E..................I.........-..ADS.......................LVKYG.TT.....S.GN.....................................Y..T.DN........E.Y..D.S......A-....-.---.........................................................................----.Y..VTSH.SIDLT....D.......L..IENT.TYY.......Y..VV...............KST...DPsn.............................nsSES.SE..YSFTT...........................................
K9QTU8_NOSS7/36-156                    .............................................rinpylq-------Q.....PG.-...-....SD..................GM..SFTWF..T...E...............................E..................D.........-..VPG.......................ILSIT.GA.....G.LSnp................................ltfT..S.TP........A.Y..Q.S......VL....A.YTNaeknqni..........................................................tglspgswLLSD.N..NYKH.TVDVR....G.......L..LPGT.TYE.......Y..TV...............VQG...SN.................................IFN.--..-----ssfktapskddwssirf..........................
A0A150AHW4_9BACT/45-148                ....................................................PDRIILTF.....HG.D...P....ST..................SR..AVTWR..T...D...............................K..................S.........V..DSA.......................VAEIA.EA.....T.VN.....................................S..K.FE........D.K..A.Q......KI....T.ATTevfdl...............................................................glykgNSSL.K..VNYH.SVVFE....G.......L..KPNT.LYA.......Y..RV...............SDG...GK.................................HRS.EW..IHFRT...........................................
A0A0G1YMU0_9BACT/128-218               ...............................................pviss-----LTA.....GM.L...A....PT..................SV..MISWN..T...N...............................E..................L.........-..TTG.......................SVYFS.TT.....T.PV.....................................N..T.NT........A.T..T.L......--....-.---.........................................................................GTTT.L..SLAH.ALNLT....A.......L..FPNT.TYY.......F..VV...............VSK...DGan.............................ntATS.TE..QSFIT...........................................
A0A0D3HX61_9ORYZ/516-610               ....................................................PEQVHITL.....GD.Q...T....GR..................AM..TVSWV..T...P...............................K..................L.........P..DSN.......................VVRYG.LR.....A.DN.....................................L..T.HT........A.N..G.T......FR....R.YSF........................................................................gRKYR.S..GFIH.HATLT....G.......L..DYGT.KYH.......Y..AV...............GSG...DT.................................ASA.RS..FSFTT...........................................
B6QKE0_TALMQ/29-116                    ....................................................PMQVRLAY.....AG.-...-....PK..................GM..VVSWN..T...F...............................S..................E.........L..ERP.......................VVHYG.RF.....P.DA.....................................L..I.HE........A.S..S.D......VS....V.T--.........................................................................YPTS.T..TYNN.HVTLQ....D.......L..EEDT.VYY.......Y..LP...............EHS...N-.................................-AT.EP..YTFRT...........................................
J3L4Y1_ORYBR/210-313                   ....................................................PLHGHLSS.....VD.S...K....AT..................SM..KLTWV..S...G...............................D..................G.........-..KPQ.......................QVQYG.SG.....K.AA.....................................A..S.VA........T.T..F.T......HK....D.MCSiavlp..............................................................spakdfGWHD.P..GYIH.SAVMT....G.......L..QPSQ.FYT.......Y..RY...............GSD...SV.................................GWS.DT..IKFRT...........................................
M5RHP0_9PLAN/2-98                      ....................................................PDRIVLTW.....AG.D...P....TT..................TQ..SVTWR..T...D...............................M..................S.........V..KKA.......................VLEFA.IA.....E.DGpl................................fvnK..T.QQ........T.D..A.K......SE....S.LK-.........................................................................TDLG.L..AQYH.SVTLT....E.......L..KPST.KYV.......Y..RV...............GDG...V-.................................NWS.EW..AHFVT...........................................
PPA6_ARATH/50-147                      ....................................................PEQVHLTQ.....GD.H...D....GR..................GM..IVSWV..T...P...............................L..................N........lA..GSN.......................VVTYW.IA.....T.NGsd................................vkpA..K.KR........A.H..A.S......TK....S.YRF.........................................................................YDYS.S..GFLH.HATIK....G.......L..EYDT.KYI.......Y..EV...............GTD...K-.................................-SV.RQ..FSFTT...........................................
A0A0G1WH45_9BACT/416-504               ................................................isgi------AA.....TS.T...T....SS..................AS..RIVWT..T...N...............................E..................Q.........-..ATG.......................KLWYS.TS.....T.PV.....................................V..T.TV........A.P..S.A......S-....-.---.........................................................................-NET.P..LFDH.DFLLS....G.......L..TSST.TYY.......Y..VV...............SSG...DAag.............................ntSTS.TE..AMFQT...........................................
G2Q6P4_MYCTT/72-174                    .......................................nninvislsylpg--------.....--.-...-....--..................GI..NIHFQ..T...P...............................F..................G........lG..EAP.......................SVLWG.TR.....P.DR.....................................L..Y.RR........A.T..G.T......SH....T.YDRtppc.................................................................saaaVTQC.S..QFFH.EVQLR....H.......L..RPGT.RYY.......Y..QI...............QAA...NG................................tTES.GV..LSFDT...........................................
T1JVC5_TETUR/23-113                    ....................................................PHQVHLSL.....ND.-...E....AT..................SI..TVSWT..D...L...............................K..................P.........F..QEP.......................TVKWG.LE.....R.DQ.....................................L..S.NQ........S.G..G.H......LR....R.FG-.........................................................................SFGR.D..IFSY.WAVMR....N.......L..EPDT.TYY.......Y..QV...............GSK...S-.................................RLS.PV..YSFRT...........................................
I1GNM1_BRADI/51-145                    ....................................................PEQVHITQ.....GD.L...T....GR..................AM..TISWV..T...P...............................H..................H.........P..GSN.......................MVRYG.LS.....P.TN.....................................L..T.HA........T.E..S.T......AV...rR.YTF........................................................................gPSYQ.S..PYIH.HATIS....G.......L..DYNT.TYH.......Y..AL...............GFG...Y-.................................TNV.RS..FSFRT...........................................
D3BNI1_POLPA/11-108                    ....................................................PLGVRLAL.....TG.-...V....EN..................EM..RISWY..T...S...............................S..................Q.........G..DAP.......................SVQYS.TT.....P.FNps.................................dmD..A.QA........M.E..V.A......SN....N.QYT.........................................................................EIAW.K..GFSV.SAVLT....Q.......L..TPLT.TYY.......Y..SV...............GDK...SV................................gIWS.PL..YNFTT...........................................
A0A0G1QVM7_9BACT/1590-1675             ..............................................isgvgv------SL.....T-.-...-....HN..................SA..TFTWT..T...D...............................L..................D.........-..SDS.......................FVQYG.AD.....A.GL.....................................T..N.ST........F.V..G.Q......Q-....-.---.........................................................................---D.S..IKNH.TVTIS....S.......L..LPQT.TYY.......F..RL...............NST...A-.................................---.--..-----gegtgiapstgnsls............................
A0A0G1U4P6_9BACT/512-602               ............................................pvissvva--------.....GT.F...T....PT..................GA..TITWT..T...N...............................E..................N.........-..ATS.......................KVYYS.DS.....T.PV.....................................N..T.ST........A.Q..A.V......S-....-.---.........................................................................-DST.L..VTSH.SLAIT....G.......L..SGNT.PYY.......Y..SV...............QSA...DSvg.............................nqVVS.TE..SSFTT...........................................
A9RPR4_PHYPA/164-266                   ....................................................PTQIHLAL.....TS.-...N....ET..................AV..RVMFV..T...K...............................D..................P.........-..VRS.......................KVRFG.SG.....E.DN.....................................L..E.TT........V.E..A.N......FV....T.YSQidmcd..............................................................epassvGWRD.P..GYIH.DAVME....G.......L..IYGG.RYY.......Y..QA...............RSN...VG.................................GWS.TT..YTF--is.........................................
V4U3U7_9ROSI/76-188                    ....................................................PEQLSVSL.....SF.-...N....HD..................SI..WITWI..T...G...............................Efqigdn......ikpldpK.........T..VAS.......................FVRYG.TS.....R.TN.....................................L..N.HE........A.T..G.H......SL....V.YDQlyp..................................................................feglQNYT.S..GIIH.HVRLT....G.......L..EPNN.KYY.......Y..QC...............GDP...SI................................pAMS.DV..YYFRT...........................................
A0A0E0RKH2_ORYRU/464-558               ...................................................n-DDVHITL.....GD.Q...T....GR..................AM..TVSWV..T...P...............................K..................L.........P..DSN.......................VVRYG.LR.....A.DN.....................................L..T.HT........A.N..G.T......FR....R.YSF........................................................................gRKYR.S..GFIH.HATLT....G.......L..DYGT.KYH.......Y..AV...............GSG...DT.................................ASA.RS..FSFTT...........................................
A0A0K0FUZ8_9BILA/14-102                ....................................................PEQVHLSY.....GG.-...D....VT..................KL..IVTWV..T...F...............................D..................D.........T..FNS.......................YVEYG.EN.....I.DK.....................................L..D.II........V.K..A.K......MH....L.F--.........................................................................DEGK.K..RYIH.TATID....N.......I..VPGK.RYF.......Y..HV...............GSK...Y-.................................GWS.PV..FWF--y..........................................
A0A0E0RKH4_ORYRU/445-539               ...................................................n-DDVHITL.....GD.Q...T....GR..................AM..TVSWV..T...P...............................K..................L.........P..DSN.......................VVRYG.LR.....A.DN.....................................L..T.HT........A.N..G.T......FR....R.YSF........................................................................gRKYR.S..GFIH.HATLT....G.......L..DYGT.KYH.......Y..AV...............GSG...DT.................................ASA.RS..FSFTT...........................................
M8AQC5_TRIUA/17-108                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...P...............................S..................E.........P..APS.......................QVFYS.KE.....E.NR.....................................Y..D.QK........A.E..G.T......MT....N.YTF.........................................................................YDYK.S..GYIH.HCLVD....G.......L..EYNT.KYY.......Y..KI...............GTG...D-.................................-SA.RE..FWFQT...........................................
G2RGJ3_THITE/36-121                    ....................................................PSQIRVAY.....AG.-...-....DK..................AM..AVSWN..T...K...............................S..................Q.........L..AHP.......................TVYYG.KS.....Q.AK.....................................L..N.KI........A.Q..S.Q......IS....T.T--.........................................................................YPTS.S..TYNN.HVVLS....D.......L..DEDT.LYY.......Y..KP...............ACT...N-.................................---.AT..YSFTT...........................................
A0A0A1V6C6_9HYPO/69-171                ..............................................nnvnvi----SLSY.....AG.-...-....-N..................GV..NIHYQ..T...P...............................F..................G........lG..ASP.......................SVAWG.TS.....A.GS.....................................L..T.SI........V.T..G.S......SR....S.YGRtppc.................................................................srvaVTQC.S..QFYH.DVQIR....N.......L..SPDT.TYY.......Y..KI...............PAA...NG................................tTAS.EV..LSFKT...........................................
A0A0D2UCQ1_GOSRA/60-151                ....................................................PQQVHITQ.....GD.Y...N....GK..................AV..MVSWV..T...A...............................D..................K.........P..GSS.......................RVQYG.TS.....E.KK.....................................Y..D.FK........A.D..G.T......VA....N.YTF.........................................................................YNYK.S..GYIH.HCLVD....G.......L..EYET.KYY.......Y..KI...............GEG...H-.................................-SS.RE..FWFQT...........................................
F2UKX4_SALR5/99-190                    ....................................................PVEVHTSL.....LN.-...-....NS..................RL..AIMWV..T...E...............................V..................P.........T..KTS.......................TVEYS.TD.....G.SH.....................................S.fS.KS........I.Q..G.S......TH....T.YT-.........................................................................AGGW.K..GVIH.EVHMP....E.......F..PANT.RVT.......Y..HV...............GDR...DG.................................GWS.AI..YTVQT...........................................
K4A790_SETIT/171-279                   ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...Gy.............................gT..................N.........E..ATP.......................FVRWG.IQ.....G.QI.....................................Q..I.LS........P.A..G.T......-L....T.FSRntmcg..............................................................ppartvGWRD.P..GFIH.TSFLR....D.......L..WPNS.MYT.......Y..QI...............GHRl.fDGs...............................iVWG.HQ..YSFK-a..........................................
A0A0G0JA05_9BACT/1200-1290             ..................................................pe--ISNVTV.....AT.T...T....LS..................TA..TITWD..T...T...............................I..................A.........-..SDS.......................FVSYD.SD.....S.LF.....................................A..S.AK........E.Q..G.D......TV....-.---.........................................................................----.I..TSSH.SVTLT....G.......L..TPGE.TYY.......F..KV...............RST...AEdrs...........................stlIVP.ET..GSFQT...........................................
H3GBF7_PHYRM/46-161                    ...................................................p-AQIHVAL.....AG.E...M....AVksyaairnanaaaselrlGM..TVSWA..T...E...............................V..................K.........T..TKS.......................TVRYG.LD.....K.DA.....................................L..S.TV........Q.Q..A.Ee....pCE....Q.YDF.........................................................................CTYT.S..PWLH.HVTIP....Gd.....kL..VADT.TYY.......Y..QC...............GDE...TG.................................GWS.PV..YSFKT...........................................
Q0CWA3_ASPTN/67-171                    .......................................tnnvnvislsylp--------.....--.-...-....-R..................GI..HIHYQ..T...P...............................F..................G........lG..DAP.......................HVKWG.KH.....P.HQ.....................................L..N.RV........A.R..G.F......TH....T.YDRtppc................................................................savkaVTQC.S..QFFH.EVSLE....H.......L..ESDT.TYY.......Y..QI...............PSA...NG................................tTES.EV..LSFTT...........................................
A0A0T5ZZ07_9BACT/1-62                  ..................................................ma--------.....--.-...-....--..................--..-----..-...-...............................-..................-.........-..TDS.......................RVSYG.PA.....Q.GK.....................................L..T.SQ........V.D..Q.A......T-....-.---.........................................................................----.L..RTEH.EVQLT....G.......L..TPDT.TYY.......Y..AI...............GST...T-.................................AT-.--..-----saggdaehff.................................
