
Database: Pfam
Entry: Ribosomal_60s
LinkDB: Ribosomal_60s
Original site: Ribosomal_60s 
#=GF ID   Ribosomal_60s
#=GF AC   PF00428.19
#=GF DE   60s Acidic ribosomal protein
#=GF PI   60s_ribosomal;
#=GF AU   Finn RD;0000-0001-8626-2148
#=GF SE   Pfam-B_151 (release 1.0)
#=GF GA   28.10 28.10;
#=GF TC   28.10 28.10;
#=GF NC   28.00 28.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   8722011
#=GF RT   Proteins P1, P2, and P0, components of the eukaryotic ribosome
#=GF RT   stalk. New structural and functional aspects. 
#=GF RA   Remacha M, Jimenez-Diaz A, Santos C, Briones E, Zambrano R,
#=GF RA   Rodriguez Gabriel MA, Guarinos E, Ballesta JP; 
#=GF RL   Biochem Cell Biol 1995;73:959-968.
#=GF DR   SCOP; 1s4h; fa;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family includes archaebacterial L12, eukaryotic P0, P1 and
#=GF CC   P2.
#=GF SQ   5126
#=GS A8BKF1_GIAIC/21-105         AC A8BKF1.1
#=GS A0A150J6Q7_9EURY/16-101     AC A0A150J6Q7.1
#=GS A0A084VHA0_ANOSI/744-827    AC A0A084VHA0.1
#=GS A0A0D0BXB3_9AGAR/17-113     AC A0A0D0BXB3.1
#=GS A0A1L0BXU2_9ASCO/20-106     AC A0A1L0BXU2.1
#=GS A0A150FY74_GONPE/17-109     AC A0A150FY74.1
#=GS F0ZXE3_DICPU/227-304        AC F0ZXE3.1
#=GS G8JWW4_ERECY/92-178         AC G8JWW4.1
#=GS A0A1Y2FID2_9ASCO/19-106     AC A0A1Y2FID2.1
#=GS M4ENX5_BRARP/28-120         AC M4ENX5.1
#=GS F6Z136_CALJA/18-88          AC F6Z136.1
#=GS A0A1A6GF20_NEOLE/4-100      AC A0A1A6GF20.1
#=GS M2MFM3_BAUCO/234-321        AC M2MFM3.1
#=GS B3S429_TRIAD/231-313        AC B3S429.1
#=GS A0A226NAL5_CALSU/231-316    AC A0A226NAL5.1
#=GS A0A0W7TI05_9EURY/230-333    AC A0A0W7TI05.1
#=GS RL12_PYRHO/16-107           AC O57705.2
#=GS RL12_PYRHO/16-107           DR PDB; 3A1Y C; 16-58;
#=GS RL12_PYRHO/16-107           DR PDB; 5H7L E; 100-107;
#=GS RL12_PYRHO/16-107           DR PDB; 3WY9 C; 83-107;
#=GS RL12_PYRHO/16-107           DR PDB; 3A1Y B; 16-58;
#=GS RL12_PYRHO/16-107           DR PDB; 3A1Y F; 16-58;
#=GS RL12_PYRHO/16-107           DR PDB; 3A1Y A; 16-58;
#=GS RL12_PYRHO/16-107           DR PDB; 3A1Y D; 16-58;
#=GS RL12_PYRHO/16-107           DR PDB; 3WY9 D; 83-107;
#=GS RL12_PYRHO/16-107           DR PDB; 5H7L G; 99-107;
#=GS RL12_PYRHO/16-107           DR PDB; 3A1Y E; 16-58;
#=GS A0A182V7K1_ANOME/231-313    AC A0A182V7K1.1
#=GS A8Y1E6_CAEBR/22-110         AC A8Y1E6.1
#=GS A0A162R5H3_MUCCL/228-307    AC A0A162R5H3.1
#=GS M2T1B0_COCSN/17-112         AC M2T1B0.1
#=GS D3S1Z2_FERPA/18-105         AC D3S1Z2.1
#=GS M7XB33_RHOT1/229-312        AC M7XB33.1
#=GS A0A229XGW7_9EURO/17-111     AC A0A229XGW7.1
#=GS R1D864_EMIHU/231-316        AC R1D864.1
#=GS A0A2G8JRJ1_STIJA/29-123     AC A0A2G8JRJ1.1
#=GS A0A1F5LZA1_9EURO/21-106     AC A0A1F5LZA1.1
#=GS X0CM61_FUSOX/17-109         AC X0CM61.1
#=GS I2JUJ7_DEKBR/21-110         AC I2JUJ7.2
#=GS R0EUX9_9BRAS/22-100         AC R0EUX9.1
#=GS S9XIA7_CAMFR/22-113         AC S9XIA7.1
#=GS A0A0E0I6L3_ORYNI/21-109     AC A0A0E0I6L3.1
#=GS A0A068Y975_ECHMU/17-122     AC A0A068Y975.1
#=GS E9CCZ9_CAPO3/17-110         AC E9CCZ9.1
#=GS A0A0H2R2S6_9HOMO/232-314    AC A0A0H2R2S6.1
#=GS A0A1J7J678_9PEZI/229-316    AC A0A1J7J678.1
#=GS A2YT04_ORYSI/17-113         AC A2YT04.1
#=GS A0A1E3QSW0_9ASCO/19-103     AC A0A1E3QSW0.1
#=GS RL12_HALVD/16-112           AC P41197.1
#=GS D7EAE1_METEZ/237-345        AC D7EAE1.1
#=GS V7CH15_PHAVU/234-320        AC V7CH15.1
#=GS D8LSD6_ECTSI/26-112         AC D8LSD6.1
#=GS I1LTT3_SOYBN/17-110         AC I1LTT3.1
#=GS A0A194VCY8_9PEZI/21-107     AC A0A194VCY8.1
#=GS A0A078HWW9_BRANA/34-119     AC A0A078HWW9.1
#=GS H2Y4S4_CIOSA/17-109         AC H2Y4S4.1
#=GS A0A0A0LV50_CUCSA/234-319    AC A0A0A0LV50.1
#=GS A0A1W5DA60_9LECA/229-313    AC A0A1W5DA60.1
#=GS A0A167PYB1_9BASI/1-55       AC A0A167PYB1.1
#=GS A0A061DU49_THECC/93-184     AC A0A061DU49.1
#=GS I3TDH6_THEC1/23-114         AC I3TDH6.1
#=GS A0A2A5VVX9_9EURY/16-103     AC A0A2A5VVX9.1
#=GS A0A077ZUT5_STYLE/32-118     AC A0A077ZUT5.1
#=GS D7LSI6_ARALL/1-57           AC D7LSI6.1
#=GS A0A197JGX0_9FUNG/20-106     AC A0A197JGX0.1
#=GS W6KKB3_9TRYP/16-110         AC W6KKB3.1
#=GS L0PBR1_PNEJ8/17-106         AC L0PBR1.1
#=GS Q7PQG7_ANOGA/231-313        AC Q7PQG7.1
#=GS A0A2K5KU25_CERAT/22-113     AC A0A2K5KU25.1
#=GS A0A1Q9DP29_SYMMI/549-634    AC A0A1Q9DP29.1
#=GS A0A0E0HF91_ORYNI/33-128     AC A0A0E0HF91.1
#=GS A0A251SUJ1_HELAN/233-316    AC A0A251SUJ1.1
#=GS A0A0D2XDL8_FUSO4/229-312    AC A0A0D2XDL8.1
#=GS A0A2I2UUJ2_FELCA/18-90      AC A0A2I2UUJ2.1
#=GS G0NY22_CAEBE/231-311        AC G0NY22.1
#=GS A0A0M9VXK6_9HYPO/21-107     AC A0A0M9VXK6.1
#=GS W5L8X7_ASTMX/100-184        AC W5L8X7.1
#=GS A0A1Q9P1A8_9ARCH/16-99      AC A0A1Q9P1A8.1
#=GS A0A0L7LLV1_9NEOP/7-61       AC A0A0L7LLV1.1
#=GS M3HIT8_CANMX/17-108         AC M3HIT8.1
#=GS A0A1Q9P2L1_9ARCH/16-104     AC A0A1Q9P2L1.1
#=GS A9V5U8_MONBE/22-104         AC A9V5U8.1
#=GS RLA0_CHICK/231-315          AC P47826.1
#=GS A0A2I3LSE1_PAPAN/20-98      AC A0A2I3LSE1.1
#=GS W2QB22_PHYPN/231-311        AC W2QB22.1
#=GS A0A175W089_9PEZI/17-109     AC A0A175W089.1
#=GS I1QF51_ORYGL/21-109         AC I1QF51.1
#=GS B9RNK0_RICCO/21-112         AC B9RNK0.1
#=GS A0A166UK57_9PEZI/229-312    AC A0A166UK57.1
#=GS A0A0F4YT67_TALEM/21-126     AC A0A0F4YT67.1
#=GS A0A0Y9UDG7_PLABE/19-110     AC A0A0Y9UDG7.1
#=GS A0A0V0R7S0_PSEPJ/29-108     AC A0A0V0R7S0.1
#=GS A0A1S3MIY2_SALSA/17-115     AC A0A1S3MIY2.1
#=GS A6R7C5_AJECN/21-109         AC A6R7C5.1
#=GS A0A195FCE2_9HYME/231-317    AC A0A195FCE2.1
#=GS A0A1B8G8I0_9PEZI/229-311    AC A0A1B8G8I0.1
#=GS F7HAM2_CALJA/21-81          AC F7HAM2.1
#=GS A0A183G5C8_HELBK/170-260    AC A0A183G5C8.1
#=GS E2B864_HARSA/22-110         AC E2B864.1
#=GS W9QTA2_9ROSA/17-115         AC W9QTA2.1
#=GS H0ZQZ1_TAEGU/22-113         AC H0ZQZ1.1
#=GS A0A251S133_HELAN/1-51       AC A0A251S133.1
#=GS A0A1S3JLM9_LINUN/22-112     AC A0A1S3JLM9.1
#=GS W1QEQ6_OGAPD/17-108         AC W1QEQ6.1
#=GS A0A1R3KG69_COCAP/17-113     AC A0A1R3KG69.1
#=GS W6QLH1_PENRF/21-106         AC W6QLH1.1
#=GS A0A1S2XL12_CICAR/234-320    AC A0A1S2XL12.1
#=GS A9PA46_POPTR/21-108         AC A9PA46.1
#=GS A6UTF7_META3/16-98          AC A6UTF7.1
#=GS A0A0F8XGE4_9EURO/229-312    AC A0A0F8XGE4.1
#=GS A0A0D9MYH1_ASPFA/21-108     AC A0A0D9MYH1.1
#=GS A0A091UHF5_PHORB/17-114     AC A0A091UHF5.1
#=GS A0A1A8WY88_PLAMA/19-111     AC A0A1A8WY88.1
#=GS T1HH04_RHOPR/213-295        AC T1HH04.1
#=GS A0A1U8LLR2_GOSHI/234-320    AC A0A1U8LLR2.1
#=GS N4UH12_FUSC1/17-109         AC N4UH12.1
#=GS M0P877_9EURY/16-109         AC M0P877.1
#=GS I3EIJ4_NEMP3/21-99          AC I3EIJ4.1
#=GS A1C664_ASPCL/17-110         AC A1C664.1
#=GS W0K3A8_9EURY/16-113         AC W0K3A8.1
#=GS A0A151N9F0_ALLMI/43-117     AC A0A151N9F0.1
#=GS W6ZGB8_COCMI/17-112         AC W6ZGB8.1
#=GS A0A1L0DN57_9ASCO/229-311    AC A0A1L0DN57.1
#=GS A0A1Q9E0V8_SYMMI/86-178     AC A0A1Q9E0V8.1
#=GS M4EWV0_BRARP/63-153         AC M4EWV0.1
#=GS A9S6G5_PHYPA/17-113         AC A9S6G5.1
#=GS A0A061GR04_THECC/18-120     AC A0A061GR04.1
#=GS J7S764_KAZNA/229-312        AC J7S764.1
#=GS A0A059BIC8_EUCGR/233-319    AC A0A059BIC8.1
#=GS A0A0Q4B269_9EURY/16-102     AC A0A0Q4B269.1
#=GS A0A094GEC3_9PEZI/64-151     AC A0A094GEC3.1
#=GS A0A0N5E0B1_TRIMR/58-147     AC A0A0N5E0B1.1
#=GS U4LVS9_PYROM/228-312        AC U4LVS9.1
#=GS A0A1J9PR42_9EURO/229-312    AC A0A1J9PR42.1
#=GS A0A1U8JIR4_GOSHI/16-114     AC A0A1U8JIR4.1
#=GS I0YK96_COCSC/20-115         AC I0YK96.1
#=GS RLA2_MOUSE/17-114           AC P99027.3
#=GS RLA2A_MAIZE/17-111          AC P46252.3
#=GS R0HZN3_9BRAS/233-319        AC R0HZN3.1
#=GS A0A151F372_9EURY/16-100     AC A0A151F372.1
#=GS A0A1V6R9H6_9EURO/17-108     AC A0A1V6R9H6.1
#=GS L9KS94_TUPCH/44-138         AC L9KS94.1
#=GS A0A1G4IZ11_9SACH/19-106     AC A0A1G4IZ11.1
#=GS A0A287A934_PIG/198-276      AC A0A287A934.1
#=GS A0A194VQP3_9PEZI/17-109     AC A0A194VQP3.1
#=GS A0A095AN35_SCHHA/17-112     AC A0A095AN35.1
#=GS A0A0P7XY39_9TELE/22-112     AC A0A0P7XY39.1
#=GS A0A0F4GXM4_9PEZI/17-110     AC A0A0F4GXM4.1
#=GS S0E8J0_GIBF5/17-109         AC S0E8J0.1
#=GS A0A0B2RNV2_GLYSO/234-319    AC A0A0B2RNV2.1
#=GS H2LZD7_ORYLA/132-215        AC H2LZD7.1
#=GS A0A218NNM9_9ARCH/16-101     AC A0A218NNM9.1
#=GS A0A182FNS5_ANOAL/231-315    AC A0A182FNS5.1
#=GS E3S6K2_PYRTT/21-111         AC E3S6K2.1
#=GS A0A0V1K4Y5_TRIPS/231-318    AC A0A0V1K4Y5.1
#=GS A0A2K5JVY5_COLAP/231-317    AC A0A2K5JVY5.1
#=GS W7L7T8_9CREN/16-103         AC W7L7T8.1
#=GS D8SB36_SELML/32-119         AC D8SB36.1
#=GS A0A094AE68_9PEZI/66-153     AC A0A094AE68.1
#=GS G8YFW0_PICSO/80-163         AC G8YFW0.1
#=GS G3B9G8_CANTC/17-109         AC G3B9G8.1
#=GS R9T4G7_METII/9-101          AC R9T4G7.1
#=GS A0A061FL90_THECC/234-319    AC A0A061FL90.1
#=GS Q5CR36_CRYPI/239-317        AC Q5CR36.1
#=GS A0A1D1VXI9_RAMVA/22-113     AC A0A1D1VXI9.1
#=GS A0A0V1PJV9_9BILA/22-119     AC A0A0V1PJV9.1
#=GS RLA2_BRUMA/18-113           AC P90703.1
#=GS RLA2_CAEEL/17-106           AC O01504.2
#=GS H3GGS5_PHYRM/27-114         AC H3GGS5.1
#=GS F0YQD0_AURAN/17-110         AC F0YQD0.1
#=GS Q5NB69_ORYSJ/60-118         AC Q5NB69.1
#=GS A0A0F7IG78_9EURY/16-105     AC A0A0F7IG78.1
#=GS W2QPS0_PHYPN/27-114         AC W2QPS0.1
#=GS A0A1J8QY12_9HOMO/30-119     AC A0A1J8QY12.1
#=GS A0A260ZCD4_9PELO/17-106     AC A0A260ZCD4.1
#=GS A0A026VZT8_OOCBI/231-316    AC A0A026VZT8.1
#=GS A0A0V0YPL7_9BILA/17-70      AC A0A0V0YPL7.1
#=GS A0BDW7_PARTE/34-121         AC A0BDW7.1
#=GS A0A1X2J0Q3_9FUNG/17-108     AC A0A1X2J0Q3.1
#=GS A0A1E4RSB0_9ASCO/17-105     AC A0A1E4RSB0.1
#=GS L1I8D2_GUITH/1-95           AC L1I8D2.1
#=GS A0A1V1SUP7_9FUNG/17-110     AC A0A1V1SUP7.1
#=GS A0A2B7XFY1_9EURO/21-109     AC A0A2B7XFY1.1
#=GS A0A0A2L9T9_PENIT/17-107     AC A0A0A2L9T9.1
#=GS A0A183W8R7_TRIRE/17-114     AC A0A183W8R7.1
#=GS A0A1E3PRK0_9ASCO/229-310    AC A0A1E3PRK0.1
#=GS A0A2H0ZCD7_CANAR/50-139     AC A0A2H0ZCD7.1
#=GS K8EDG0_9CHLO/232-314        AC K8EDG0.1
#=GS D7EAE2_METEZ/16-105         AC D7EAE2.1
#=GS Q22XR4_TETTS/108-197        AC Q22XR4.2