W5FCY0_WHEAT/85-203                    ....................................................PEQIALAA.....SA.-...D....PS..................SL..WVSWV..T...G...............................R..................A.........Q..VGShltpld...........ptairsEVWYS.ER.....P.AStd................................tvgH..P.HV........A.R..G.S......AE....V.YSQlyp..................................................................ypglLNYT.S..GVIH.HVRLV....G.......L..TPST.RYY.......Y..RC...............GDS...SLk...............................dGLS.DE..RSFRT...........................................
K4CQY9_SOLLC/48-136                    ....................................................PEQVHISL.....VG.-...-....KD..................YM..RVTWI..T...S...............................H..................K.........H..EKS.......................IVEYG.TS.....P.GN.....................................Y.dK.SS........T.T..G.E......RM....S.YRY.........................................................................FFYN.S..GVIH.HITIG....P.......L..GPNK.TYY.......Y..RC...............GGN...G-.................................---.PE..FSFKT...........................................
A0A0A0LR86_CUCSA/177-285               ..........................................plfprlahgk--------.....--.-...L....WN..................EM..TITWT..S...G...............................Y..................Di.......sD..ATP.......................FVEWG.LE.....G.EV.....................................Q..T.RS........P.A..G.T......L-....T.FSRnsmcd..............................................................apartvGWRD.P..GFFH.TSFLQ....N.......L..WPNT.VYT.......Y..RM...............GHRl.lSGs...............................yIWS.KS..YSFK-s..........................................
C4IIN9_CLOBU/61-149                    ....................................................PTQVSLTP.....GK.-...D....ET..................EL..NFSWY..S...K...............................K..................S.........N..EKP.......................RFKFG.KK.....A.DL.....................................K..D.GK........E.-..-.-......IE....V.TSE.........................................................................EAVS.G..YVSN.KCIVT....G.......L..TENT.TYY.......Y..SY...............TVD...G-.................................KWS.EP..VSYR-a..........................................
W9RAH0_9ROSA/203-311                   ............................................pvyprlaq--------.....GK.-...I....WN..................EM..TVTWT..S...G...............................Y..................Gi.......dE..AEP.......................FVEWG.QK.....G.GD.....................................K..V.RS........P.A..G.T......M-....T.FDRnslcg..............................................................apastlGWRD.P..GFIH.TSFLK....E.......L..WPNT.KYV.......Y..KL...............GHK..lSDg..............................syIWS.QE..YHFR-s..........................................
A0A0D9Y1T9_9ORYZ/65-137                ................................................napq--------.....--.-...-....--..................--..-----..-...-...............................Q..................E.........A..GNS.......................TVMYG.KA.....M.DK.....................................L..D.MA........A.E..G.N......HT....R.HKY.........................................................................YNYT.S..GHIH.HCTLV....N.......L..EYGV.KYY.......Y..AM...............GFG...Y-.................................-TV.RT..FWFTT...........................................
A0A0D2SAD0_GOSRA/73-185                ....................................................PEQIFVSL.....SS.-...T....HD..................SV..WISWI..T...G...............................Efqigen......ikemdpK.........T..VGS.......................VVKYG.RW.....R.FG.....................................M..T.KR........A.M..G.H......SL....V.YSQlyp..................................................................fkglQNYT.S..GIIH.HVRLT....G.......L..KPNT.FYY.......Y..QC...............GDP...SI................................pAMS.DV..HYFRT...........................................
A0A024GJF9_9STRA/39-144                ..................................pllihlalyddtrissdl--------.....--.-...T....GN..................GM..TVSWV..T...K...............................Q..................S........lM..SPS.......................VVQFG.LE.....L.SR.....................................L..S.EKi......vS.S..Q.K......CE....R.YSF.........................................................................CDYR.S..PCFH.HVTIPa..rS.......L..SPGT.MYY.......Y..RC...............GNE...AS.................................GWS.EV..RTFT-i..........................................
A0A078IWD1_BRANA/53-147                ....................................................PEQVHITQ.....GD.H...N....GR..................GM..IISWV..T...P...............................I..................N........dD..GSN.......................FVKYW.IT.....D.SDe...................................sT..K.ES........A.E..A.S......TS....S.YTY.........................................................................YDYT.S..GFLH.HATIK....G.......L..KYDT.KYF.......Y..EL...............GTG...R-.................................-SS.RR..FSFTT...........................................
A0A0E0N3Q1_ORYRU/206-309               ....................................................PLHGHLSS.....VD.S...K....AT..................SM..RLTWV..S...G...............................D..................A.........-..RPQ.......................QVQYG.TG.....K.TA.....................................T..S.VA........T.T..F.T......HK....D.MCSiavlp..............................................................spakdfGWHD.P..GYIH.SALMT....G.......L..QPCQ.SYN.......Y..RY...............GSD...SV.................................GWS.NT..TEFRT...........................................
M0Y7U1_HORVD/85-177                    ....................................................PQQVHISL.....SG.-...-....EK..................HM..RITWV..T...D...............................D..................N.........S..VPS.......................VVDYG.TK.....S.NT.....................................Y..T.SS........S.D..G.E......ST....S.YSY.........................................................................LMYS.S..GKIH.HVVIG....P.......L..EDNT.VYY.......Y..RC...............GGR...GS.................................---.--..-----efqlktppsqf................................
U5CYW7_AMBTC/86-177                    ....................................................PEQVHITQ.....GD.Y...D....GK..................AV..IVSWV..T...P...............................A..................E.........P..GTS.......................EVFYA.TS.....E.NG.....................................Y..D.HH........A.E..G.K......VT....N.YTF.........................................................................YNYK.S..GYIH.HCLID....G.......L..EYDT.KYN.......Y..KI...............GKD...S-.................................-SS.RE..FWFHT...........................................
A0A0R3P3Y3_DROPS/42-143                ....................................................PEQVHLAF.....GE.R...T....AS..................EM..VVTWS..T...R...............................S..................Lp.......pD..TAS.......................VVEYG.LI.....V.AGqa................................psrL..N.QR........A.Q..G.T......AT....R.FVDg.......................................................................gRKHS.T..QFIH.RVTLS....Q.......L..EANS.SYA.......Y..HC...............GSA...L-.................................GWS.AV..YQFRT...........................................
A8XTP7_CAEBR/46-139                    ....................................................PEQIRISY.....GG.-...D....PS..................VS..FVTWQ..T...F...............................D..................D.........T..LQS.......................IVEYG.SD.....W.KF.....................................L..N.QS........V.L..G.R......CS....V.FLD.........................................................................RNKN.SvwRYIH.RANLT....A.......L..VPGQ.TYY.......Y..HV...............GSE...H-.................................GWS.PI..YFFT-a..........................................
A0A0C2ZBS2_9HOMO/1-79                  ....................................................--------.....--.-...-....--..................-M..TVSWS..T...Y...............................A..................Q.........L..QAP.......................QVFYG.ES.....P.FD.....................................L..S.AV........A.T..G.Y......SV....T.Y--.........................................................................-PTS.R..VYDN.HVKIT....G.......L..KANT.KYW.......Y..RV...............AYQ...NC.................................---.--..-----pgcayratdtfvt..............................
A0A0G1U8B4_9BACT/1567-1665             ................................................isdv----TATI.....VD.-...-....DK..................NA..VIVWN..T...D...............................T..................D.........-..ANS.......................AVTYA.TN.....V.AS.....................................L..N.NA........T.N..T.I......TV....Q.SAS.........................................................................LVGG.P..PYQH.SVTLT....D.......L..AART.TYW.......Y..SV...............SST...DEagdv.........................atdkNNL.AY..YSFTT...........................................
K8Z245_NANGC/45-168                    ...................................................v-QQIHIAQ.....GI.-...D....PT..................TM..VISWL..T...P...............................N..................Yt......apA..PAS.......................QVRYG.LD.....P.DN.....................................L..D.WL.......iT.N..Q.D......AF....T.YTIpagyak............................................................qdqkspyPDYT.S..GWLH.NVELR....N.......L..QPNT.LYY.......Y..QC...............GDF...--.................................---.--..-----silpsngddypytpptgrsgtlffkt.................
R5UXL6_9BACT/265-353                   ...............................................trpyl--------.....QN.P...T....EQ..................GI..TVSWL..T...N...............................V..................P.........-..VYS.......................WVEFG.TD.....T.LN.....................................L..K.RA........H.T..L.V......--....-.-DG.........................................................................QVIA.N..NYIH.KIRLS....P.......L..EAGK.TYY.......Y..RV...............CSR...EIls.............................ykAYS.KV..-----fget.......................................
B5GCP1_STRSH/62-157                    ....................................................PTGVILGV.....GA.-...N....ET..................QR..TVSWY..T...A...............................T..................D.........-..SAQ.......................QVQLV.PT.....A.RL.....................................A..D.GE........F.P..A.D......AA....V.FDAtg....................................................................aanIATS.G..GFNR.HATLT....G.......R..QEHT.AYS.......Y..RV...............GAA...G-.................................AWS.PT..YSFKT...........................................
A0A0N4ZQH4_PARTI/26-119                ....................................................PKHVHLSL.....NN.-...D....PQ..................SM..VFSWI..T...F...............................S..................Si......shT..STP.......................IVKYG.TS.....N.VS.....................................L..T.NT........V.T..G.S......FT....V.FI-.........................................................................YNGI.V..RYMY.KATAS....N.......L..QFNT.RYY.......Y..QV...............GSE...E-.................................GLS.QI..FSFKT...........................................
A0A0N1FSY9_9ACTN/78-183                ....................................................PFGRHLAF.....GA.D...P....KT..................QM..RVSWQ..V...P...............................L..................A.........V..RRP.......................YLRVG.TH.....P.GQ.....................................L..S.RK........L.A..A.E......VR....A.LHTpgv...................................................................tgvRPTL.D..QYYV.HAALD....G.......L..RPGT.TYY.......Y..GV...............GHD...GFdpa...........................spaHGS.TV..GSFRT...........................................
W7SUE8_9PSEU/51-144                    ...................................................v-QGLHLTF.....GR.D...P....SR..................QM..VVSWI..T...E...............................G..................S.........V..RKP.......................RVVYG.TL.....E.GG.....................................F..G.GC........A.D..A.D......TK....T.YVD........................................................................gTSGR.T..VYIH.HAELN....R.......L..RPNT.QYM.......Y..AA...............QHD...G-.................................ATP.DA..GTFRT...........................................
F0SF17_PSESL/21-113                    ...................................................a-QGVHLSWysndeKN.N...T....SN..................SI..AVTWM..G...N...............................T..................S.........-..-NE.......................SIYYG.TD.....S.SK.....................................L..K.NK........A.P..L.E......IK....-.--Y.........................................................................SNEL.G..LYTF.KSKIQ....K.......L..KPDT.YYF.......Y..RI...............GTS...L-.................................AQN.PV..YHFKT...........................................
A0A0G4J5I3_PLABS/166-257               ...............................................pammr-----LAI.....IN.-...-....QT..................AV..SVSWT..T...W...............................Rgl.............tssA.........L..YNP.......................VVVFG.NG.....T.GR.....................................H..D.EK........V.A..G.T......TR....S.Y--.........................................................................---S.S..DYHH.DVVIA....G.......L..KPNG.RYF.......Y..RC...............GDE...GR.................................GLS.IE..ASFE-m..........................................
L8FYE5_PSED2/70-174                    ..............................................tnnvnv------IS.....LA.Y...L....PD..................GM..NIHYQ..T...P...............................F..................S........lG..VAP.......................SVKWG.TD.....P.NK.....................................L..Y.KT........A.T..G.N......SH....T.YDRtppc................................................................slissVTLC.S..QWFH.EVPIK....N.......L..QPGT.TYY.......Y..QI...............PAA...NG................................tTVS.DV..EKFTT...........................................
R6YVF7_9BACE/45-136                    ....................................................PGRILLTF.....GD.E...D....GL..................SR..NISWQ..Y...D...............................S..................I.........V..HPS.......................FVELA.DT.....L.SK.....................................D..T.TV........I.K..A.Q......GE....T.FSS.........................................................................-RSG.K..AAYY.VARLR....S.......L..KPSR.CYS.......Y..RV...............CSN...G-.................................NYS.AW..KHFQT...........................................
F0XBL4_GROCL/70-173                    ............................................tnnvnvis--------.....LS.Y...V....PK..................GM..NIHYQ..T...P...............................F..................G........lG..VLP.......................SVKWG.TS.....E.AA.....................................L..L.YT........V.T..G.Q......TH....G.YDRtppc.................................................................smvaVTQC.S..QFFH.EVQIT....D.......L..QPDT.TYY.......Y..QI...............LAA...NG................................tTES.DV..LSFTT...........................................
A0A0G1WH45_9BACT/216-306               ..............................................pkisdv------EI.....KN.I...A....AN..................SV..KIEWE..T...N...............................E..................P.........-..ATS.......................VIWYG.TA.....T.SV.....................................S..I.G-........-.N..G.L......--....T.I--.........................................................................SSTT.L..VRDH.ELVLS....G.......L..SAST.TYY.......Y..IV...............ASA...DVkg.............................ntATS.SQ..RSFTT...........................................
A0A0A0LWA9_CUCSA/62-153                ....................................................PQQVHITQ.....GD.Y...E....GK..................AV..IISWV..T...P...............................D..................E.........L..EPN.......................SVQYG.TS.....E.GG.....................................Y..E.FT........A.E..G.A......VT....N.YTF.........................................................................YKYK.S..GYIH.HCLIA....D.......L..KYDT.KYY.......Y..KI...............GSG...D-.................................-SA.RE..FW---fhs........................................
A0A044UEU8_ONCVO/46-137                ....................................................PEQIALSY.....GG.-...D....VS..................SM..WITWL..T...Y...............................N..................D.........T..FSS.......................IVEYG.ID.....D.--.....................................L..R.WS........V.K..G.S......ST....L.FVDg.......................................................................gEQRS.K..RYIH.RILLT....D.......L..KPGT.IYQ.......Y..HV...............GSE...Y-.................................GWS.SL..YRFK-a..........................................