#=GS G4T639_SERID/17-115         AC G4T639.1
#=GS RL10_THEKO/232-339          AC Q5JH36.1
#=GS B8D5P6_DESA1/16-106         AC B8D5P6.1
#=GS A0A2H3IC99_9EURO/229-312    AC A0A2H3IC99.1
#=GS J8Q3S6_SACAR/17-109         AC J8Q3S6.1
#=GS RLA4_YEAST/17-109           AC P02400.2
#=GS RLA4_YEAST/17-109           DR PDB; 3N3X B; 1-6;
#=GS RLA4_YEAST/17-109           DR PDB; 3N2D B; 1-6;
#=GS A0A0M9G2S6_9TRYP/238-325    AC A0A0M9G2S6.1
#=GS A0A024TZ76_9STRA/29-112     AC A0A024TZ76.1
#=GS L9KM63_TUPCH/231-323        AC L9KM63.1
#=GS A0A1U8AI74_NELNU/21-110     AC A0A1U8AI74.1
#=GS K6VAU9_9APIC/32-118         AC K6VAU9.1
#=GS A0A0C3JZ86_PISTI/229-311    AC A0A0C3JZ86.1
#=GS RLA1_HUMAN/22-113           AC P05386.1
#=GS RLA1_HUMAN/22-113           DR PDB; 2LBF A; 22-69;
#=GS RLA1_HUMAN/22-113           DR PDB; 4BEH A; 22-113;
#=GS H3FJM0_PRIPA/251-331        AC H3FJM0.1
#=GS A0A2K5KWB2_CERAT/186-268    AC A0A2K5KWB2.1
#=GS A0A0C4EIJ4_PUCT1/17-111     AC A0A0C4EIJ4.1
#=GS M4CAU5_BRARP/233-320        AC M4CAU5.1
#=GS S2JPQ0_MUCC1/20-104         AC S2JPQ0.1
#=GS A0A1S3DWV9_CICAR/1-75       AC A0A1S3DWV9.1
#=GS A0A2A2FFV2_9EURY/16-112     AC A0A2A2FFV2.1
#=GS A0A1U8NFT9_GOSHI/17-105     AC A0A1U8NFT9.1
#=GS A0A0V0U7F6_9BILA/22-112     AC A0A0V0U7F6.1
#=GS A0A1U8P582_GOSHI/234-319    AC A0A1U8P582.1
#=GS A0A2G2VUC0_CAPBA/1-77       AC A0A2G2VUC0.1
#=GS A0A0W8DX01_PHYNI/27-107     AC A0A0W8DX01.1
#=GS A0A1S4E3U5_CUCME/17-112     AC A0A1S4E3U5.1
#=GS A0A2H3E6B9_ARMGA/17-111     AC A0A2H3E6B9.1
#=GS K3ZVC4_SETIT/234-318        AC K3ZVC4.1
#=GS W4KDF3_9HOMO/229-312        AC W4KDF3.1
#=GS W0T7L8_KLUMD/17-108         AC W0T7L8.1
#=GS G1UBJ0_METIK/16-101         AC G1UBJ0.1
#=GS A0A1S3PW10_SALSA/33-129     AC A0A1S3PW10.1
#=GS A0A139HJP5_9PEZI/17-112     AC A0A139HJP5.1
#=GS Q2UKH6_ASPOR/229-312        AC Q2UKH6.1
#=GS A0A099P5Y8_PICKU/19-102     AC A0A099P5Y8.1
#=GS E1Z866_CHLVA/233-313        AC E1Z866.1
#=GS A0A177B0Y2_9METZ/25-109     AC A0A177B0Y2.1
#=GS A0A084WHE2_ANOSI/23-113     AC A0A084WHE2.1
#=GS A0A0B4H8T9_9HYPO/21-108     AC A0A0B4H8T9.1
#=GS A0A0V0X243_9BILA/22-119     AC A0A0V0X243.1
#=GS A0A096PAI6_OSTTA/229-310    AC A0A096PAI6.1
#=GS A0A1R3JJS3_COCAP/307-395    AC A0A1R3JJS3.1
#=GS H2LPR5_ORYLA/17-112         AC H2LPR5.1
#=GS A0A0D9WH38_9ORYZ/17-111     AC A0A0D9WH38.1
#=GS A0A183TEY4_SCHSO/17-115     AC A0A183TEY4.1
#=GS A0A0D1Z6K8_9EURO/17-113     AC A0A0D1Z6K8.1
#=GS A0A0V1CZ80_TRIBR/231-319    AC A0A0V1CZ80.1
#=GS A0A182QAP0_9DIPT/23-112     AC A0A182QAP0.1
#=GS A0A0N4VYA0_HAEPC/17-71      AC A0A0N4VYA0.1
#=GS C1MX55_MICPC/17-108         AC C1MX55.1
#=GS G1QHI2_NOMLE/231-316        AC G1QHI2.3
#=GS L5LCV2_MYODS/2-92           AC L5LCV2.1
#=GS RLA25_ARATH/17-113          AC Q9LUK2.1
#=GS A0A091FQM0_9AVES/17-114     AC A0A091FQM0.1
#=GS A9PCM7_POPTR/17-112         AC A9PCM7.1
#=GS A0A1B7P4U5_9EURO/17-111     AC A0A1B7P4U5.1
#=GS A0A1S3C8T5_CUCME/17-114     AC A0A1S3C8T5.1
#=GS S5Z820_9CREN/16-105         AC S5Z820.1
#=GS A0A0M0BYG7_9ARCH/16-102     AC A0A0M0BYG7.1
#=GS A0A067KDN6_JATCU/17-86      AC A0A067KDN6.1
#=GS A0A1D6C729_WHEAT/36-119     AC A0A1D6C729.1
#=GS A0A1S3ZR95_TOBAC/234-318    AC A0A1S3ZR95.1
#=GS F7DX87_MACMU/220-302        AC F7DX87.2
#=GS RLA2_BOVIN/17-114           AC P42899.1
#=GS S9W177_SCHCR/17-108         AC S9W177.1
#=GS Q9U1X9_CAEEL/17-109         AC Q9U1X9.1
#=GS Q4DWU6_TRYCC/16-106         AC Q4DWU6.1
#=GS A0A0B4HZI1_9HYPO/17-109     AC A0A0B4HZI1.1
#=GS A0A1B7MWK1_9HOMO/21-110     AC A0A1B7MWK1.1
#=GS A0A0D9WXB0_9ORYZ/28-86      AC A0A0D9WXB0.1
#=GS A0A0L9UNI9_PHAAN/17-77      AC A0A0L9UNI9.1
#=GS F9CUR1_9ARCH/16-97          AC F9CUR1.1
#=GS C5Z967_SORBI/61-118         AC C5Z967.1
#=GS A0A0W7VNC0_9HYPO/229-312    AC A0A0W7VNC0.1
#=GS W7A957_9APIC/19-110         AC W7A957.1
#=GS A0A1D6C4Q5_WHEAT/227-311    AC A0A1D6C4Q5.1
#=GS A0A0P7V4N1_9TELE/231-295    AC A0A0P7V4N1.1
#=GS A0A0X8V2L6_9EURY/16-102     AC A0A0X8V2L6.1
#=GS A0A1S2Z8G7_CICAR/21-75      AC A0A1S2Z8G7.1
#=GS E4WQM2_OIKDI/20-106         AC E4WQM2.1
#=GS A8A9N2_IGNH4/16-106         AC A8A9N2.1
#=GS A0A1U8FRL2_CAPAN/22-113     AC A0A1U8FRL2.1
#=GS D7MFV8_ARALL/23-118         AC D7MFV8.1
#=GS A0A093Q0C2_9PASS/17-114     AC A0A093Q0C2.1
#=GS G0QTQ2_ICHMG/21-107         AC G0QTQ2.1
#=GS A0A1D2WL69_9EURY/16-99      AC A0A1D2WL69.1
#=GS I1GWP5_BRADI/14-119         AC I1GWP5.1
#=GS A0A1L7X3R8_9HELO/21-109     AC A0A1L7X3R8.1
#=GS K5XEM2_AGABU/17-111         AC K5XEM2.1
#=GS A0A0S4IV06_BODSA/21-106     AC A0A0S4IV06.1
#=GS A0A177VL13_9BASI/21-108     AC A0A177VL13.1
#=GS T0M453_9EURY/16-100         AC T0M453.1
#=GS F9XB28_ZYMTI/229-312        AC F9XB28.1
#=GS A2STT7_METLZ/16-102         AC A2STT7.1
#=GS W5JMB2_ANODA/231-315        AC W5JMB2.1
#=GS A0A2H3FSQ9_9HELO/229-312    AC A0A2H3FSQ9.1
#=GS D7G7B6_ECTSI/10-100         AC D7G7B6.1
#=GS A0A0L0D948_THETB/17-104     AC A0A0L0D948.1
#=GS A0A154NZP4_9HYME/231-316    AC A0A154NZP4.1
#=GS W6ZJF7_COCMI/21-119         AC W6ZJF7.1
#=GS F2X232_AILME/17-114         AC F2X232.1