A6DMR8_9BACT/24-105                    ..........................................vlgavdsdsi--------.....--.-...-....--..................--..KV-WG..R...T...............................E..................A.........P..DSF.......................YVRYG.TE.....K.GA.....................................L..N.IR........S.K..T.T......ST....-.---.........................................................................-ELS.H..DNTG.TVELT....D.......L..TPGT.EYF.......Y..AI...............FSD...GK.................................QIS.PE..GSFKT...........................................
U5HIV4_USTV1/56-149                    ....................................................PLQHHLAF.....GK.-...D....YR..................TL..YISWA..S...F...............................S..................F.........I..RTP.......................EVHFG.TD.....P.NN.....................................L..N.L-........-.T..G.T......SR....D.SST.........................................................................YPTS.R..TYNN.HVKLM....D.......L..KLNT.KYW.......Y..TV...............SYT...NAa..............................yaAYR.PK..YTFKT...........................................
E9ENB8_METRA/26-116                    ..................................................ag--QIRLAY.....HG.-...-....AD..................GM..TVSWN..T...F...............................E..................H.........V..KAP.......................SVKWG.LS.....K.GK.....................................L..E.HT........A.S..S.N......VS....L.--T.........................................................................YPTS.T..TYNN.HVVIS....G.......L..KPDT.TYY.......Y..LP...............SPL..pQG.................................NHV.EP..YTFRT...........................................
W4FSD2_9STRA/128-237                   ....................................................PQHGHLAF.....ND.-...H....ID..................QM..VIMYN..S...A...............................S..................N.........R..TIP.......................SVKYS.RR.....D.PSg..................................stN..V.FV........R.S..G.T......SS....T.YSAsdmchmp...........................................................ativgqqWFRH.P..GYMH.TVVMD....S.......L..DLNA.TYS.......Y..QF...............GND...ID.................................GWS.AT..YSFQ-s..........................................
R5IYI8_9CLOT/55-151                    ..................................................ft--KVSLTP.....GG.-...A....AS..................EL..NFAWY..S...E...............................G..................N.........E..PTP.......................VVYFG.TD.....K.DD.....................................L..K.AC........-.S..G.T......AS....S.VDPs.......................................................................lTGGK.P..YSYN.YVTVN....G.......L..KENT.TYY.......Y..SV...............EKS...GV.................................---.--..-----rtpaevyktgsfe..............................
M4CRV9_BRARP/60-147                    ....................................................PQQVHVSL.....AG.-...-....KD..................HM..RVTYI..T...E...............................D..................K.........K..VES.......................VVEYG.KQ.....P.GK.....................................Y..D.RK........N.T..G.E......ST....S.YKY.........................................................................FFYR.S..GKIH.HVKIG....P.......L..EPNT.TYY.......Y..MC...............GCN...G-.................................---.PE..FSFKT...........................................
C3ZZU0_BRAFL/24-115                    ....................................................PQQVHLSY.....AG.-...S....AS..................EM..MVTWS..T...A...............................N..................Q.........-..TDS.......................VVEYG.EG.....G.LM.....................................K..-.-T........P.R..G.S......SV....E.FEDg.......................................................................gDEHR.V..QHIH.RVTLT....G.......L..TPGH.TYM.......Y..HC...............GSM...EG.................................GWS.DL..FVFT-a..........................................
M4FGY5_BRARP/75-186                    ....................................................PEQISLAL.....SS.-...N....YD..................SI..WVSWI..T...G...............................Efqigtn......vkpldpT.........S..IAS.......................IVQFG.TL.....G.DS.....................................L..I.HT........A.T..G.S......SL....V.YSQlyp..................................................................feglLNYT.S..GIIH.HVRIT....G.......L..QPST.VYY.......Y..RC...............GDP...SH.................................GMS.KI..HHFKT...........................................
A0A0G1K2Y4_9BACT/34-120                ...................................................p-EISNVEV.....TG.V...T....DS..................SM..TITWE..T...D...............................E..................D.........-..ADS.......................SVNYG.LQ.....P.DL.....................................G..I.VR........I.P..-.-......--....-.---.........................................................................--VP.D..RTSH.SITLD....N.......L..EPGR.TYY.......F..RV...............ISA...DEng.............................nqGIS.A-..-----dykvem.....................................
A0A059BLC6_EUCGR/1-77                  ....................................................--------.....--.-...-....--..................-M..HISWV..T...D...............................G..................K.........S..SPS.......................YMEYG.TS.....P.GR.....................................Y..D.ST........A.Q..G.E......ST....S.YSY.........................................................................LFYS.S..GRIH.HTVIG....P.......L..ESNT.VYF.......Y..RC...............GGE...G-.................................---.--..-----pefqlktpp..................................
A0A0D3BK13_BRAOL/49-144                ....................................................PEQVHLTQ.....GD.H...N....GR..................GM..IISWV..T...P...............................L..................N........lD..GSN.......................VVTYW.IA.....S.NGs..................................diK..R.RK........K.K..A.S......TS....S.YKF.........................................................................YDYS.S..GFLH.HATIK....N.......L..EYDT.KYM.......Y..EV...............GTD...K-.................................-SV.RQ..FSFTT...........................................
A0A176W291_MARPO/78-169                ....................................................PQQVHIHQ.....GD.Y...E....GT..................AV..IVSWV..T...Q...............................D..................E.........P..GDG.......................KVLYG.QA.....Q.GN.....................................Y..T.TF........V.I..G.E......AY....S.YSF.........................................................................YNYT.S..GFIH.HAVIS....G.......L..QFDT.RYF.......Y..AI...............GSG...N-.................................-VS.RE..FWFIT...........................................
A0A101NYA6_9ACTN/74-179                ....................................................PFGRHLAF.....GN.D...P....RT..................EM..TVSWQ..V...P...............................V..................A.........V..KNP.......................FIRIG.AH.....P.WD.....................................L..S.RK........I.E..A.E......VR....S.LYTpag...................................................................vgaSGDH.T..QYYL.HARLT....H.......L..RPGR.TYY.......Y..GV...............GHE...G-.................................---.--..-----fdpaerhllgtlgtftt..........................
Q54BS2_DICDI/21-117                    ....................................................PTSIRLAF.....TK.-...N....QD..................EV..RVTWW..T...D...............................E..................A.........M..ESP.......................IVLFN.NE.....M.FVpn.................................qdS..V.NG........I.E..A.T......VM....S.YD-.........................................................................TLGF.H..GHPT.TAILT....G.......L..QEMT.QYF.......Y..SI...............GNK..hSD.................................EYS.EV..FNFTT...........................................
A0A0V2FD45_CAUVI/43-143                ....................................................PERIILNL.....TA.D...P....AH..................EM..AVTWR..T...A...............................P..................G.........-..LLG.......................HVEYA.QA.....E.DG.....................................P..D.FI........Q.K..A.V......RV....A.AVTddat................................................................iavreDPAF.K..AAYH.STVLK....G.......L..KPET.VYA.......Y..RV...............GDG...E-.................................RWS.EW..LQFRT...........................................
G0IXK3_CYCMS/231-326                   ...................................................a-DQIMLTW.....SA.D...P....SS..................TM..DIQWR..T...A...............................S..................A.........I..DSS.......................KVSYR.IK.....G.TD.....................................V..V.HT........Q.K..A.E......KY....E.MEDl......................................................................rlANDR.Y..VNRF.TAQLE....N.......L..EAGT.TYE.......Y..KI...............STQ...N-.................................SWP.AT..QTFTT...........................................
A0A0G0IBQ4_9BACT/822-915               ............................................ssistpvi--------.....--.-...T....SS..................AA..VIMWQ..T...D...............................E..................P.........-..STS.......................QVEYG.LT.....S.AA.....................................S..G.SY........T.T..S.T......IR....-.---.........................................................................-DNT.L..TKIH.VVTIT....G.......L..TAET.KYY.......Y..RV...............QSY...DMnpd...........................satAVS.SE..QDV--tttat......................................
A0A0G1U6G5_9BACT/47-137                ....................................................PRQVRITN.....VA.-...-....DT..................SF..SVSWI..T...D...............................Q..................V.........-..ASG.......................QIRYG.TE.....A.NS.....................................L..T.KT........A.A..D.E......RD....Q.LS-.........................................................................GDTG.S..YEVH.QVTLK....N.......L..TATT.AYY.......F..KL...............ESG...GK.................................---.--..-----qfdnngkpfev................................
A0A0L9VP92_PHAAN/74-185                ....................................................PEQIALAI.....SS.-...-....PT..................SM..WVSWV..T...G...............................Daqigln......vtpvdpA.........S..IGS.......................EVWYG.KE.....S.GK.....................................Y..T.SV........G.K..G.D......SV....V.YSQlyp..................................................................feglWNYT.S..GIIH.HVKLE....G.......L..EPGT.RYY.......Y..KC...............GDS...SI................................pAMS.EE..RFFET...........................................
Q7XVG3_ORYSJ/52-141                    ....................................................PQQVHVSL.....VG.-...-....AN..................HM..RVSWI..T...E...............................D..................K.........H..VKS.......................VVEYG.KV.....S.GN.....................................Y..T.AS........A.T..G.E......HT....S.YRY.........................................................................FLYS.S..GKIH.HVKIG....P.......L..DPGT.VYY.......Y..RC...............GMA...GD.................................---.--..-----efglrtpp...................................
PPA21_ARATH/51-138                     ....................................................PQQVHISL.....AG.-...-....KD..................HM..RVTYT..T...D...............................D..................L.........N..VAS.......................MVEYG.KH.....P.KK.....................................Y..D.KK........T.A..G.E......ST....S.YTY.........................................................................FFYN.S..GKIH.HVKIG....P.......L..KPNT.KYY.......Y..RC...............GGH...G-.................................---.DE..FSFKT...........................................
A0A101EYK0_9BACT/25-115                ....................................................PWGIHLSW.....QH.D...P....AT..................TM..TIMWR..M...E...............................P..................G.........E..VEA.......................MVEYG.PT.....P.-Q.....................................L..G.ER........A.L..G.T......RT....S.YV-.........................................................................YARK.E..VIWY.VAELT....G.......L..SPKT.TYF.......Y..RC...............GTP...G-.................................NWS.DI..YSFTT...........................................
M0USG3_HORVD/55-146                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...P...............................S..................E.........P..APS.......................QVFYG.KE.....E.NR.....................................Y..D.QK........A.E..G.T......MT....N.YTF.........................................................................YDYK.S..GYIH.HCLVD....G.......L..EYNT.KYH.......Y..KI...............GTG...D-.................................-SA.RE..FLF--qt.........................................
A0A0E0B509_9ORYZ/186-294               ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Di.......kE..AYP.......................FVEWG.MK.....W.SP.....................................P..T.RT........A.A..G.T......V-....T.FDReslcg..............................................................epartvGWRD.P..GFIH.TAFLT....D.......L..WPNK.EYY.......Y..KI...............GHMl.pDGk...............................iVWG.KF..YSFK-a..........................................
A0A158NSC8_ATTCE/30-121                ....................................................PEAVHLSY.....GN.-...N....IH..................DI..VVTWS..T...K...............................N..................D.........T..KES.......................IVEYG.IG.....G.FI.....................................L..R.AE........G.N..S.T......LF....V.DGG.........................................................................EKKR.K..QYIH.RVWLK....N.......L..TPNS.KYI.......Y..HC...............GSR...Y-.................................GWS.NV..FYMRT...........................................
A0A0D2JRB2_9DELT/123-217               ...............................................ktpyl------IF.....ND.-...D....PH..................TM..TVMWQ..T...T...............................G..................E.........P..DST.......................SIQWS.TD.....P.QF.....................................K..R.SG........G.K..-.-......DS....S.YGElpv...................................................................gvdSLGL.D..ENLY.SFTIK....N.......L..SPDT.TIF.......Y..RV...............FVN...S-.................................-ET.YK..GSFKTp..........................................
B8M2M8_TALSN/32-119                    ....................................................PMQMRLAY.....AG.-...-....DR..................GM..TVSWN..T...Y...............................S..................K.........L..DHP.......................SVRYG.LH.....P.DS.....................................L..D.RK........A.V..S.D......VS....V.T--.........................................................................YPTS.T..TYNN.HVKIN....G.......L..KPDT.LYY.......Y..QP...............QCG...N-.................................-SS.QI..YSMKT...........................................
M5WCJ4_PRUPE/166-274                   ..............................................plyprl------AQ.....GK.-...Y....WD..................EM..TVTWT..S...G...............................Y..................Ni.......iE..AVP.......................FVEWG.LK.....G.EA.....................................Q..I.QS........P.A..G.T......LT....-.FHResmca..............................................................ppartvGWRD.P..GFFH.TSFLK....N.......L..WPNS.LYT.......Y..KL...............GHRl.sNGs...............................nIWS.KS..YHFK-s..........................................
V4AER7_LOTGI/168-263                   ....................................................PEQIHLSF.....GK.-...S....SN..................EM..IVMWA..T...P...............................I..................H.........-..VKS.......................WVTYR.ES.....G.KQ.....................................E..E.SN........S.S..S.T......IA....E.LTH........................................................................dSDSA.F..RYIH.RALLK....D.......L..KEGT.LYQ.......Y..EV...............TAEcpqKK.................................MTS.NS..YNFTT...........................................
N4UF48_FUSC1/69-170                    ..............................................snnvnv------IS.....LS.Y...T....PG..................GI..NIHYQ..T...P...............................F..................G........lG..AAP.......................AVHWG.TS.....A.SE.....................................L..K.NK........A.T..G.S......TT....T.YDRtppc................................................................savkaVTQC.N..QFFH.DVQIS....D.......L..KPGK.TYY.......P..AA...............NGT...T-.................................-KS.DV..LSFTT...........................................
W5EW95_WHEAT/27-67                     ....................................................PEQVHITQ.....GD.L...T....GR..................AM..TISWV..T...P...............................E..................H.........P..GSN.......................VVRYG.LA.....A.DN.....................................L..-.--........-.-..-.-......--....-.---.........................................................................----.-..----.-----....-.......-..----.---.......-..--...............---...--.................................---.--..-----n..........................................
F4L0X8_HALH1/22-113                    ................................................arfr-----AMW.....RD.D...P....AT..................SM..VIAWD..Q...L...............................S..................G.........-..TTP.......................MIYYD.EV.....D.NG.....................................Q..K.TE........L.Y..R.L......KR....K.PDQ........................................................................vVTAR.G..LNNH.FARLS....G.......L..KPNT.VYF.......F..VV...............KDS...E-.................................GSS.RR..YSFRT...........................................
F0ZBD3_DICPU/24-120                    ..................................................sh--SVKLSF.....TK.-...S....ID..................QM..KVTWY..T...I...............................D..................K.........M..VNP.......................VVLFN.TEmf.apE.KD.....................................S..V.LS........V.Q..A.Q......IF....Q.YD-.........................................................................TLGF.K..GYPT.TATIN....G.......L..SQKT.TYY.......Y..CV...............GDK...AA................................nVYS.QI..YNFTT...........................................
W2T0P9_NECAM/1-72                      ....................................................--------.....--.-...-....--..................-M..AVIWT..T...F...............................Q..................Y.........-..DDA.......................EVSYG.ED.....P.NK.....................................L..L.YT........A.T..H.E......GV....K.QWM.........................................................................SGSS.A..RYSH.RAMMR....N.......L..KPST.NYY.......Y..QI...............GAR...S-.................................-F-.--..-----sfnt.......................................
A0A0E0BVP5_9ORYZ/58-149                ....................................................PQQVHITL.....GD.Q...T....GT..................AM..TVSWV..T...A...............................N..................E.........L..GSS.......................TVRYG.SS.....P.EK.....................................L..D.RA........A.E..G.S......HT....R.YDY.........................................................................FNYT.S..GFIH.HCTLT....G.......L..THAT.KYY.......Y..AM...............GFD...H-.................................-TV.RT..FSFTT...........................................
W5F648_WHEAT/139-247                   ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Di.......kE..AVP.......................FVEWG.EK.....G.GR.....................................R..F.LS........P.A..-.G......TL....T.FDRnsmcg..............................................................apartvGWRH.P..GYIH.TSYLK....D.......L..WPDS.MYT.......Y..RL...............GHRl.pNGt...............................rVWS.KS..YSFK-a..........................................
A0A0G1LBR3_9BACT/42-128                ..............................................pkdvri--------.....SN.I...T....DS..................SL..TISWI..T...D...............................K..................E.........-..TSG.......................FVKWG.KS.....A.TS.....................................L..D.KT........E.L..D.E......--....-.---.........................................................................-LKD.Q..GFTH.LLTLR....G.......L..TPQT.TYF.......F..KI...............NSG...GE.................................---.--..-----dfdnngiawqvtn..............................
B9IJI2_POPTR/70-182                    ....................................................PEQISVSL.....ST.-...T....HD..................SV..WISWI..T...G...............................Dfqigdr......ikplnpK.........T..VAS.......................VVRYG.RL.....R.IP.....................................L..I.HK........A.T..G.Y......SL....V.YNQlyp..................................................................fvglQNYT.S..GIIH.HVRLT....G.......L..KPNT.LYH.......Y..QC...............GDP...SI................................pAMS.SK..YYFKT...........................................
A0A0M9ZJU6_9ACTN/56-149                ..................................................va--GLHLQF.....GT.D...A....SR..................EV..VVSWH..T...A...............................A..................S.........V..SRP.......................RVLLG.TP.....A.GG.....................................L..G.RS........V.P..A.Q......TT....T.YRD........................................................................aKSGT.E..VQVH.HARVS....G.......L..RPDT.DYV.......Y..AA...............VHE...G-.................................AQA.EF..GTVRT...........................................
A0A0D2QJD8_GOSRA/61-152                ....................................................PQQVHITQ.....GD.H...L....GN..................AV..IVSWV..T...P...............................D..................E.........P..GSN.......................SVFYW.AE.....N.SE.....................................L..K.NS........A.Q..G.I......VL....T.YKY.........................................................................FNYT.S..GFIH.HCTVR....D.......L..EFDT.KYY.......Y..EV...............GIG...N-.................................-SS.RR..FWFVT...........................................
A0A024GVU8_9STRA/140-246               ....................................................PKQGHLSF.....TS.-...L....WN..................EM..VVMFN..S...D...............................S..................N.........A..TEP.......................MVRYG.LS.....R.EA.....................................L..D.RY........A.S..G.T......WT....T.YEAkdmchrp...........................................................ativsqwRFRN.P..GFMH.KVIMS....D.......L..HSGT.RYY.......Y..QF...............GND...VI.................................GWS.RI..GSF--is.........................................
A0A078H7F7_BRANA/178-286               ................................................pvyp----RLAL.....GK.-...E....WD..................TM..TVTWT..S...G...............................Yg................lK.........I..AEP.......................VVEWG.VK.....G.GE.....................................R..K.LS........P.A..G.T......LT....F.ARNtmcga...............................................................partvGWRD.P..GYIH.TAFLK....E.......L..WPNA.KYT.......Y..RV...............GHR..lTNd..............................afVWS.KE..YQFK-s..........................................
A6C7F2_9PLAN/41-137                    ....................................................PDRIMLTW.....KQ.D...P....AH..................TQ..SVTWR..T...D...............................T..................S.........V..TKC.......................YGEIA.VA.....E.AGpd................................fakT..A.RQ........F.K..A.E......TS....Q.LK-.........................................................................TDLG.D..CHFH.AITFT....D.......L..KPDT.LYA.......Y..RV...............GAD...D-.................................TWS.EW..MQFRT...........................................
A0A0D2SE28_GOSRA/97-209                ....................................................PEQISVSL.....SV.-...N....YD..................SV..WISWI..T...G...............................Efqignn......ikplnpN.........T..VAS.......................VVRYG.RS.....R.VP.....................................L..T.DE........A.S..G.Y......SL....V.YNQlyp..................................................................feglQNYT.S..GIIH.HVRLT....G.......L..KPST.LYY.......Y..RC...............GDP...SI................................sAMS.GI..YHFR-a..........................................
A0A151SR68_CAJCA/453-544               ....................................................PQQVHITQ.....GD.Y...D....GR..................AV..IISWV..T...P...............................D..................E.........P..GPN.......................HVQYG.TS.....E.NT.....................................F..Q.SS........A.E..A.T......VT....N.YTF.........................................................................YKYK.S..GYIH.HCLIE....G.......L..EYKT.KYY.......Y..RI...............GSG...D-.................................-SS.RE..FWFET...........................................
M7ZW23_TRIUA/161-253                   ...................................................v-NKVHISL.....SG.-...-....EK..................HM..RITWV..T...D...............................D..................N.........S..VPS.......................VVDYG.TK.....S.NT.....................................Y..T.SS........S.N..G.E......ST....S.YSY.........................................................................LMYS.S..GKIH.HVVIG....P.......L..EDNT.IYY.......Y..RC...............GGR...GS.................................---.--..-----efqlktppsqf................................
A0A078IC94_BRANA/61-152                ....................................................PQQVHITQ.....GD.V...E....GK..................AV..IVSWV..T...Q...............................E..................A.........P..GSD.......................TVLYW.KE.....N.SS.....................................K..K.LK........A.Y..G.K......SK....T.YKF.........................................................................YNYT.S..GHIH.HCTIR....N.......L..EYDT.KYY.......Y..VV...............GVG...Q-.................................TER.EF..Y----fft........................................
A0A0D2X5D2_CAPO3/144-244               ....................................................PEQIHIAV.....AG.N...N....SR..................DI..SVQWV..T...L...............................Q..................E.........V..SNA.......................SVIWG.TS.....T.NS.....................................L..T.NF........A.P..A.T......AH....P.MQ-.........................................................................IYGW.R..GVIY.RAVMT....N.......L..APAT.TYH.......Y..RV...............GSF...TD.................................---.--..-----kqfyphpagsqpdlkftt.........................
A0A0K0FU16_9BILA/79-175                ...................................................h-EQIHISL.....AK.-...D....PQ..................TM..VISWT..T...F...............................F..................Dms.....kiN..NKP.......................TVKYG.LN.....S.SN.....................................L..A.LT........E.T..G.Y......TK....I.FKH........................................................................vTGNI.T..RYFH.RVYLT....D.......L..LFDT.TYY.......Y..KV...............GDD...Q-.................................TWS.KI..FYFQT...........................................
A0A091DBW4_FUKDA/28-121                ....................................................PEHVHLSY.....PG.-...E....PG..................SM..TVTWT..T...W...............................V..................P.........-..ARS.......................EVQFG.VQ....lS.GP.....................................L..P.LR........A.Q..G.F......LT....T.FVDg.......................................................................gILKR.K..IYIH.RVTLR....K.......L..LPGV.QYI.......Y..RC...............GSA...Q-.................................GWS.RR..FRFR-a..........................................
E3NI17_CAERE/20-115                    ...................................................v-EQVHLSL.....SG.-...K....MD..................EM..VVTWL..T...Q...............................G..................Pl.......pN..VTP.......................YVTYG.LS.....K.DS.....................................L..R.WT........A.K..A.T......TT....S.WKDq.......................................................................gSHGY.I..RYTH.RATMT....K.......M..VAGD.VYY.......Y..KV...............GSS...Q-.................................DMS.DV..YHFK-q..........................................
A0A074XWF3_AURPU/33-122                ....................................................PVQQRVAF.....KG.-...-....PN..................AI..SVAWN..T...Y...............................Q..................K.........L..NEG.......................CVQYG.KS.....A.NS.....................................L..T.SQ........A.C..S.T......QS....L.T--.........................................................................YGTS.R..TWAN.TVVLS....G.......L..DAAT.TYY.......Y..KI...............NST...N-.................................--S.TV..NQFMTart........................................
A0A0B0NR04_GOSAR/59-150                ....................................................PQQVHITQ.....GD.H...V....GK..................AV..IVSWV..T...E...............................D..................E.........P..GSS.......................TVVYW.SE.....N.SK.....................................E..K.KK........A.K..G.K......FN....T.YRF.........................................................................FNYT.S..GFIH.HCTIR....N.......M..EYNT.KYY.......Y..VV...............GVD...H-.................................-TM.RK..FWFTT...........................................
L0DPB6_SINAD/41-133                    ....................................................PNTLFLTW.....QR.D...P....TT..................TM..TVQWI..A...P...............................A..................A.........D..EGA.......................TVDFA.EF.....G.KA.....................................G..A.TQ........S.V..A.T......KQ....T.--P.........................................................................YPMT.N..LRVF.RAELT....G.......L..SPGA.EYQ.......F..QI...............NKK...G-.................................---.PA..HRFRTmpaka......................................
L1M9J8_9BACT/45-136                    ....................................................PTRVLLTF.....GN.D...G....EM..................SR..NVSWM..C...D...............................T..................V.........V..HKS.......................HLELL.PE.....G.GD.....................................Q..P.IC........V.K..A.D......GE....V.FES.........................................................................-RSG.K..AAYY.VARLT....Q.......L..QDGR.CYY.......Y..RA...............VTN...G-.................................KAS.PW..YEFS-v..........................................
A0A069DLN1_9BACL/1078-1177             ....................................................PYNITVGM.....GE.D...P....TI..................SR..SFNWH..T...H...............................P..................S.........V..NET.......................VVEIA.EE.....E.GFagf...............................nqpD..V.IR........L.S..G.D......SS....L.FNT.........................................................................LDIG.T..IRVH.KASAD....V.......L..KPGT.AYV.......Y..RV...............GDG...TE.................................HYS.EQ..GSFTT...........................................
A0A0G1PKU7_9BACT/1476-1567             ........................................ttggtpsvtvga--------.....--.-...-....-A..................TA..TVTWT..T...S...............................R..................K.........-..SFG.......................SVDYG.KT.....T.GY.....................................G..S.NA........S.E..A.T......Q-....-.---.........................................................................----.-..SASH.SVKIS....G.......L..TPGE.TYH.......Y..RV...............QNL...DDsglmg.......................ysrtdAYS.AD..YSFTT...........................................
A0A0D9XA43_9ORYZ/178-275               ................................................pvyp----RLAQ.....GK.-...S....YD..................EM..TVTWT..S...G...............................Y..................Di.......sE..AYP.......................FVEWG.MV.....V.LS....................................gS..G.AA........A.T..A.P......AR....T.V--.........................................................................GWRE.P..GFIH.TAFLR....D.......L..WPNK.EYY.......Y..KI...............GHE..lSDg..............................siVWG.KQ..YTFR-a..........................................
R9AG81_WALI9/22-118                    ..........................................snsltyqqrt--------.....-A.I...A....PN..................GV..NVAFN..S...P...............................G..................Nn.......tQ..YTP.......................SVYYS.TN.....A.TN.....................................I..T.EN........A.S..G.E......SL....M.Y--.........................................................................-NTA.L..STTH.KVGLR....N.......L..TSDC.TYY.......Y..QT...............CLN..vDGe...............................cARS.EV..LSFK-s..........................................
A0A0N0A900_9ACTN/70-175                ....................................................PFGRHLAF.....GP.D...P....RT..................GM..RVSWQ..V...P...............................F..................A.........V..HRP.......................YVRLG.LR.....P.DD.....................................L..G.RR........I.A..A.E......VR....P.LHTpgv...................................................................sgvRPAL.E..QYYV.HAAAD....G.......L..TPGT.TYY.......Y..GV...............GHD...G-.................................-WD.PA..-----atahraaiasfrt..............................
A0A0D9ZFS6_9ORYZ/63-176                ....................................................PEQIAVAL.....SA.-...A....PS..................SA..WVSWV..T...G...............................Dfqmgaa......vepldpT.........A..VAS.......................VVRYG.LA.....A.DS.....................................L..V.RR........A.T..G.D......AL....V.YSQlyp..................................................................fdglLNYT.S..AIIH.HVRLQ....G.......L..EPGT.EYF.......Y..QC...............GDP...AIp...............................aAMS.DI..HAFRT...........................................