#=GS A0A2C5WV68_9PEZI/17-107     AC A0A2C5WV68.1
#=GS G8JUX7_ERECY/20-104         AC G8JUX7.1
#=GS H2NIU8_PONAB/231-316        AC H2NIU8.1
#=GS N4V8B6_COLOR/17-109         AC N4V8B6.1
#=GS A0A2K1XTJ3_POPTR/21-92      AC A0A2K1XTJ3.1
#=GS A0A0E0IXV3_ORYNI/687-772    AC A0A0E0IXV3.1
#=GS D7LPU7_ARALL/17-115         AC D7LPU7.1
#=GS A4FVF5_XENLA/17-110         AC A4FVF5.1
#=GS A0A2G9GVC5_9LAMI/17-114     AC A0A2G9GVC5.1
#=GS A0A0R3SI00_HYMDI/231-320    AC A0A0R3SI00.1
#=GS A0A016VCV0_9BILA/17-92      AC A0A016VCV0.1
#=GS A0A1J6K3D1_NICAT/234-321    AC A0A1J6K3D1.1
#=GS G3SDP0_GORGO/231-316        AC G3SDP0.2
#=GS U6MU67_9EIME/9-107          AC U6MU67.1
#=GS A2FUC9_TRIVA/17-102         AC A2FUC9.1
#=GS A0A0E3NSU5_9EURY/16-102     AC A0A0E3NSU5.1
#=GS K3YIN8_SETIT/234-317        AC K3YIN8.1
#=GS A0A151X8W5_9HYME/231-317    AC A0A151X8W5.1
#=GS R1EJ84_EMIHU/17-113         AC R1EJ84.1
#=GS A0A0D2DFG5_9EURO/229-314    AC A0A0D2DFG5.1
#=GS H2AX77_KAZAF/229-310        AC H2AX77.1
#=GS A0A059DCP2_EUCGR/17-105     AC A0A059DCP2.1
#=GS A0A0D3AWE2_BRAOL/17-112     AC A0A0D3AWE2.1
#=GS A0A195CJ37_9HYME/231-317    AC A0A195CJ37.1
#=GS A0A1U7QK56_MESAU/22-113     AC A0A1U7QK56.1
#=GS M0CQB0_9EURY/16-113         AC M0CQB0.1
#=GS S6F164_ZYGB2/20-106         AC S6F164.1
#=GS A0A200R957_9MAGN/51-120     AC A0A200R957.1
#=GS Q12UP7_METBU/16-99          AC Q12UP7.1
#=GS U1HEL1_ENDPU/17-113         AC U1HEL1.1
#=GS A0A2H0ZMX0_CANAR/20-107     AC A0A2H0ZMX0.1
#=GS A0A182V6B4_ANOME/23-112     AC A0A182V6B4.1
#=GS A0A2H3FCT1_9HELO/17-111     AC A0A2H3FCT1.1
#=GS D4AV09_ARTBC/21-109         AC D4AV09.1
#=GS A0A017S3R6_9EURO/229-310    AC A0A017S3R6.1
#=GS I1JPZ4_SOYBN/17-112         AC I1JPZ4.1
#=GS W4J340_PLAFP/1-47           AC W4J340.1
#=GS A0A165CDA1_9APHY/229-314    AC A0A165CDA1.1
#=GS A0A1F5LFD3_9EURO/229-312    AC A0A1F5LFD3.1
#=GS A0A0D2BED2_9EURO/17-112     AC A0A0D2BED2.1
#=GS E9Q3T0_MOUSE/22-113         AC E9Q3T0.1
#=GS A0A0D2VUN1_CAPO3/231-314    AC A0A0D2VUN1.1
#=GS H0GKN0_SACCK/229-311        AC H0GKN0.1
#=GS I3J3T8_ORENI/22-113         AC I3J3T8.1
#=GS F4Q1Q9_CAVFA/17-102         AC F4Q1Q9.1
#=GS M7T3Z7_9EURY/16-107         AC M7T3Z7.1
#=GS A0A063BT28_9HYPO/22-108     AC A0A063BT28.1
#=GS A0A0B2QYX5_GLYSO/17-78      AC A0A0B2QYX5.1
#=GS A0A2H3CEN0_9AGAR/229-311    AC A0A2H3CEN0.1
#=GS G7KGX1_MEDTR/234-320        AC G7KGX1.1
#=GS A0A0V0X2Y9_9BILA/251-339    AC A0A0V0X2Y9.1
#=GS A0A1C7NK93_9FUNG/20-105     AC A0A1C7NK93.1
#=GS A0A1J4L1F2_9EUKA/21-105     AC A0A1J4L1F2.1
#=GS A0A2A9PE40_9HYPO/229-312    AC A0A2A9PE40.1
#=GS A0A094E2H5_9PEZI/60-137     AC A0A094E2H5.1
#=GS G1LEW2_AILME/231-316        AC G1LEW2.1
#=GS A0A091D0U3_FUKDA/22-113     AC A0A091D0U3.1
#=GS I7MA52_TETTS/93-183         AC I7MA52.2
#=GS A0A1S3E015_CICAR/21-111     AC A0A1S3E015.1
#=GS A0A0D2MQK0_9AGAR/229-311    AC A0A0D2MQK0.1
#=GS A0A1J1H4Q7_PLARL/32-117     AC A0A1J1H4Q7.1
#=GS A0A1L9PUF3_ASPVE/17-113     AC A0A1L9PUF3.1
#=GS A0A0G2K4Q1_RAT/59-92        AC A0A0G2K4Q1.1
#=GS F1NB66_CHICK/231-315        AC F1NB66.3
#=GS B6H919_PENRW/229-311        AC B6H919.1
#=GS I2GVW8_TETBL/16-105         AC I2GVW8.1
#=GS A0A2K5N115_CERAT/13-96      AC A0A2K5N115.1
#=GS U1QTC0_9EURY/16-113         AC U1QTC0.1
#=GS A0A1E4RTV6_CYBJA/229-311    AC A0A1E4RTV6.1
#=GS A0A0D3DC34_BRAOL/17-112     AC A0A0D3DC34.1
#=GS C6H5J3_AJECH/21-109         AC C6H5J3.1
#=GS A0A2K5JI75_COLAP/22-113     AC A0A2K5JI75.1
#=GS J9K3E2_ACYPI/23-110         AC J9K3E2.1
#=GS A0A0Q4B8R9_9EURY/231-332    AC A0A0Q4B8R9.1
#=GS A0A1A9ZQR1_GLOPL/22-109     AC A0A1A9ZQR1.1
#=GS M1D5E9_SOLTU/21-107         AC M1D5E9.1
#=GS A4I2U1_LEIIN/238-323        AC A4I2U1.1
#=GS A0A060S2P3_PYCCI/21-109     AC A0A060S2P3.1
#=GS Q7PNA9_ANOGA/23-112         AC Q7PNA9.4
#=GS V8NRP9_OPHHA/69-153         AC V8NRP9.1
#=GS A0A1E5RL84_9ASCO/16-104     AC A0A1E5RL84.1
#=GS A0A182XZS7_ANOST/37-127     AC A0A182XZS7.1
#=GS G3HDY7_CRIGR/192-273        AC G3HDY7.1
#=GS A0A0B0MIG5_GOSAR/166-252    AC A0A0B0MIG5.1
#=GS H0XF20_OTOGA/17-114         AC H0XF20.1
#=GS A0A2H3E459_ARMGA/229-311    AC A0A2H3E459.1
#=GS A0A0L1I1Z2_9PLEO/21-110     AC A0A0L1I1Z2.1
#=GS B9SNZ6_RICCO/35-121         AC B9SNZ6.1
#=GS Q29N41_DROPS/22-111         AC Q29N41.1
#=GS A0A1I7U4V3_9PELO/17-106     AC A0A1I7U4V3.1
#=GS H2P057_PONAB/231-311        AC H2P057.1
#=GS B4N0U4_DROWI/22-112         AC B4N0U4.1
#=GS A0A094ELX9_9PEZI/229-311    AC A0A094ELX9.1
#=GS B7GA61_PHATC/17-105         AC B7GA61.1
#=GS A0A1L8I062_XENLA/231-313    AC A0A1L8I062.1
#=GS A0A135VNQ3_9ARCH/16-102     AC A0A135VNQ3.1
#=GS A0A0D3HR34_9ORYZ/795-880    AC A0A0D3HR34.1
#=GS L5LJH3_MYODS/63-135         AC L5LJH3.1
#=GS A0A182LYR4_9DIPT/17-111     AC A0A182LYR4.2
#=GS M4E983_BRARP/17-112         AC M4E983.1
#=GS A0A068XUG9_ECHMU/22-120     AC A0A068XUG9.1
#=GS A0A078IFI2_BRANA/35-119     AC A0A078IFI2.1
#=GS A0A0L0SPN6_ALLMA/231-310    AC A0A0L0SPN6.1
#=GS L0AAV7_CALLD/21-108         AC L0AAV7.1
#=GS A0A1B7NG81_9HOMO/17-89      AC A0A1B7NG81.1
#=GS H2LMY7_ORYLA/17-114         AC H2LMY7.1
#=GS A0A2K5HM78_COLAP/23-114     AC A0A2K5HM78.1
#=GS RLA1_SCHPO/21-108           AC P17476.1
#=GS F2U1N9_SALR5/229-310        AC F2U1N9.1
#=GS S9V3Y4_9TRYP/21-107         AC S9V3Y4.1
#=GS A4SAM0_OSTLU/232-312        AC A4SAM0.1
#=GS B4LE06_DROVI/231-316        AC B4LE06.1
#=GS A0A0G4KSX6_9PEZI/192-274    AC A0A0G4KSX6.1
#=GS A0A195BNB3_9HYME/231-317    AC A0A195BNB3.1
#=GS A0A0C2YUF0_9HOMO/21-110     AC A0A0C2YUF0.1
#=GS A0A0R3XDL8_HYDTA/1-76       AC A0A0R3XDL8.1
#=GS A0A1E3H9Z9_9TREE/229-313    AC A0A1E3H9Z9.1
#=GS A0A238F902_9BASI/229-310    AC A0A238F902.1
#=GS A0A074XFT6_AURPU/17-108     AC A0A074XFT6.1
#=GS Q5ANH5_CANAL/17-110         AC Q5ANH5.1
#=GS A0A1R2BCH2_9CILI/246-329    AC A0A1R2BCH2.1
#=GS A0A165UA00_9HOMO/17-111     AC A0A165UA00.1
#=GS F4WNI7_ACREC/22-109         AC F4WNI7.1
#=GS A0A067Q3X5_9HOMO/17-111     AC A0A067Q3X5.1
#=GS A0A0F2LX59_SPOSC/100-165    AC A0A0F2LX59.1
#=GS H0GEJ4_SACCK/17-109         AC H0GEJ4.1
#=GS F4PNB1_CAVFA/622-701        AC F4PNB1.1
#=GS M2XVP1_GALSU/18-114         AC M2XVP1.1
#=GS A0A024UC28_9STRA/26-113     AC A0A024UC28.1
#=GS A0A093NXI2_PYGAD/17-114     AC A0A093NXI2.1
#=GS F6TTP1_HORSE/55-140         AC F6TTP1.1
#=GS B9PJK1_TOXGV/19-112         AC B9PJK1.1
#=GS A0A285N6F7_9EURY/16-115     AC A0A285N6F7.1
#=GS A0A0D0D097_9AGAR/229-311    AC A0A0D0D097.1
#=GS A0A2K5MZV3_CERAT/17-114     AC A0A2K5MZV3.1
#=GS L0KZG3_METHD/16-101         AC L0KZG3.1
#=GS A0A087TID0_9ARAC/17-104     AC A0A087TID0.1
#=GS RLA6_SCHPO/17-109           AC O14317.2
#=GS A0A1X7RAJ0_9SACH/229-311    AC A0A1X7RAJ0.1
#=GS A0A231MDT6_9EURO/21-109     AC A0A231MDT6.1
#=GS A0A093XNG5_9PEZI/54-141     AC A0A093XNG5.1
#=GS A0A0K0CUE7_ANGCA/18-89      AC A0A0K0CUE7.1
#=GS U6NFM5_HAECO/22-114         AC U6NFM5.1
#=GS A0A151ZJ20_9MYCE/227-306    AC A0A151ZJ20.1
#=GS H3AB03_LATCH/17-111         AC H3AB03.1
#=GS A0A1U7LUW1_9ASCO/172-253    AC A0A1U7LUW1.1
#=GS A0A0F9XN31_TRIHA/21-107     AC A0A0F9XN31.1
#=GS RLA22_ARATH/17-114          AC Q9SLF7.1
#=GS A0A251TCE4_HELAN/61-156     AC A0A251TCE4.1
#=GS A0A1E5REY8_9ASCO/16-107     AC A0A1E5REY8.1
#=GS A0A1I8CEK9_9BILA/22-108     AC A0A1I8CEK9.1
#=GS N1PQL2_DOTSN/21-111         AC N1PQL2.1
#=GS A0A139A309_GONPR/26-117     AC A0A139A309.1
#=GS A0A2G3CRU5_CAPCH/234-317    AC A0A2G3CRU5.1
#=GS A0A1Y1UL69_9FUNG/57-146     AC A0A1Y1UL69.1
#=GS I2GVA9_TETBL/17-108         AC I2GVA9.1
#=GS A0A1X0NTR3_9TRYP/20-106     AC A0A1X0NTR3.1
#=GS A0A0F4G702_9PEZI/21-110     AC A0A0F4G702.1
#=GS A0A1I7TE45_9PELO/17-110     AC A0A1I7TE45.1
#=GS M4D695_BRARP/17-112         AC M4D695.1
#=GS A0A1Y3N6M7_PIRSE/228-312    AC A0A1Y3N6M7.1
#=GS A0A139CK36_9EURY/16-104     AC A0A139CK36.1
#=GS V9F855_PHYPR/231-311        AC V9F855.1
#=GS A0A0D7BGG0_9AGAR/229-311    AC A0A0D7BGG0.1
#=GS I1H2D6_BRADI/17-109         AC I1H2D6.1
#=GS A0A167XV60_9PEZI/17-109     AC A0A167XV60.1
#=GS A0A1D5PMT8_CHICK/17-114     AC A0A1D5PMT8.1
#=GS A0A2I2V3N0_FELCA/22-109     AC A0A2I2V3N0.1
#=GS Q0PXZ8_DIACI/22-112         AC Q0PXZ8.1
#=GS A0A151NXJ6_ALLMI/43-118     AC A0A151NXJ6.1
#=GS A0A2G3CXU2_CAPCH/21-109     AC A0A2G3CXU2.1
#=GS A0A087UME9_9ARAC/2-70       AC A0A087UME9.1
#=GS A0A135T9P7_9PEZI/21-108     AC A0A135T9P7.1
#=GS A0A165GAE5_9APHY/17-81      AC A0A165GAE5.1
#=GS V7BL51_PHAVU/17-113         AC V7BL51.1
#=GS A0A0C2YV85_HEBCY/17-110     AC A0A0C2YV85.1
#=GS R8BRB9_TOGMI/21-109         AC R8BRB9.1
#=GS A0A109FEK9_9BASI/17-109     AC A0A109FEK9.1
#=GS A0A0R3UK10_9CEST/17-121     AC A0A0R3UK10.1
#=GS W2SC27_9EURO/21-113         AC W2SC27.1
#=GS B8CG46_THAPS/231-316        AC B8CG46.1
#=GS A4S7T7_OSTLU/17-106         AC A4S7T7.1
#=GS A0A165T2J2_9HOMO/7-97       AC A0A165T2J2.1
#=GS C1GLK3_PARBD/21-110         AC C1GLK3.1
#=GS G4MKJ9_MAGO7/229-312        AC G4MKJ9.1
#=GS V4KPP2_EUTSA/17-114         AC V4KPP2.1
#=GS A0A200QQZ5_9MAGN/21-108     AC A0A200QQZ5.1
#=GS A0A1S3LEC7_SALSA/81-176     AC A0A1S3LEC7.1
#=GS A0A1A6GCN7_NEOLE/30-86      AC A0A1A6GCN7.1
#=GS A0A195B898_9HYME/22-109     AC A0A195B898.1
#=GS A0A1Y9IV09_9DIPT/231-314    AC A0A1Y9IV09.1
#=GS A0A1D2VIL8_9ASCO/12-104     AC A0A1D2VIL8.1
#=GS J3MJT3_ORYBR/17-122         AC J3MJT3.1
#=GS A0A0V1I0I6_9BILA/231-318    AC A0A0V1I0I6.1
#=GS A0A0R3PL14_ANGCS/17-112     AC A0A0R3PL14.1
#=GS A0A0U5G341_9EURO/229-313    AC A0A0U5G341.1
#=GS J4UJH5_BEAB2/17-110         AC J4UJH5.1
#=GS A0A0D3C2E8_BRAOL/17-112     AC A0A0D3C2E8.1
#=GS A0A1V6QLN2_9EURO/17-107     AC A0A1V6QLN2.1
#=GS A0A093BVF1_TAUER/207-293    AC A0A093BVF1.1
#=GS A0A091CK14_FUKDA/177-262    AC A0A091CK14.1
#=GS A0A1U8N2L0_GOSHI/234-320    AC A0A1U8N2L0.1
#=GS A0A024W572_PLAFA/231-315    AC A0A024W572.1
#=GS A0A0D2N385_GOSRA/17-115     AC A0A0D2N385.1
#=GS A0A078JT63_BRANA/15-83      AC A0A078JT63.1
#=GS A0A0E0CLG0_9ORYZ/586-681    AC A0A0E0CLG0.1
#=GS A0A0M9FQ02_9TRYP/85-173     AC A0A0M9FQ02.1
#=GS K7MZ77_SOYBN/17-112         AC K7MZ77.1
#=GS A0A094HEI7_9PEZI/63-140     AC A0A094HEI7.1
#=GS A2EIR1_TRIVA/17-105         AC A2EIR1.1