R5GK44_9BACT/27-117                    ...........................................hgpylqnvg--------.....--.-...-....ER..................EA..TLVWI..S...D...............................S..................P.........-..SVG.......................WVETA.PD.....D.GT.....................................-..H.FY........A.R..E.R......PK....T.YDTh.......................................................................iGIKR.T..GRIH.TVRLT....G.......L..EPGT.RYR.......Y..RV...............CVQ...E-.................................---.--..-----vtahkgnrvty................................
M8AZP4_TRIUA/44-135                    ..................................................kr--RVHITL.....GD.Q...T....GT..................AM..TVSWV..T...A...............................S..................E.........L..GNG.......................TVRYG.PS.....P.DK.....................................M..E.MT........A.Q..G.T......HT....R.YDY.........................................................................FNYT.S..GFIH.HCVLR....N.......L..KHGV.KYY.......Y..AM...............GFG...H-.................................-TV.RT..FSFT-a..........................................
F2UHU8_SALR5/29-118                    ...................................................v-EQIHLSL.....TG.-...M....TT..................EM..AVDFV..S...T...............................N..................S.........-..STC.......................NVLYR.PQ.....G.SS.....................................D..P.YS........H.A..A.S......TV....G.W--.........................................................................HFSE.I..GFLH.QATMK....N.......L..KHNT.RYQ.......Y..HI...............QCA...DG.................................SSS.QT..MSF--vn.........................................
M0ZWN4_SOLTU/17-108                    ....................................................PQQVYITQ.....GD.H...E....GN..................GV..IVSWT..T...T...............................D..................E.........P..GSN.......................AVLYW.VE.....N.SN.....................................V..K.SF........A.D..G.F......VV....S.YKY.........................................................................YNYT.S..GYIH.HCTIK....D.......L..EFDT.KYY.......Y..EV...............GLG...N-.................................-TT.RQ..FWFVT...........................................
E1VVZ0_GLUAR/220-311                   ....................................................PSRVILTP.....TE.T...P....ET..................SQ..YVSWL..G...G...............................I..................A........nE..ETG.......................VVEIR.ET.....A.GT.....................................E..V.RS........I.D..A.R......--....F.VDR.........................................................................VNNN.P..LPHF.SAELT....G.......L..TPAT.SYT.......Y..RV...............GNA...G-.................................SYS.PW..YTFKT...........................................
G4Q306_ACIIR/31-121                    ................................................yeir-----QIM.....TQ.D...P....ST..................SR..TLMWQ..S...Q...............................D..................E.........D..NRA.......................LAEIR.KK.....G.EK.....................................A..S.QV........V.P..A.T......SS....V.FT-.........................................................................DNGV.T..RHLH.TAMVT....G.......L..TPGT.SYE.......Y..RV...............GND...R-.................................KRS.PW..MP---let........................................
M1VGQ9_CYAM1/128-235                   ...................................................a-YHVHIGM.....TG.-...N....AG..................EV..VISYN..T...Q...............................E..................K.........P..PQS.......................CLYVA.EE.....H.TS.....................................N..Q.TK........F.C..T.E......DV....R.TTSlgsg................................................................lspflCTGW.S..GYAS.HVKVN....G.......L..QPGK.RYT.......Y..TI..............pGSP...G-.................................---.--..-----nvsytfmapygnttkt...........................
A0A026WWS0_CERBI/22-113                ....................................................PEAVHLSY.....GD.-...N....VR..................DI..VVTWS..T...K...............................N..................D.........T..EES.......................IVEYG.IG.....G.LI.....................................L..R.AE........G.N..S.T......LF....V.DGG.........................................................................EQKR.R..QYIH.RVWLK....N.......L..TPDS.KYI.......Y..HC...............GSH...H-.................................GWS.NV..FYMRT...........................................
A0A0Q6Y5Q0_9MICO/55-152                ....................................................PDRIVLTP.....SG.D...L....AR..................SQ..AVTWR..T...A...............................T..................G.........V..TTA.......................QAQLR.VA.....T.AEpy................................rsdL..T.TV........D.A..T.D......KV....Q.VDT.........................................................................SSGY.S..ELFH.TVEFA....G.......L..TPST.QYQ.......Y..RV...............GDG...T-.................................NFS.EW..QHFTT...........................................
A0A061E9V0_THECC/171-279               ...............................................pvypr-----LAQ.....GK.-...V....WN..................EM..TVTWT..S...G...............................Y..................Gi.......gE..AVP.......................FVEWS.WK.....G.GL.....................................P..I.HS........P.A..G.T......L-....T.FDSnsmcg..............................................................epamtvGWRD.P..GFIH.TSFLK....E.......L..WPNT.LYT.......Y..RL...............GHV..lSDg..............................tyVWS.QQ..YSFK-a..........................................
F8K1E0_STREN/56-149                    ..................................................ls--GVHLQF.....GA.D...A....AT..................EA..TVSWQ..T...P...............................I..................P.........V..RRP.......................RVLLG.TV.....G.DG.....................................V..G.HS........V.A..A.H......TR....T.YRD........................................................................pVTGE.E..VHAH.HARLT....G.......L..RPET.EYL.......Y..VA...............VHD...G-.................................ATP.E-..-----agtlrt.....................................
A0A024JX34_9MYCO/68-162                ..................................................vf--GLHLQF.....GR.N...A....GT..................EV..VVSWH..S...T...............................E..................A.........V..RNP.......................RVMLG.TP.....G.SG.....................................F..G.QT........V.A..A.E......TR....T.YRD........................................................................gKSNN.E..VRVN.HARLT....N.......L..TPDT.DYV.......Y..AA...............VHD...G-.................................AEP.--..-----eqgtvrta...................................
A2XIP0_ORYSI/68-155                    ....................................................PQQVHISL.....AG.-...-....EK..................HM..RVTFV..T...D...............................D..................N.........S..VPS.......................VVDYG.TE.....A.GT.....................................Y..T.ST........S.Q..G.E......ST....S.YSY.........................................................................LMYS.S..GKIH.HVVIG....P.......L..NDNT.VYY.......Y..RC...............GGH...G-.................................---.PE..FQFKT...........................................
S8DCH9_9LAMI/48-139                    ....................................................PQQVHITQ.....GD.H...E....GR..................AV..IVSWI..T...P...............................S..................E.........P..GSN.......................SVLYW.EE.....K.NL.....................................I..K.KT........A.S..G.I......IR....R.YKF.........................................................................YTYT.S..GFIH.HCNIS....D.......L..NFDT.KYY.......Y..EL...............GTG...K-.................................-TT.RQ..FWFRT...........................................
A0A0B1TSC7_OESDE/40-134                ....................................................PEQIHLSL.....GE.-...K....PS..................DM..VITWL..T...F...............................D..................D.........T..GKT.......................LVNYG.PA.....S.EK....................................kL..T.QT........M.E..G.Q......CT....E.FLDk.......................................................................qKKAK.K..RYIH.RATLT....G.......L..IPGT.MYR.......Y..RV...............GSE...Y-.................................GWS.AL..YTFK-a..........................................
A0A0K8LC31_9EURO/34-123                ....................................................PFQQRLAV.....YG.-...-....PN..................AV..SIGWN..T...Y...............................E..................K.........L..DQG.......................CVQYG.TS.....S.SA.....................................L..T.SK........A.C..S.S......SS....T.T--.........................................................................YATS.R..TYSN.VVVLT....G.......L..APAT.TYY.......Y..KI...............VSG...N-.................................--S.TV..NHF--lsprt......................................
A0A0G1HS13_9BACT/47-139                .................................................pkn---LK--I.....SN.L...N....AS..................TF..SVSWT..T...D...............................T..................P.........-..LTG.......................LIKYS.ED.....P.AK.....................................I..V.TP........A.G..D.V......RD....Q.IS-.........................................................................GTSQ.S..YNNH.TVNVS....G.......L..SPST.TYY.......F..LI...............ISG...SGt..............................ydDNS.KP..FSVRT...........................................
A0A0N0A473_9ACTN/75-180                ....................................................PFGRHLAF.....GA.D...P....KT..................QM..RISWQ..V...P...............................F..................A.........V..RKP.......................YVRVG.PT.....P.GN.....................................L..S.RR........I.D..A.E......LR....P.LHTpgl...................................................................tgiRLDL.D..QYYV.HAALD....G.......L..RPGT.TYY.......Y..GV...............GHE...GSdpa...........................thaH--.--..-----qptlatfrt..................................
D2VI40_NAEGR/49-149                    ...................................................p-LFMHLAF.....TS.-...V....PT..................EM..VVSFH..T...N...............................D..................Yde.....kiL..GKP.......................FVKYG.KE.....D.TLki.................................gaK..V.SW........I.G..A.V......IT....Q.Y-G.........................................................................DVKH.T..GYDF.NILMK....D.......L..EYQT.KYY.......Y..QV...............GFL...GS................................nVTS.GV..YNFHT...........................................
A0A0D2QJH5_GOSRA/169-277               ................................................plyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Di.......dE..AVP.......................FVEWG.RK.....G.DL.....................................Q..V.RS........P.A..G.T......-L....T.FKQnsmcg..............................................................spastvGWRD.P..GFIH.TSFLK....D.......L..WPNF.VYM.......Y..RI...............GHLl.yNGs...............................vVWS.KT..YSFK-s..........................................
B6QIV6_TALMQ/35-122                    ....................................................PFQQRLAV.....YG.-...-....PG..................AV..SVGWN..T...Y...............................A..................S.........Q..NSA.......................CVQYG.TS.....K.TN.....................................L..N.LK........S.C..S.T......SS....S.TT-.........................................................................YASS.R..TYSS.VVVLS....N.......L..APAT.TYY.......Y..KI...............VST...N-.................................--S.TV..GHF--ls.........................................
A0A0C2JJ49_THEKT/144-245               ....................................................PTQIHIAL.....TG.-...N....PD..................QL..RVSWV..S...G...............................S..................N.........-..LEP.......................CVWYG.KS.....F.ER.....................................L..D.NK........K.C..G.T......SE....T.YQAkdmce..............................................................piattrGFID.P..GFMH.SVVLT....D.......L..DNDQ.LYY.......Y..AV...............GSS...E-.................................FLS.PL..FR---tks........................................
A0A0G1Q3J8_9BACT/42-130                ................................................prdv------RV.....TN.I...S....QS..................TL..TVSWT..T...D...............................T..................Q.........-..TLG.......................TVEWG.ET.....E.NS.....................................T..G.TT........I.V..S.-......--....-.---.........................................................................-ETG.S..GYTH.SATLT....G.......L..KPQT.SYF.......F..KI...............NSA...GT.................................---.--..-----dfdnngidweaqtasd...........................
U3AS85_9CAUL/150-248                   ....................................................PDHLQLTW.....QD.D...P....RT..................GV..TVQWR..T...D...............................E..................T.........V..DES.......................LLWLA.PA.....G.DDga................................grmL..T.SR........A.D..A.L......TS....R.Q-I.........................................................................VNDP.D..IRLH.RVRLD....D.......L..TPAT.DYE.......Y..AV...............SAD...NG................................qTWT.QR..RRFRT...........................................
A0A0R3SYY7_HYMDI/18-106                ....................................................PEQIHLSL.....SG.-...E....EG..................SM..TITWT..T...L...............................Q..................E.........A..AHS.......................GVLYG.TE.....K.PE.....................................N..Y.VP........A.S..Q.K......AF....V.DGG.........................................................................EEQR.V..TYMH.TVTLK....T.......L..QPNT.SY-.......-..--...............---...--.................................---.--..-----gtklfyalmndfsaw............................
F2UJ11_SALR5/126-227                   ....................................................PEQIHLSI.....TT.-...D....IS..................EM..VVMWS..T...L...............................K..................A.........T..PHP.......................VVQYG.LS.....S.DN.....................................L..N.MT........A.N..A.T......TA....S.YT-.........................................................................SGGW.Q..GHLY.TATMT....G.......L..RPKT.TYY.......Y..RV...............GDP...TVapdy.........................wmkpAWS.QVpsL----hftt.......................................
A0A067LB35_JATCU/170-278               ............................................pvyprlaq--------.....GK.-...I....WN..................EM..TVTWT..S...G...............................H..................Gi.......dE..AEP.......................FVEWG.PK.....G.GD.....................................L..K.RS........P.A..G.T......LT....-.FSRnsmcg..............................................................epartvGWRD.P..GFIH.TSFLK....E.......L..WPNV.VYK.......Y..KV...............GHRl.fNGt...............................yIWS.QE..YQFR-s..........................................
A0A0K9QP40_SPIOL/342-433               ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...P...............................Y..................L.........H..GSH.......................TVYYG.TT.....K.GK.....................................Y..T.SK........A.K..A.T......NT....S.YSF.........................................................................NVYK.S..GQIY.HCLVD....G.......L..EYNT.KYY.......Y..RI...............GSG...P-.................................-SN.RE..FWFQT...........................................
A0A078IFS5_BRANA/60-151                ....................................................PQQVHITQ.....GN.H...E....GN..................GV..IISWV..T...P...............................S..................A.........P..CSN.......................TVRYW.SE.....N.GK.....................................S..K.KL........A.E..A.T......MN....T.YRF.........................................................................FNYT.S..GYIH.HCFID....D.......L..EFDM.KYY.......Y..EI...............GSG...K-.................................-WQ.RR..FWFFT...........................................
L8H162_ACACA/156-258                   ....................................................PMQGRLML.....TG.-...R....QN..................EM..RVMWT..T...R...............................D..................A.........-..VRP.......................QVKFG.TS.....P.GN.....................................Y..D.QS........V.G..A.A......TS....T.YRKehmcg..............................................................apanaeGWRD.P..GLLH.SAVLS....N.......L..RPDT.RYY.......Y..VY...............GDP...TF.................................GFS.AE..ASF--vs.........................................
W2Y9V2_PHYPR/67-164                    ....................................................PQQIHLAF.....AG.K..kP....GT..................AM..TVSWA..T...F...............................E..................D.........V..TDS.......................SVWVG.DY.....E.DT.....................................L..E.LV........D.T..PvS......SA....S.YYS.........................................................................DKEY.N..LFHH.HAKIT....G.......L..KPRT.KYY.......Y..KV...............GSR...GDe...............................kYTS.DV..TSFIT...........................................