#=GS A0A067S6N2_GALM3/41-133     AC A0A067S6N2.1
#=GS A0A074WAS3_9PEZI/21-108     AC A0A074WAS3.1
#=GS A0A0E0EHH4_9ORYZ/234-318    AC A0A0E0EHH4.1
#=GS B3S1Z8_TRIAD/22-109         AC B3S1Z8.1
#=GS K4MC06_9EURY/16-102         AC K4MC06.1
#=GS B0DA55_LACBS/229-311        AC B0DA55.1
#=GS A0A251SQ67_HELAN/56-152     AC A0A251SQ67.1
#=GS A0A0L0C8Z6_LUCCU/22-112     AC A0A0L0C8Z6.1
#=GS A0A087VLU5_BALRE/213-295    AC A0A087VLU5.1
#=GS X6NNN7_RETFI/14-130         AC X6NNN7.1
#=GS A0A1G4JZC9_9SACH/17-107     AC A0A1G4JZC9.1
#=GS A0A078G324_BRANA/22-110     AC A0A078G324.1
#=GS K4D9W7_SOLLC/17-112         AC K4D9W7.1
#=GS S7Q1Q1_MYOBR/22-112         AC S7Q1Q1.1
#=GS J3LDF6_ORYBR/17-112         AC J3LDF6.1
#=GS A7E8S1_SCLS1/17-111         AC A7E8S1.1
#=GS D3ZJT4_RAT/193-278          AC D3ZJT4.3
#=GS C6T1E4_SOYBN/17-113         AC C6T1E4.1
#=GS L9XJ51_9EURY/16-116         AC L9XJ51.1
#=GS A0A1U7YB93_NICSY/22-111     AC A0A1U7YB93.1
#=GS Q6BGT0_DEBHA/20-104         AC Q6BGT0.1
#=GS A0A1U8K049_GOSHI/23-110     AC A0A1U8K049.1
#=GS F4IGR5_ARATH/35-126         AC F4IGR5.1
#=GS A0A1Y2BVI4_9FUNG/23-113     AC A0A1Y2BVI4.1
#=GS I2H6R1_TETBL/229-311        AC I2H6R1.1
#=GS A0A150VEX9_9PEZI/21-110     AC A0A150VEX9.1
#=GS A0A251UIM0_HELAN/8-94       AC A0A251UIM0.1
#=GS A0A0P7B2G0_9HYPO/21-107     AC A0A0P7B2G0.1
#=GS A0A094ASH8_9PEZI/229-310    AC A0A094ASH8.1
#=GS W1PR36_AMBTC/34-119         AC W1PR36.1
#=GS A0A128A151_9ARCH/16-98      AC A0A128A151.1
#=GS A0A1B8C7A3_9PEZI/17-109     AC A0A1B8C7A3.1
#=GS K4B212_SOLLC/21-111         AC K4B212.1
#=GS A0A1Y2F3F5_9BASI/20-106     AC A0A1Y2F3F5.1
#=GS R9NZM7_PSEHS/230-312        AC R9NZM7.1
#=GS A0A0W7VSD8_9HYPO/21-107     AC A0A0W7VSD8.1
#=GS A0A0P7GR51_9EURY/16-107     AC A0A0P7GR51.1
#=GS S8APN6_DACHA/21-108         AC S8APN6.1
#=GS B9HSR0_POPTR/234-319        AC B9HSR0.1
#=GS M3YCB9_MUSPF/19-116         AC M3YCB9.1
#=GS W7LXA2_GIBM7/229-312        AC W7LXA2.1
#=GS A0A1R3IP07_COCAP/234-320    AC A0A1R3IP07.1
#=GS A0A183HKG4_9BILA/23-98      AC A0A183HKG4.1
#=GS I7J968_BABMR/21-107         AC I7J968.1
#=GS A0A1D6C556_WHEAT/17-111     AC A0A1D6C556.1
#=GS A0A2H3XT26_PHODC/17-112     AC A0A2H3XT26.1
#=GS M0SWA9_MUSAM/234-318        AC M0SWA9.1
#=GS A0A0L7REM3_9HYME/16-112     AC A0A0L7REM3.1
#=GS C7YQC5_NECH7/228-309        AC C7YQC5.1
#=GS A0A0D2TLY9_GOSRA/17-112     AC A0A0D2TLY9.1
#=GS U5DHQ6_AMBTC/17-117         AC U5DHQ6.1
#=GS A0A1A8YW79_9APIC/218-300    AC A0A1A8YW79.1
#=GS A0A1J8QFZ6_9HOMO/17-110     AC A0A1J8QFZ6.1
#=GS A0A1Y2GJH5_9FUNG/17-109     AC A0A1Y2GJH5.1
#=GS L8GPQ3_ACACA/232-322        AC L8GPQ3.1
#=GS A0A0M0JB82_9EUKA/232-325    AC A0A0M0JB82.1
#=GS G4ZT58_PHYSP/27-112         AC G4ZT58.1
#=GS A0A1Y2HST7_9FUNG/21-110     AC A0A1Y2HST7.1
#=GS G0QFB8_NANS0/16-102         AC G0QFB8.1
#=GS A0A135VYN5_9ARCH/235-339    AC A0A135VYN5.1
#=GS H0ERP3_GLAL7/17-111         AC H0ERP3.1
#=GS A0A1A6HSN5_NEOLE/30-98      AC A0A1A6HSN5.1
#=GS A0A0A2VU65_BEABA/21-107     AC A0A0A2VU65.1
#=GS A2DI07_TRIVA/20-103         AC A2DI07.1
#=GS A0A162R9D5_MUCCL/228-307    AC A0A162R9D5.1
#=GS A0A0E0F2E3_9ORYZ/722-807    AC A0A0E0F2E3.1
#=GS A0A0J9EAQ8_9RHOB/16-99      AC A0A0J9EAQ8.1
#=GS A0A1I8F2I1_9PLAT/38-105     AC A0A1I8F2I1.1
#=GS A0A1Y2DLM8_9PEZI/226-312    AC A0A1Y2DLM8.1
#=GS A7TPM0_VANPO/16-106         AC A7TPM0.1
#=GS W2GJS6_PHYPR/17-105         AC W2GJS6.1
#=GS G1NA41_MELGA/17-114         AC G1NA41.2
#=GS S9WQI4_CAMFR/1-92           AC S9WQI4.1
#=GS A0EAT4_PARTE/17-112         AC A0EAT4.1
#=GS A0A1U8PQ91_GOSHI/17-113     AC A0A1U8PQ91.1
#=GS A0A0N0RXU2_9EURO/229-311    AC A0A0N0RXU2.1
#=GS I1JS37_SOYBN/21-102         AC I1JS37.1
#=GS A0A024VN04_PLAFA/9-66       AC A0A024VN04.1
#=GS G8JV68_ERECY/229-311        AC G8JV68.1
#=GS B5DGC7_SALSA/231-314        AC B5DGC7.1
#=GS V9EUP6_PHYPR/27-114         AC V9EUP6.1
#=GS M4C7I1_BRARP/234-318        AC M4C7I1.1
#=GS A0A1D6FKX5_MAIZE/25-119     AC A0A1D6FKX5.1
#=GS Q9HL72_THEAC/10-105         AC Q9HL72.1
#=GS B9SEJ7_RICCO/21-109         AC B9SEJ7.1
#=GS A0A1U8L658_GOSHI/22-113     AC A0A1U8L658.1
#=GS A0A0L9UA58_PHAAN/211-295    AC A0A0L9UA58.1
#=GS A2WLK9_ORYSI/17-113         AC A2WLK9.1
#=GS A0A0G4NWQ8_PENCA/17-107     AC A0A0G4NWQ8.1
#=GS A0A022R988_ERYGU/17-114     AC A0A022R988.1
#=GS A0A2G2Z109_CAPAN/17-114     AC A0A2G2Z109.1
#=GS A0A2H3U1X8_FUSOX/17-109     AC A0A2H3U1X8.1
#=GS A0A0D2HGP3_9EURO/17-113     AC A0A0D2HGP3.1
#=GS A0A137R1G9_9AGAR/21-109     AC A0A137R1G9.1
#=GS RLA2_ASPFU/17-110           AC Q9UUZ6.2
#=GS A0A1Y1VD95_9FUNG/17-107     AC A0A1Y1VD95.1
#=GS A0A135UZE1_9PEZI/21-108     AC A0A135UZE1.1
#=GS I3J4E9_ORENI/17-113         AC I3J4E9.1
#=GS A0A1S3V1S5_VIGRR/17-113     AC A0A1S3V1S5.1
#=GS F7GPD3_CALJA/22-113         AC F7GPD3.1
#=GS G9NNF9_HYPAI/17-109         AC G9NNF9.1
#=GS I2JTS8_DEKBR/23-113         AC I2JTS8.1
#=GS A0A287CUL9_ICTTR/205-285    AC A0A287CUL9.1
#=GS A7TRI9_VANPO/20-105         AC A7TRI9.1
#=GS F2PTP8_TRIEC/229-310        AC F2PTP8.1