A0A0W8C5X2_PHYNI/243-349               ....................................................PKHVHTAY.....GR.-...T....PG..................SL..SVQWM..T...K...............................Qf................cA.........E..GDT.......................QLKLV.EG.....Y.HAhieve..........................gpkatpV..A.AW........A.N..T.T......LF....E.DEG.........................................................................EAQS.K..RWMH.VVRLE....G.......L..KPDT.RYT.......Y..VV...............GNA...HY................................sSWS.IP..YVTKT...........................................
W5GCP3_WHEAT/63-155                    ..................................................xx--XVHISL.....SG.-...-....EK..................HM..RITWV..T...D...............................D..................N.........S..VPS.......................VVDYG.TK.....S.NT.....................................Y..T.SS........S.N..G.E......ST....S.YSY.........................................................................LMYS.S..GKIH.HVVIG....P.......L..EDNT.IYY.......Y..RC...............GGR...GS.................................---.--..-----efqlktppsqf................................
M4FFP5_BRARP/54-148                    ....................................................PEQVHITQ.....GD.H...N....GR..................GM..IISWV..T...P...............................I..................N........dD..GSN.......................VVQYW.VA.....D.GDe...................................sT..K.KS........A.E..A.S......TS....T.YRY.........................................................................YDYA.S..GFLH.HATIK....K.......L..EYST.KYF.......Y..EL...............GTG...R-.................................-ST.RR..FSFTT...........................................
A0A0W8BX37_PHYNI/201-306               ....................................................PLQVHLAL.....TQ.-...N....AD..................EM..RVKWV..S...D...............................N..................V.........-..SNP.......................VVTFG.EH.....K.SK.....................................L..D.RV........V.R..A.T......QS....S.YKAedmcnal...........................................................atvkfprHFRD.P..GQIF.DAVMT....K.......L..EAGK.RYF.......Y..QV...............GDE...NG.................................ELS.DI..LEFQ-m..........................................
M0QXC1_HUMAN/32-125                    ....................................................PEQVHLSY.....PG.-...E....PG..................SM..TVTWT..T...W...............................V..................P.........-..TRS.......................EVQFG.LQ.....P.SG....................................pL..P.LR........A.Q..G.T......FV....P.FVDg.......................................................................gILRR.K..LYIH.RVTLR....K.......L..LPGV.QYV.......Y..RC...............GSA...Q-.................................GWS.RR..FRFR-a..........................................
R6I7G2_9FIRM/45-133                    ..................................................as--AVSMSP.....GS.-...D....PS..................SM..NFTWL..S...P...............................T..................K.........D..CVV.......................MFEIA.TD.....S.SM.....................................K..N.GK........F.L..K.V......ER....T.---.........................................................................HTAL.Y..GWKN.DVTAE....N.......L..KSNT.TYY.......Y..RV...............AEN...G-.................................KWS.KT..YSFNT...........................................
A0A022QVD0_ERYGU/72-184                ....................................................PEQISVSL.....SS.-...T....FD..................SV..WISWI..T...G...............................Efqigen......vkplnpK.........T..VAS.......................VVHYG.KL.....R.FP.....................................M..T.HK........A.N..G.E......SL....V.YSQlyp..................................................................feglQNYT.S..GIIH.HVRLM....G.......L..EPST.LYY.......Y..RC...............GDP...SV................................qAMS.DI..YYFKT...........................................
V4UUP3_9ROSI/59-150                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IISWV..T...P...............................H..................E.........P..GPS.......................TVSYG.TS.....E.DK.....................................F..D.FT........A.E..G.T......VN....N.YTF.........................................................................YKYK.S..GYIH.QCLVD....G.......L..EYDT.KYY.......Y..KI...............GSG...D-.................................-SS.RE..FWFQT...........................................
K3XWN3_SETIT/55-145                    ....................................................PQQVHITQ.....GD.Y...D....GK..................AV..IVSWV..T...Q...............................E..................E.........P..GPS.......................EVFYG.KE.....K.-Q.....................................Y..D.QK........A.E..G.T......TT....N.YTF.........................................................................YDYK.S..GYIH.HCLVS....G.......L..EYNT.KYY.......Y..KI...............GNG...D-.................................-SA.RE..FWFET...........................................
B8N7N3_ASPFN/34-123                    ....................................................PYQQRLAI.....YG.-...-....PN..................AI..SVGWN..T...Y...............................E..................K.........L..NQS.......................CVQYG.TS.....K.DK.....................................L..D.AQ........A.C..S.S......TS....-.-ST.........................................................................YATS.R..TYSN.AVVLT....G.......L..TPAT.TYY.......Y..KI...............VST...N-.................................--S.TV..D----qflsprs....................................
W7MWA6_GIBM7/76-178                    ..........................................lsyipaqngg--------.....--.-...D....TV..................GI..NIHYQ..T...P...............................F..................G........lG..QAP.......................LVNWG.TS.....A.SY.....................................L..N.NV........A.I..G.S......TA....T.YDRtppc.................................................................slvhMTQC.S..QFFH.NVQIE....H.......L..QPGT.TYF.......Y..QI...............PAA...NG................................tTES.TV..LSFTT...........................................
A0A0F0HUV3_9PSEU/52-145                ...................................................v-SGLHLQF.....GT.D...P....SA..................EM..TVSWI..T...P...............................Q..................S.........V..GRP.......................QVRLG.SP.....E.GG.....................................F..G.RA........F.D..A.G......TR....T.YRD........................................................................gLSGE.E..VYVH.HCRLA....G.......L..RPAT.TYL.......Y..AA...............VHD...G-.................................AVP.ET..GSFTT...........................................
G0T437_SOYBN/145-251                   ....................................................PQQIHLAF.....VG.A...Hg..kEE..................DM..RVMYI..T...R...............................D..................P.........-..RET.......................YVRYG.ER.....E.DK.....................................L..D.GI........A.V..A.R......VE....R.YERehmcda.............................................................pantsvGWRD.P..GFIH.DAVLI....G.......L..KKGQ.RYY.......Y..KV...............GND...NG.................................GWS.AT..QSFV-s..........................................
A0A0F7U1T8_9EURO/34-122                ....................................................PFQQRLAV.....YG.-...-....AN..................AV..SVGWN..T...Y...............................E..................Q.........L..NKS.......................CVAYG.TS.....A.DS.....................................L..T.SS........A.C..S.T......TS....S.--T.........................................................................YATS.R..TWSN.YAVLT....G.......L..TPAT.TYY.......Y..KI...............VSG...N-.................................--S.SV..DHF--lspr.......................................
A0A0E0JPF2_ORYPU/62-153                ....................................................PQQVHITQ.....GN.H...D....GT..................AM..IISWV..T...T...............................I..................E.........P..GSS.......................TVLYG.TS.....E.DN.....................................L..N.FS........A.D..G.K......QT....Q.YTF.........................................................................YNYT.S..GYIH.HCTIK....K.......L..EFDT.KYY.......Y..AV...............GIG...Q-.................................-TV.RK..FWFRT...........................................
A0A151TVS7_CAJCA/1-76                  ....................................................--------.....--.-...-....--..................-M..RISWI..T...G...............................S..................P.........-..TPA.......................KVSYG.PS.....P.SA.....................................N..A.ES........A.T..G.N......TS....S.YHF.........................................................................LLYE.S..GQIH.EVVIG....P.......L..NPNT.VYY.......Y..RL...............GDQ...P-.................................-SS.QT..RQFKT...........................................
A0A0E0Q3A6_ORYRU/142-247               ....................................................PDQVHLSF.....AD.-...G....VD..................EM..RVMFV..C...G...............................D..................G.........-..GRR.......................VVRYG.PA.....K.EEg...................................eG..W.KE........V.A..A.E......VR....T.YEQkhmcds.............................................................panssvGWRD.P..GFVF.DGLMK....G.......L..EPGR.RYF.......Y..KV...............GSN...SS.................................GWS.DT..YSF--is.........................................
H3EWH7_PRIPA/49-144                    ....................................................PEQVHLSW.....AG.-...-....LN..................AY..WVTWM..T...F...............................D..................D.........V..LEA.......................TVQYG.NT.....K.EGr...................................sL..G.RS........V.K..G.T......IS....F.FKD.........................................................................-GKK.S..RYVS.RVKIVldgdE.......D..KPGD.IYR.......Y..RV...............GSH...R-.................................GWS.SI..YEFR-f..........................................
A0A0Q4Q9G0_9BACL/599-705               ....................................................PQYVQTYV.....TE.D...M....SS..................QL..SAAWQ..T...K...............................P..................D.........Q..TST.......................YIQYI.EA.....S.DWgtges..........................pdfnhvK..Q.QH........A.E..S.E......--....-.--Lqvls.................................................................mkenGTKG.E..IRFH.NILIE....G.......L..KADT.AYK.......Y..RV...............GYE...G-.................................NWS.EW..HEYST...........................................
R9P097_PSEHS/34-120                    ....................................................PTQTRLSF.....KE.-...-....LN..................AV..SVAWN..T...Y...............................Q..................K.........I..DKP.......................CVAYG.TS.....A.NS.....................................L..T.KR........A.C..S.S......TS....-.-DT.........................................................................YPTS.R..TWFN.NVVLN....N.......L..ASNT.KYF.......Y..KI...............DST...N-.................................--S.TT..QSFT-s..........................................
J2K5M6_9ACTN/86-191                    ....................................................PFGRHLAF.....GA.D...P....RS..................QL..RVSWQ..V...P...............................L..................A.........V..RRP.......................YVRVG.LQ.....P.WD.....................................L..G.RK........I.E..A.E......VR....P.LHTpsl...................................................................sakLPAV.Q..QYYL.HAALD....G.......L..QPGT.TYY.......Y..GV...............GHD...GFdpa...........................gprHVA.TV..GTFRT...........................................
A0A059W8M0_STRA9/91-196                ....................................................PFGRHLAF.....GA.D...P....RS..................QM..RIGWQ..V...P...............................F..................A.........V..KRP.......................YLRVG.VK.....P.WD.....................................L..G.RK........V.P..A.E......VR....H.LHTpsl...................................................................sakLPAV.D..QFYL.HAALD....G.......L..RPGT.TYY.......Y..GV...............GHD...GFdpa...........................dprHFS.TV..GTFRT...........................................
A0A067Q9A0_9HOMO/40-127                ....................................................PFQVRLAY.....AG.-...-....ST..................GM..HVSWN..T...Y...............................Y..................P.........L..EEP.......................TVLYG.FF.....P.NA.....................................L..H.FS........A.S..S.T......TS....V.T--.........................................................................YPTS.L..TFNN.HVKIT....G.......L..EPDT.VYY.......Y..RL..............vGSQ...E-.................................--G.EI..LSFRT...........................................
F0XDX6_GROCL/33-122                    ..................................................pv--QQRIAV.....NG.-...-....AS..................SI..SVGWN..T...Y...............................E..................T.........L..SQA.......................CVQYG.LA.....A.DA.....................................L..T.LE........A.C..S.N......TS....T.T--.........................................................................YATS.R..TYSH.AVSLP....N.......L..KTAT.TYY.......Y..KI...............VST...N-.................................--S.TV..EQF--msprq......................................
A0A0G1EBW3_9BACT/48-137                ...................................................p-EQVRITN.....I-.-...T....DA..................GF..SVSWI..T...G...............................R..................E.........-..TTG.......................SIKFG.EK.....I.NE.....................................L..K.QP........A.L..D.D......RD....Q.LS-.........................................................................GGKA.A..VEVH.HVTLK....N.......L..LPTT.KYY.......F..KI...............ESG...GK.................................---.--..-----qfdnkgkpfe.................................
Q0J0L3_ORYSJ/186-294                   ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Di.......kE..AYP.......................FVEWG.MK.....W.SP.....................................P..T.RT........A.A..G.T......V-....T.FDReslcg..............................................................epartvGWRD.P..GFIH.TAFLT....D.......L..WPNK.EYY.......Y..KI...............GHMl.pDGk...............................iVWG.KF..YSFK-a..........................................
A0A0E0P3W8_ORYRU/63-176                ....................................................PEQIAVAL.....SA.-...A....PS..................SA..WVSWV..T...G...............................Dfqmgaa......vepldpT.........A..VAS.......................VVRYG.LA.....A.DS.....................................L..V.RR........A.T..G.D......AL....V.YSQlyp..................................................................fdglLNYT.S..AIIH.HVRLQ....G.......L..EPGT.EYF.......Y..QC...............GDP...AIp...............................aAMS.DI..HAFRT...........................................
A0A024UTB7_9STRA/1-86                  ....................................................--------.....--.-...-....--..................-M..TVTWT..T...R...............................Q..................A.........V..EGP.......................QVWFA.LA.....N.QTra................................slnD..M.QV........V.L..A.S......TK....V.YYS.........................................................................EGDY.S..LFNH.YATLP....G.......L..LPHK.RYD.......Y..IV...............GSK...NPn...............................tVTS.TR..HTFTT...........................................
V4U3L0_9ROSI/78-189                    ....................................................PEQIALAI.....SS.-...-....PT..................SM..WVSWV..S...G...............................Daqigsn......vtpldpS.........T..VAS.......................DVWYG.KQ.....S.GK.....................................Y..T.SK........R.G..G.N......AT....V.YSQlyp..................................................................fkglLNYT.S..GIIH.HVKID....G.......L..DPGT.KYY.......Y..KC...............GDS...KI................................pAMS.AE..HVFET...........................................
D7MGL9_ARALL/172-280                   ................................................plyp----RLAL.....GK.-...N....WD..................EM..TVTWT..S...G...............................Y..................Ni.......dE..AVP.......................FIEWS.AK.....G.LP.....................................A..R.RS........P.-..A.G......TL....T.FNRnsmcg..............................................................npargvGWRD.P..GFFH.TSFLK....E.......L..WPNR.EYT.......Y..RL...............GHDl.vNGs...............................tIWS.KN..YTFV-s..........................................