#=GS A0A251UPU1_HELAN/234-320    AC A0A251UPU1.1
#=GS G3B2H7_CANTC/24-114         AC G3B2H7.1
#=GS A0A1S3E560_CICAR/87-174     AC A0A1S3E560.1
#=GS A0A0E0Q290_ORYRU/57-118     AC A0A0E0Q290.1
#=GS K0KCA6_WICCF/20-111         AC K0KCA6.1
#=GS V4MWJ8_EUTSA/22-112         AC V4MWJ8.1
#=GS A0A0Q0VR99_9EURY/16-103     AC A0A0Q0VR99.1
#=GS A0A0F4ZHZ3_9PEZI/229-312    AC A0A0F4ZHZ3.1
#=GS G2YZN2_BOTF4/229-311        AC G2YZN2.1
#=GS RLA4_SCHPO/17-109           AC P17478.1
#=GS A0A150FUL6_GONPE/21-106     AC A0A150FUL6.1
#=GS A0A1R3RPW4_ASPC5/17-104     AC A0A1R3RPW4.1
#=GS A0A0K9PTP6_ZOSMR/17-110     AC A0A0K9PTP6.1
#=GS A0A093Q1J4_9PASS/231-317    AC A0A093Q1J4.1
#=GS A0A1S3XMA7_TOBAC/17-110     AC A0A1S3XMA7.1
#=GS A0A074VQP9_9PEZI/21-108     AC A0A074VQP9.1
#=GS A0A099P603_PICKU/229-306    AC A0A099P603.1
#=GS Q5I7K5_WHEAT/21-109         AC Q5I7K5.1
#=GS E1RJY9_METP4/16-102         AC E1RJY9.1
#=GS H1VUX6_COLHI/17-109         AC H1VUX6.1
#=GS M2Y4X8_GALSU/230-318        AC M2Y4X8.1
#=GS A0A218W393_PUNGR/234-319    AC A0A218W393.1
#=GS A9U0Z9_PHYPA/17-114         AC A9U0Z9.1
#=GS A0A182P931_9DIPT/231-314    AC A0A182P931.2
#=GS A0A1Q9BWW4_SYMMI/23-119     AC A0A1Q9BWW4.1
#=GS A0A1I7VVN4_LOALO/60-159     AC A0A1I7VVN4.1
#=GS A0A2B7Z3Z2_9EURO/21-107     AC A0A2B7Z3Z2.1
#=GS A0A0D2SI41_GOSRA/23-110     AC A0A0D2SI41.1
#=GS D5U264_THEAM/16-104         AC D5U264.1
#=GS Q6P5K5_DANRE/22-112         AC Q6P5K5.1
#=GS B5DGX0_SALSA/17-112         AC B5DGX0.1
#=GS G8YNS3_PICSO/17-107         AC G8YNS3.1
#=GS B2ATQ3_PODAN/17-110         AC B2ATQ3.1
#=GS W6YB45_COCCA/21-119         AC W6YB45.1
#=GS Q69UI8_ORYSJ/21-109         AC Q69UI8.1
#=GS A0A0U1LS43_TALIS/21-110     AC A0A0U1LS43.1
#=GS A0A218XP16_PUNGR/10-119     AC A0A218XP16.1
#=GS A0A1S2Y8Z9_CICAR/234-321    AC A0A1S2Y8Z9.1
#=GS A0A1V4L2F9_PATFA/22-64      AC A0A1V4L2F9.1
#=GS A0A0F4Z4N1_TALEM/229-311    AC A0A0F4Z4N1.1
#=GS A0A0D2H0D6_9EURO/21-113     AC A0A0D2H0D6.1
#=GS A0A182X1D6_ANOQN/23-112     AC A0A182X1D6.1
#=GS A0A0D2QAP7_GOSRA/17-112     AC A0A0D2QAP7.1
#=GS B3L4A3_PLAKH/19-110         AC B3L4A3.1
#=GS A0A168PKS2_ABSGL/24-88      AC A0A168PKS2.1
#=GS A0A074T1Q0_HAMHA/19-112     AC A0A074T1Q0.1
#=GS A0A0B0MDL8_GOSAR/17-119     AC A0A0B0MDL8.1
#=GS A0A0L0T5V5_ALLMA/17-107     AC A0A0L0T5V5.1
#=GS A0A2H9NWR6_9ARCH/9-104      AC A0A2H9NWR6.1
#=GS W4ZQ59_WHEAT/17-112         AC W4ZQ59.1
#=GS A0A1G4JK94_9SACH/17-105     AC A0A1G4JK94.1
#=GS A0A0D3B7B5_BRAOL/17-113     AC A0A0D3B7B5.1
#=GS W5JPX9_ANODA/23-101         AC W5JPX9.1
#=GS A9P894_POPTR/17-113         AC A9P894.1
#=GS A0A0D3F5X5_9ORYZ/402-497    AC A0A0D3F5X5.1
#=GS J9FK46_9SPIT/60-140         AC J9FK46.1
#=GS A0A0D3CLR0_BRAOL/233-320    AC A0A0D3CLR0.1
#=GS V4M9T3_EUTSA/209-296        AC V4M9T3.1
#=GS D7LEE5_ARALL/234-316        AC D7LEE5.1
#=GS A0A1Y3ACG0_9EURY/16-113     AC A0A1Y3ACG0.1
#=GS F4R3M9_MELLP/229-309        AC F4R3M9.1
#=GS A0A1S3TZJ4_VIGRR/21-111     AC A0A1S3TZJ4.1
#=GS A0A2A2L4J1_9BILA/17-112     AC A0A2A2L4J1.1
#=GS A0A196SNE7_BLAHN/234-318    AC A0A196SNE7.1
#=GS A0A179FY22_METCM/229-312    AC A0A179FY22.1
#=GS I3EDG3_NEMP3/17-100         AC I3EDG3.1
#=GS A0A182WVR6_ANOQN/231-313    AC A0A182WVR6.1
#=GS RL12_METJA/16-101           AC P54048.1
#=GS A0A1Y1WDH5_9FUNG/21-106     AC A0A1Y1WDH5.1
#=GS W9YCK1_9EURO/17-112         AC W9YCK1.1
#=GS A0A1E7GB07_9EURY/16-101     AC A0A1E7GB07.1
#=GS E7Q766_YEASB/229-311        AC E7Q766.1
#=GS A0A2K5KHQ3_CERAT/17-114     AC A0A2K5KHQ3.1
#=GS A3LPG9_PICST/20-106         AC A3LPG9.1
#=GS A0A078JAM1_BRANA/234-317    AC A0A078JAM1.1
#=GS A0A1V6Y2X6_PENNA/17-108     AC A0A1V6Y2X6.1
#=GS M7ZWX9_TRIUA/13-119         AC M7ZWX9.1
#=GS A0A0D0AC10_9HOMO/21-111     AC A0A0D0AC10.1
#=GS L9KWE4_TUPCH/13-90          AC L9KWE4.1
#=GS A0A1Y2FGH4_9ASCO/17-109     AC A0A1Y2FGH4.1
#=GS G0S079_CHATD/17-111         AC G0S079.1
#=GS A0A0A1N974_9FUNG/20-106     AC A0A0A1N974.1
#=GS L5KN85_PTEAL/17-114         AC L5KN85.1
#=GS A0A1D6FPC0_MAIZE/40-121     AC A0A1D6FPC0.1
#=GS A4H3L0_LEIBR/21-105         AC A4H3L0.2
#=GS A0A1J6IH17_NICAT/22-111     AC A0A1J6IH17.1
#=GS R0FYN6_9BRAS/17-113         AC R0FYN6.1
#=GS RLA03_ARATH/233-320         AC P57691.1
#=GS L5KF91_PTEAL/141-216        AC L5KF91.1
#=GS A0A1A8VZC5_PLAMA/32-118     AC A0A1A8VZC5.1
#=GS A0A1E4TFQ6_9ASCO/20-108     AC A0A1E4TFQ6.1
#=GS D8LP25_ECTSI/194-276        AC D8LP25.1
#=GS A0A2I3FRW1_NOMLE/161-230    AC A0A2I3FRW1.1
#=GS A0A166DPC9_9EURY/16-100     AC A0A166DPC9.1
#=GS I1C401_RHIO9/20-105         AC I1C401.1
#=GS A0A0D2VSS8_GOSRA/186-272    AC A0A0D2VSS8.1
#=GS A0A1Y1YV42_9FUNG/20-105     AC A0A1Y1YV42.1
#=GS D7FZX8_ECTSI/66-150         AC D7FZX8.1
#=GS A0A0L0N2X0_9HYPO/21-97      AC A0A0L0N2X0.1
#=GS M0C479_9EURY/30-119         AC M0C479.1
#=GS A0A147K0F9_9EURY/16-99      AC A0A147K0F9.1
#=GS A0A1U7Z0P0_NELNU/17-113     AC A0A1U7Z0P0.1
#=GS G9MJN9_HYPVG/21-107         AC G9MJN9.1
#=GS A0A0M9G6H9_9TRYP/16-106     AC A0A0M9G6H9.1
#=GS W7JSZ3_PLAFO/231-315        AC W7JSZ3.1