F9WZK8_ZYMTI/29-115                    ....................................................PVQQRLAY.....AG.-...-....PD..................SM..SVGWN..T...Y...............................A..................R.........Q..DQS.......................CVTYG.TS.....S.SS.....................................L..P.WQ........A.C..S.S......NS....Q.T--.........................................................................YATS.R..TWYN.TVTLT....G.......L..KPAT.TYY.......Y..KI...............VSG...N-.................................--S.SV..EHF--vs.........................................
A0A0Q5QBT8_9FLAO/21-110                ................................................lvpy-------L.....QN.P...T....PN..................SI..IVNWK..T...S...............................S..................N.........-..NET.......................TVYYG.TS.....A.AN.....................................L..S.VT........V.T..G.T......TN....I.FSD.........................................................................TGYNnN..YYYH.TAKIT....N.......L..QPNT.KYY.......Y..KV...............KTG...T-.................................VES.SV..YNFRT...........................................
R5K5D4_9CLOT/235-329                   ..................................................qk--NISWTV.....GK.-...D....AS..................EI..NVTWY..A...D...............................V..................D.........-..GTG.......................TLLVA.KN.....S.EV.....................................S..G.NE........M.P..A.D......AK....S.FTAng.....................................................................taSNKS.G..YYNY.QTTAT....G.......L..SADT.TYA.......Y..QL...............VNG...E-.................................TKS.EI..RAFTT...........................................
A0A0P0NI43_9SPHI/33-131                ....................................................PDRVILTW.....TG.N...P....EI..................SQ..TVTWR..T...D...............................T..................T.........I..NAA.......................KAQIK.AE.....D.SS.....................................P..A.LE........E.-..-.S......IT....N.YDAgsrv.................................................................lsggNNYA.T..AKYH.QVTFN....N.......L..KPGT.VYA.......Y..RV...............GAG...E-.................................HWS.EW..FQFTT...........................................
A0A0K1JDW6_9MICO/67-160                ...................................................v-DGLHLQF.....GA.D...A....AT..................EV..VASWH..T...L...............................Q..................P.........V..QHP.......................RVFLG.DS.....R.GT.....................................F..E.RT........A.A..A.T......TV....S.YVD........................................................................aKSGR.T..VYAH.HAPLR....R.......L..RPSN.AYL.......Y..AA...............LHD...G-.................................AAP.QF..GEFTT...........................................
D7B7A3_NOCDD/36-123                    ....................................................PERVILSP.....TA.D...P....AT..................SQ..TLAWR..S...D...............................G..................S.........-..GSP.......................VMQIA.PA.....A.DP....................................gR..V.TT........V.E..G.A......D-....-.---.........................................................................TGSA.S..GTFH.AATAT....G.......L..TPDT.AYR.......Y..RV...............GDG...T-.................................AFS.PW..RTFTT...........................................
M4DJP3_BRARP/143-246                   ....................................................PEQIHLAF.....ED.-...G....VN..................GM..RVTFV..A...G...............................D..................G.........-..EER.......................FVRYG.ER.....K.ER.....................................L..G.NS........A.P..A.R......GV....R.YERehmcna.............................................................pantsiGWRD.P..GWIF.DAVMN....N.......L..NGGV.KYY.......Y..QV...............GSD...SK.................................GWS.EI..HSF--ia.........................................
A0A0N1EDF9_9SPHN/25-125                ....................................................PERVILNL.....TA.D...P....AT..................GM..AVTWR..S...A...............................P..................G.........-..LPG.......................QVQYA.KA.....T.SS.....................................P..D.FV........K.A..P.L......TV....A.ANTddat................................................................lpvreDPAF.R..AAYH.SAVLT....G.......L..EPDT.VYA.......Y..RV...............GDG...A-.................................HWS.EW..FQFRT...........................................
A0A0G0QRS9_9BACT/174-263               ...............................................pvisd-----LTA.....KS.L...K....PR..................QA..TISWT..T...D...............................T..................R.........-..ATS.......................SVWYG.TT.....S.PL.....................................D..T.SK........L.P..V.I......FR....-.---.........................................................................--PA.K..ILNH.KINLS....R.......L..EPNT.KYY.......V..IV...............ASS...NGd..............................gmTKS.SE..ISFTT...........................................
M0WRY8_HORVD/175-288                   .................................................pvf---PRLAQ.....GK.-...T....HD..................EM..TVTWT..S...G...............................Y..................Di.......dE..AYP.......................LVEWG.MV.....T.TGgg.................................atN..P.TR........T.P..A.G......TL....T.FNRgsmcs..............................................................epartvGWRD.P..GFIH.TAFMR....D.......L..WPNK.EYF.......Y..KI...............GHE..lSDg..............................tvVWG.KP..YTFR-a..........................................
A0A0G0BNC0_9BACT/308-396               .................................................vss-----VQV.....TN.L...T....DT..................GF..TVLWV..S...A...............................Q..................K.........-..EAG.......................SINYG.TS.....S.SS.....................................L..S.SE........A.L..D.E......RD....G.--A.........................................................................TNRG.T..YYIH.SVSVT....M.......V..QPET.KYY.......F..KV...............KSG...GA.................................QYS.NT..FDVTT...........................................
K3ZRC8_SETIT/150-254                   ....................................................PEQVHLAF.....AD.-...A....VD..................EM..RVMFL..C...N...............................D..................A.........-..GKR.......................VVRYG.LE.....E.EE.....................................K..N.WT........E.V..G.T......EV...rT.YEQkhmcdw.............................................................panssvAWRD.P..GFVF.DGLMK....G.......L..EPGR.KYF.......Y..KV...............GSD...TG.................................GWS.KT..YSF--is.........................................
R6HZQ0_9FIRM/49-138                    .................................................ntl---IALTP.....GA.-...D....AT..................QL..NFCWH..S...D...............................D..................T.........A..KSG.......................VVRIG.KS.....A.DM.....................................T..S.FK.......eF.V..G.K......AS....T.---.........................................................................DSYT.G..QSVY.KVTAT....G.......L..EPNT.VYY.......Y..TY...............GSN...G-.................................KFS.SP..VMYR-t..........................................
J3NEE6_ORYBR/164-272                   ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Di.......kE..AVP.......................FVEWG.VK.....G.GR.....................................R..F.LS........P.A..-.G......TL....T.FDRnsmcg..............................................................apartvGWRH.P..GYIH.TSYLK....D.......L..WPDS.LYT.......Y..RL...............GHRl.pNGt...............................qIWS.NS..YSFK-a..........................................
Q93XG4_SOYBN/72-184                    ....................................................PEQISVSL.....ST.-...S....HD..................SV..WISWV..T...G...............................Efqigld......ikpldpK.........T..VSS.......................VVQYG.TS.....R.FE.....................................L..V.HE........A.R..G.Q......SL....I.YNQlyp..................................................................feglQNYT.S..GIIH.HVQLK....G.......L..EPST.LYY.......Y..QC...............GDP...SL................................qAMS.DI..YYFRT...........................................
R6VQY0_9BACT/287-387                   ..................................................tt--QPYLQL.....AT.-...-....KT..................SM..NVMFQ..T...N...............................C..................V.........-..GHC.......................WIEYG.TD.....T.LN.....................................T..R.R-........A.R..A.-......--....L.MDG.........................................................................QEVC.Y..DIEN.NIKLD....H.......L..QPGT.RYY.......Y..RV...............CVQ...EIlhksaya...................nhfggdtLRT.RF..YSFR-t..........................................
D7LG89_ARALL/60-151                    ....................................................PQQVHLTQ.....GN.H...E....GN..................GV..IISWV..T...P...............................V..................K.........P..GSN.......................TVHYW.SE.....N.EK.....................................S..K.KQ........A.E..G.T......VN....T.YRF.........................................................................FNYT.S..GYIH.HCLIN....D.......L..KFDT.KYY.......Y..EI...............GSG...R-.................................-WS.RR..FWFFT...........................................
C9RL59_FIBSS/785-865                   ............................................kgvticqv--------.....--.-...D....HR..................SA..KIYWW..S...T...............................D..................R.........-..LNG.......................VVNYG.KA.....K.GA.....................................Y..T.ET........Q.N..A.S......GS....-.---.........................................................................----.A..VLFH.EAELT....G.......L..EAGT.TYY.......F..TV...............SSG...A-.................................KTS.EE..YSFTT...........................................
F0ZSZ8_DICPU/136-240                   .................................................pgk---SYLSI.....TK.-...N....SS..................EM..RLMWV..S...G...............................T..................D.........-..DTP.......................IVMYG.ID.....S.NL....................................kT..Y.EK........A.K..G.T......SS....T.YSImdmcsy.............................................................panstdYFKN.P..GYIH.NTVMV....N.......L..LPNT.VYY.......Y..SF...............GSD...ND.................................GWS.LI..QSFIT...........................................
A0A0L8H6Z1_OCTBM/1-84                  ...................................................m--------.....--.-...-....--..................--..---WS..S...V...............................V..................N.........-..CSS.......................SVKYG.DT.....M.WN.....................................K..N.YK........A.E..P.T......TV....F.FNL.........................................................................TNSLaR..HYYY.HAVLK....N.......L..KPNA.TYY.......Y..SI...............VNS...K-.................................-MV.TP..AYFKTppkgnewsps.................................
A0A090DV63_9CHLA/31-119                ..................................................pi--GLWLSW.....HK.D...P....ST..................TM..NIKWL..T...K...............................K..................E.........D..RNS.......................HLEYR.EV.....N.KL.....................................I..W.KG........A.L..V.Q......EI....K.M--.........................................................................PYDL.P..YVIH.YVEIK....G.......L..TPNT.VYE.......F..TI...............DDK...E-.................................---.--..-----tylfktlp...................................
U7DZC7_POPTR/63-154                    ....................................................PQQVHITQ.....GD.Y...N....GK..................AV..IISWV..T...P...............................D..................E.........P..GTS.......................KVQYG.VS.....K.KN.....................................Y..D.FT........A.E..G.A......VR....N.YTF.........................................................................YNYT.S..GYIH.QCLVD....G.......L..EYDT.KYY.......Y..KI...............GNG...D-.................................-SY.RE..FWFQT...........................................
A0A0A1MJW3_9FUNG/59-160                ....................................................PQQIHMSL.....AD.-...D....SK..................FA..RVQFA..T...L...............................D..................S.........I..DSS.......................VLAYW.PK.....K.QGnh.................................aqK..N.TT........A.T..G.K......DW....T.FVDg.......................................................................gSAQR.Q..LYLH.NIQTK....T.......L..KPDT.IYV.......Y..QV...............GAK...KGn..............................siKWS.KT..YEFHT...........................................
A2YHH3_ORYSI/142-247                   ....................................................PDQVHLSF.....AD.-...G....VD..................EM..RVMFV..C...G...............................D..................G.........-..GRR.......................VVRYG.PA.....K.EEg...................................eG..W.KE........V.A..A.E......VR....T.YEQkhmcds.............................................................panssvGWRD.P..GFVF.DGLMK....G.......L..EPGR.RYF.......Y..KV...............GSN...SS.................................GWS.DT..YSF--is.........................................
A0A176VGE7_MARPO/220-319               ................................................plyg----HISS.....ID.S...T....GT..................SM..RLTWI..S...G...............................D..................A.........-..APQ.......................TVQYA.DG.....S.TA.....................................T..S.TV........G.T..F.T......KS....N.MCEpsa..................................................................asdfGWHD.P..GFIH.TAVMT....G.......L..SPST.QYS.......Y..QY...............GSQ...AV.................................GLS.PS..TNFST...........................................
D7LB83_ARALL/54-148                    ....................................................PEQVHITQ.....GD.H...S....GR..................GM..IISWV..T...P...............................L..................N........eD..GSN.......................VVTYW.IA.....G.GDg...................................tD..N.KS........A.I..A.T......TS....S.YRY.........................................................................FDYT.S..NYLH.HATIK....G.......L..EYET.KYF.......Y..EL...............GTG...R-.................................-ST.RQ..FNFM-t..........................................
A0A059ADB7_EUCGR/219-322               ................................................plyg----HLSS.....ID.S...T....GT..................SM..RITWV..S...G...............................D..................K.........-..EPQ.......................EVQYG.DG.....K.SQ.....................................T..S.EV........S.T..F.S......QD....D.MCTgnvlh..............................................................spakdfGWHD.P..GYIH.SAVMT....G.......L..QPST.SYP.......Y..KY...............GSD...SA.................................GWS.QQ..VQFRT...........................................
I2JMH5_9GAMM/74-173                    ....................................................PRGLHASL.....VG.D...S....HT..................SR..TVTWF..T...D...............................G..................E.........-..-DA.......................PVSYL.EY.....S.SFvlglde........................faiqdeaF..E.FS........V.E..A.S......TS....Q.---.........................................................................TTGT.E..SFTH.RASAE....G.......I..DPDR.PLR.......Y..RV...............GSD...DG.................................GWS.AV..Y----vl.........................................
B0WRM8_CULQU/25-116                    ....................................................PEQVHLSF.....GE.-...S....TN..................EI..VVTWS..T...F...............................S..................P.........T..NES.......................VVEYG.IG.....G.LV.....................................L..S.ET........G.T..E.I......KF....V.DGG.........................................................................PQRH.T..QYIH.RVVLR....D.......L..QPSS.RYE.......Y..HC...............GSK...V-.................................GWS.AE..FYFHT...........................................
B4GTD5_DROPE/4-87                      .................................................svl--------.....--.-...-....--..................DM..VVTWN..T...R...............................D..................N.........T..NES.......................ICEFG.IE.....G.LQ.....................................R..L.AK........A.P..Q.G......PT....A.FVDg.......................................................................gPKKA.T..QYIH.RVTLT....N.......L..EPNS.TYR.......Y..HC...............GSQ...L-.................................GWS.AT..YWFRT...........................................
A0A151TVN7_CAJCA/44-131                ....................................................PQQVHISL.....VG.-...-....KE..................KM..RVSWI..T...E...............................E..................K.........Q..AES.......................VVEYG.TK.....S.GE.....................................Y..S.AK........A.T..G.E......HT....S.YQY.........................................................................FFYT.S..GQIH.NVVIG....P.......L..QPST.TYY.......Y..RC...............SAS...G-.................................---.PE..FSFKT...........................................
K4BSC3_SOLLC/64-176                    ....................................................PEQIALAL.....ST.-...N....SS..................SM..WISWI..T...G...............................Eaqigln......vtphdpE.........T..VAS.......................EVWYG.KE.....S.GK.....................................Y..T.MK........Q.N..G.V......SV....V.YSQlyp..................................................................feglWNYS.S..GIIH.HVKID....G.......L..EPET.KYY.......Y..KC...............GDS...SL................................aAMS.DE..LEFET...........................................
H3GR12_PHYRM/205-310                   ....................................................PLQIHLAL.....TG.-...N....AD..................EM..RVKWV..S...D...............................N..................V.........-..TDP.......................VVIFG.KE.....K.EK.....................................L..E.RV........E.R..A.T......QS....S.YTTedmcngp...........................................................attvfprNYRD.P..GQIF.DTVMT....K.......L..EAGE.TYF.......Y..KV...............GNQ...KG.................................DMS.DV..LEFR-m..........................................
A0A0D2U273_GOSRA/47-139                ....................................................PHQVHISL.....AG.-...-....EN..................HM..RISWI..T...D...............................D..................N.........S..APS.......................IVEYG.TL.....P.GQ.....................................Y..T.LS........S.S..G.E......TA....S.YNY.........................................................................LFYS.S..GKIH.HTVIG....P.......L..EHDT.IYF.......Y..RC...............GGQ...G-.................................---.--..-----pefqlktppgqf...............................
A0A0E0MNX6_ORYPU/864-972               ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Si.......kE..AIP.......................FVEWG.HI.....G.GN.....................................Q..M.LS........P.A..G.T......L-....T.FSRnsmcg..............................................................spartvGWRD.P..GYIH.TSFLK....E.......L..WPDS.LYT.......Y..RL...............GHRl.lDGt...............................hIWS.KS..YSFR-a..........................................
K3WND8_PYTUL/77-174                    ....................................................PQQLHLAF.....AE.W...P...aGS..................GM..TISWT..T...F...............................V..................Q.........V..DDP.......................KVWIG.AT.....Q.AE.....................................L.vL.AD........A.A..I.E......TK....S.YYS.........................................................................DKRY.S..LYNY.HATVR....G.......L..SAST.KYF.......Y..KV...............GST...ASp...............................eWQS.DV..ASFVT...........................................
A0A0G2ZXQ7_9DELT/229-312               ................................................sgmt------AV.....AG.-...-....PT..................SA..DIGWT..T...D...............................E..................P.........-..ASS.......................QVEYG.TS.....S.AL.....................................G..S.AT........G.V..-.-......--....-.---.........................................................................-DPA.R..TTSH.GVSLT....G.......L..QPNR.TYF.......Y..RV...............RSV...DAsg.............................naGVS.QV..LSFST...........................................
I7Z876_9GAMM/70-168                    ....................................................PRGLHASW.....ID.D...P....TS..................TR..TLTWF..T...D...............................G..................T........rA..PDS.......................YLEYG.PV.....E.NG.....................................M..N.DT........D.I..A.Sap..fpQ-....-.--Rtla..................................................................srqaTYGV.E..AITH.TATAT....N.......L..APDK.AVR.......Y..RV...............GSA...E-.................................GWS.AV..H----vl.........................................
I1R7G6_ORYGL/120-228                   ................................................pvyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Si.......kE..AIP.......................FVEWG.HK.....G.GN.....................................Q..M.LS........P.A..G.T......L-....T.FSRnsmcg..............................................................spartvGWRD.P..GYIH.TSFLK....E.......L..WPDS.LYT.......Y..RL...............GHRl.lDGt...............................hIWS.KS..YSFR-a..........................................
A0A087ZWE4_APIME/25-116                ....................................................PEAVHLAY.....GD.-...N....IH..................DI..VVTWN..T...K...............................N..................N.........T..QES.......................IVEYG.IN.....G.LI.....................................L..T.AT........G.N..S.T......LF....V.DGG.........................................................................NEKQ.K..QYIH.RVWLK....N.......L..TPNT.KYI.......Y..HC...............GSK...Y-.................................GWS.NI..FYLKT...........................................
S8ED44_9LAMI/169-278                   ................................................plyp----RLAQ.....GK.-...S....WN..................EM..TVTWT..S...G...............................Y..................Ni.......dE..AVP.......................FVEWG.AA.....G.GH.....................................S..R.AR........S.P..A.G......TL....T.FSRssmcg..............................................................aparsiGWRD.P..GFIH.TSFLK....D.......L..WPRK.RYT.......Y..KI...............GHLl.sNGs...............................yVWG.KE..HSFR-s..........................................
A0A0D3GLH5_9ORYZ/142-247               ....................................................PDQVHLSF.....AD.-...G....VD..................EM..RVMFV..C...G...............................D..................G.........-..GRR.......................VVRYG.PA.....K.EEg...................................eG..W.KE........V.A..A.E......VR....T.YEQkhmcds.............................................................panssvGWRD.P..GFVF.DGLMK....G.......L..EPGR.RYF.......Y..KV...............GSN...SS.................................GWS.DT..YSF--is.........................................
A0A059LNF5_9CHLO/20-133                ....................................................PQQVKVIY.....YG.-...-....DR..................SV..LVTWS..T...G...............................Y..................S.........Q..EGPrtlepl..........pscsncaAVQLG.DA.....R.GE.....................................Y..T.QT........I.H..G.E......TV....T.YDQlywg.................................................................fpeaTNYT.S..PYIH.RALIE....D.......V..GSTS.TIY.......Y..RV...............GNP..aKD.................................TWS.AE..YSFS-l..........................................
C9Z590_STRSW/80-185                    ....................................................PFGRHLAF.....GG.D...P....RT..................QM..RISWQ..V...P...............................L..................A.........V..RKP.......................YVRVG.LR.....P.EE.....................................L..S.RK........I.D..A.E......VR....D.LHTpgv...................................................................egvRLEL.E..QYYL.HAALD....G.......L..RPGT.TYY.......Y..GV...............GHE...GFdpa...........................apaHRS.TI..GTFRT...........................................
A0A0X8E2Z2_9MICO/240-331               ....................................................PTRVILTP.....TT.T...P....ET..................SQ..SFSWL..A...G...............................D..................A........gH..ASG.......................QVQLR.PA.....S.GG.....................................D..T.RT........V.D..A.Y......QA....G.L--.........................................................................VNNN.P..KPHY.SATVT....G.......L..APAT.AYS.......Y..RV...............GLE...G-.................................SRS.EW..KTFTT...........................................
D4YMS9_9MICO/37-133                    ................................................iynl----GLQV.....GD.-...R....NT..................DR..AFTWY..T...K...............................K..................V.........-..GKQ.......................SVKIA.PA.....K.DL.....................................V..R.GK........I.P..E.D......AR....R.VNEek....................................................................sgvSIDR.A..RLFH.QAHVT....G.......L..KENT.TYA.......Y..QV...............GSD...KN.................................GWS.DV..YTFST...........................................
F4PNQ9_DICFS/30-186                    ....................................................PYHIHLAL.....GD.-...D....PQ..................DI..VVSWL..T...K...............................A..................K.........V..PMP.......................TVYYY.QG.....S.CDdvqenlkniqkhpispmgskllateeitsvdansdilL..T.NN........N.H..N.N......QQ....Q.YSTnqiksfk..........................................................matgttttYFGL.D..AYIH.SVQLT....L.......L..SSGK.PYC.......Y..RV...............GGE...KSmltss......................gskypsSWSnTW..YSFKT...........................................
F0ZBD4_DICPU/23-119                    ....................................................PFSIKLAF.....TK.-...E....RD..................SF..RVTWW..T...K...............................D..................K.........M..KSP.......................VALYS.TEmf.tpE.KD.....................................S..S.FA........V.L..G.Q......VD....N.YD-.........................................................................TIGY.H..GHPT.TAVLN....N.......L..AEST.TYF.......Y..CV...............GDK..sEG.................................VYS.EV..FNFTT...........................................
A0A0B2AF13_9MICC/64-157                ...................................................v-DGLHLQF.....GS.D...A....SS..................VI..VVSWH..T...L...............................Q..................P.........V..ADA.......................RVLLG.DG.....H.GN.....................................F..T.AA........V.G..A.A......TK....S.YVD........................................................................dKSGR.T..VYTH.HATLT....G.......L..QAST.GYL.......Y..AA...............IHA...G-.................................ATP.EF..GTFTT...........................................
A0A0K9PXA7_ZOSMR/51-142                ....................................................PQQVHITQ.....GD.H...D....GK..................GL..IVSWV..T...P...............................S..................D.........A..GSS.......................AVRFG.VE.....E.KK.....................................L..D.QV........A.I..G.K......VL....R.YKY.........................................................................CNYT.S..GFIH.HCTLK....E.......L..KHNT.MYF.......Y..EI...............GDG...N-.................................-ST.RK..FHFI-t..........................................
A0A1B6QJQ7_SORBI/108-195               ....................................................PQQVHISL.....AG.-...-....EK..................HM..RITWI..T...D...............................D..................N.........S..VPS.......................VVDYG.TK.....E.GA.....................................Y..T.MK........S.Q..G.E......ST....S.YSY.........................................................................LLYS.S..GKIH.HVVVG....P.......L..EDNT.IYY.......Y..RC...............GGQ...G-.................................---.PE..FQFKT...........................................
A0A0D3H2H5_9ORYZ/177-288               ................................................pvyp----RLAQ.....GK.-...S....YD..................EM..TVTWT..S...G...............................Y..................Di.......sE..AYP.......................FVEWG.MV.....V.AGa..................................aaP..T.RT........A.A..G.T......-L....T.FNRgsmcg..............................................................epartvGWRD.P..GFIH.TAFLR....D.......L..WPNK.EYY.......Y..KI...............GHE..lSDg..............................siVWG.KQ..YTFR-a..........................................
A0A059D7Z9_EUCGR/145-247               ....................................................PEQVHLSY.....TD.-...R....ED..................EM..RVMFV..A...E...............................D..................G.........-..GRR.......................YVRYG.KR.....E.GK.....................................M..G.EL........A.T..A.R......AG....R.YERddmcda.............................................................pandsvGWRD.P..GWIH.DAVMM....N.......L..KGGV.RYY.......Y..QV...............GSD...SG.................................GWS.ET..YSF--m..........................................
F6UAF3_ORNAN/34-110                    ....................................................PEQVHLSF.....QG.-...E....PG..................SM..TVTWT..T...W...............................V..................A.........-..TDS.......................EVQFG.LE.....P.GE....................................iL..P.AR........V.R..G.T......CS....P.FVDg.......................................................................gILRR.T..LFMH.RVVLR....G.......L..TPGV.RY-.......-..--...............---...--.................................---.--..-----g..........................................
T1MCA0_TRIUA/171-300                   .................................................pvf---PRLAQ.....GK.-...T....HD..................EM..AVTWT..S...G...............................Y..................Di.......gE..AYP.......................FVEWG.VV.....A.SGgnpprppaga.................ptwcvaapggN..P.TR........T.P..A.G......TL....T.FTRgsmcg..............................................................epartvGWRD.P..GFIH.TAFMR....G.......L..WPNK.EYL.......Y..KI...............GHE..lSDg..............................tvVWG.RS..YTFR-a..........................................
E1WXV8_HALMS/30-125                    ...................................................v-SKVRLTW.....SE.N...P....ST..................TM..KIIWD..T...K...............................S..................E.........N.gKDQ.......................VLFYD.TI.....D.HG.....................................D..D.FY........A.Y..R.N......KV....K.VQK........................................................................lTLYK.S..MFNA.VVHLR....E.......L..TPNT.KYY.......F..II...............RAT...DG.................................KLS.KR..YWFKT...........................................
A0A0J8BZ70_BETVU/57-143                ....................................................PQQVHVSL.....VG.-...-....ND..................RM..RVTWI..T...E...............................G..................M.........-..EAS.......................IVEYG.TN.....S.GK.....................................Y..E.SS........A.K..G.D......HK....T.YHY.........................................................................FLYS.S..GRIH.NVVIG....P.......L..KPST.TYY.......Y..RC...............SKK...G-.................................---.PE..LSFRT...........................................
D8RZB9_SELML/170-283                   ................................................plyp----RLAQ.....GQ.-...S....WN..................EM..TVTWT..S...G...............................Y..................Rt.......sE..AIP.......................FVSYE.VA.....D.HIal.................................hkI..P.SF........S.P..A.S......TL....S.LSRgdmcg..............................................................ppastvGWRD.P..GQIH.TGSMK....D.......L..LPNT.RYS.......Y..RV...............GHK..lSDn..............................svVMS.PI..KYFK-s..........................................
R6TIC8_9STAP/34-134                    ................................................kylt-----ASV.....GE.-...S....YD..................EV..GINYH..C...N...............................V..................D.........-..-NS.......................YVIYG.TT.....L.NG.....................................S..E.IE........N.P..I.R......VD....S.VSTlwkldq.............................................................vgedtqSGFS.E..RYIC.KANLT....H.......L..KSNT.TYY.......Y..QA...............ISN...D-.................................VKS.SI..QSFTT...........................................
F4PPK2_DICFS/171-279                   ....................................................PQSVKLSL.....TP.-...V....YG..................QM..KVSWF..T...S...............................L..................E.........N..GVS.......................LVQYS.QS.....Q.SAlqaslmn.......................iklpagsS..V.YT........A.N..G.T......SS....A.FAT.........................................................................ESNW.F..GFSN.MVLLE....S.......L..EPMT.TYF.......Y..AC...............GGK...TAt...............................sAWT.SV..RKFTT...........................................
D2VG13_NAEGR/99-204                    ..................................................ir--HVHLAY.....TQ.-...Q....PN..................EL..VVQFH..T...Fs............................yhD..................K.........L..GKP.......................LVRIG.KS.....V.NQ.............................