#=GS N1JC20_BLUG1/21-109         AC N1JC20.1
#=GS A0A0H1B6I4_9EURO/17-71      AC A0A0H1B6I4.1
#=GS L9VME7_9EURY/16-113         AC L9VME7.1
#=GS S7QDW7_MYOBR/36-121         AC S7QDW7.1
#=GS A0A1S4B492_TOBAC/22-114     AC A0A1S4B492.1
#=GS A9P8R9_POPTR/21-109         AC A9P8R9.1
#=GS G0W5B5_NAUDC/16-105         AC G0W5B5.1
#=GS A0A0B7NHQ5_9FUNG/17-102     AC A0A0B7NHQ5.1
#=GS E9DE71_COCPS/229-311        AC E9DE71.1
#=GS A0A1V8UUC9_9PEZI/17-112     AC A0A1V8UUC9.1
#=GS A0A0L0V2H7_9BASI/17-112     AC A0A0L0V2H7.1
#=GS G3QN05_GORGO/18-88          AC G3QN05.2
#=GS A0A0A2IJH7_PENEN/229-311    AC A0A0A2IJH7.1
#=GS W7TDP6_9STRA/29-116         AC W7TDP6.1
#=GS A0A1B8C4V5_9PEZI/229-311    AC A0A1B8C4V5.1
#=GS A0A0B2UJS3_9MICR/16-102     AC A0A0B2UJS3.1
#=GS Q7S796_NEUCR/21-108         AC Q7S796.1
#=GS A0A085MBM8_9BILA/17-112     AC A0A085MBM8.1
#=GS A0A1G4AWP6_9PEZI/17-110     AC A0A1G4AWP6.1
#=GS Q5CRL2_CRYPI/32-121         AC Q5CRL2.1
#=GS M7TCF8_9EURY/16-100         AC M7TCF8.1
#=GS A0A100IL88_ASPNG/17-109     AC A0A100IL88.1
#=GS A0A1L9TCF4_9EURO/229-311    AC A0A1L9TCF4.1
#=GS A0A0L0SVI2_ALLMA/21-74      AC A0A0L0SVI2.1
#=GS C5M7W4_CANTT/17-109         AC C5M7W4.1
#=GS A0A218V367_9PASE/231-317    AC A0A218V367.1
#=GS D7M357_ARALL/20-84          AC D7M357.1
#=GS L8HHW3_ACACA/30-120         AC L8HHW3.1
#=GS J3KX68_ORYBR/175-270        AC J3KX68.1
#=GS A0A0A1NW39_9FUNG/17-107     AC A0A0A1NW39.1
#=GS V6TW26_GIAIN/17-107         AC V6TW26.1
#=GS U6GIL0_EIMAC/19-112         AC U6GIL0.1
#=GS A0A1C7N3E0_9FUNG/17-108     AC A0A1C7N3E0.1
#=GS J4CCW5_THEOR/19-109         AC J4CCW5.1
#=GS A0A1Q6DTC4_9EURY/16-99      AC A0A1Q6DTC4.1
#=GS Q5B161_EMENI/21-108         AC Q5B161.1
#=GS C5DQ37_ZYGRC/20-107         AC C5DQ37.1
#=GS A0A061HIZ5_BLUGR/17-109     AC A0A061HIZ5.1
#=GS A0A1I8CDQ7_9BILA/17-107     AC A0A1I8CDQ7.1
#=GS A0A0E0F294_9ORYZ/228-313    AC A0A0E0F294.1
#=GS A0A1E4RRL4_9ASCO/229-310    AC A0A1E4RRL4.1
#=GS H9B912_EIMTE/32-121         AC H9B912.1
#=GS A0A151GML1_9HYPO/229-311    AC A0A151GML1.1
#=GS A0A178AEL0_9PLEO/23-114     AC A0A178AEL0.1
#=GS A0A0M3I7Q6_ASCLU/17-116     AC A0A0M3I7Q6.1
#=GS A0A0Q3MBG8_AMAAE/78-175     AC A0A0Q3MBG8.1
#=GS R9P2N1_PSEHS/52-138         AC R9P2N1.1
#=GS A0A0D2MTN5_9CHLO/21-105     AC A0A0D2MTN5.1
#=GS D8S0E7_SELML/33-119         AC D8S0E7.1
#=GS A0A1I8IGI2_9PLAT/24-113     AC A0A1I8IGI2.1
#=GS A0A0C9MD30_9FUNG/17-106     AC A0A0C9MD30.1
#=GS G2YND2_BOTF4/17-110         AC G2YND2.1
#=GS R1BXG8_EMIHU/66-128         AC R1BXG8.1
#=GS A0A1U7ZST4_NELNU/234-318    AC A0A1U7ZST4.1
#=GS B0CUH7_LACBS/17-111         AC B0CUH7.1
#=GS A0A1D6FKZ1_MAIZE/25-119     AC A0A1D6FKZ1.1
#=GS A0A067NRR6_PLEOS/17-111     AC A0A067NRR6.1
#=GS A0A1J9REG0_9PEZI/229-312    AC A0A1J9REG0.1
#=GS A0A0P7BLS0_9HYPO/229-311    AC A0A0P7BLS0.1
#=GS C5KMM7_PERM5/17-108         AC C5KMM7.1
#=GS A0A1E3QGY1_9ASCO/20-105     AC A0A1E3QGY1.1
#=GS A0A0R3T310_HYMNN/22-117     AC A0A0R3T310.1
#=GS A0A0C7N2Z3_9SACH/19-105     AC A0A0C7N2Z3.1
#=GS A0A0D7B7R6_9AGAR/20-107     AC A0A0D7B7R6.1
#=GS A0A087S8N5_9ARCH/16-104     AC A0A087S8N5.1
#=GS W5MX37_LEPOC/17-113         AC W5MX37.1
#=GS H2AWZ4_KAZAF/20-106         AC H2AWZ4.1
#=GS K3ZAW7_SETIT/17-111         AC K3ZAW7.1
#=GS A0A0F2M121_SPOSC/229-311    AC A0A0F2M121.1
#=GS A0A0D9ZZX9_9ORYZ/17-112     AC A0A0D9ZZX9.1
#=GS A0A137PF35_CONC2/17-108     AC A0A137PF35.1
#=GS S7MGA9_MYOBR/17-114         AC S7MGA9.1
#=GS A0A166C8D7_DAUCA/86-182     AC A0A166C8D7.1
#=GS A0A183KFV1_9TREM/17-112     AC A0A183KFV1.1
#=GS A0A1U7LWC9_9ASCO/21-108     AC A0A1U7LWC9.1
#=GS F6VQ14_HORSE/22-113         AC F6VQ14.1
#=GS A0A1G4M880_LACFM/229-310    AC A0A1G4M880.1
#=GS D4AQF6_ARTBC/17-112         AC D4AQF6.1
#=GS A0A096MLS9_PAPAN/15-111     AC A0A096MLS9.2
#=GS D7DR74_METV3/238-336        AC D7DR74.1
#=GS A0A1S2Z7B4_CICAR/21-111     AC A0A1S2Z7B4.1
#=GS A0A1G4IT97_9SACH/17-109     AC A0A1G4IT97.1
#=GS V4M5E8_EUTSA/22-112         AC V4M5E8.1
#=GS Q0CTP9_ASPTN/21-107         AC Q0CTP9.1
#=GS A0A2G5VTM5_9PELO/22-110     AC A0A2G5VTM5.1
#=GS A0A0D2N962_9CHLO/233-312    AC A0A0D2N962.1
#=GS C1G5J1_PARBD/17-112         AC C1G5J1.1
#=GS W2T216_NECAM/231-304        AC W2T216.1
#=GS A0A183FF76_HELBK/17-109     AC A0A183FF76.1
#=GS X6MF38_RETFI/17-128         AC X6MF38.1
#=GS A0A0P1B0G7_9STRA/231-311    AC A0A0P1B0G7.1
#=GS A0A0N4TX79_BRUPA/21-117     AC A0A0N4TX79.1
#=GS A0A093J7C0_EURHL/17-114     AC A0A093J7C0.1
#=GS A0A0N5D0F2_THECL/231-316    AC A0A0N5D0F2.1
#=GS E3NNU7_CAERE/17-106         AC E3NNU7.1
#=GS B8P0N4_POSPM/17-112         AC B8P0N4.1
#=GS A0A1J4JHT4_9EUKA/17-104     AC A0A1J4JHT4.1
#=GS Q8H3F5_ORYSJ/17-107         AC Q8H3F5.1
#=GS B8LU13_TALSN/21-110         AC B8LU13.1
#=GS A0A0B5HW48_ARCG5/16-101     AC A0A0B5HW48.1
#=GS RL10_PYRHO/233-341          AC O74109.1
#=GS RL10_PYRHO/233-341          DR PDB; 3A1Y G; 233-284;
#=GS A0A0N5A9D7_9BILA/17-113     AC A0A0N5A9D7.1
#=GS A0A1X2IEN1_9FUNG/228-308    AC A0A1X2IEN1.1
#=GS F1RYZ0_PIG/17-114           AC F1RYZ0.1
#=GS A0A0D3HR33_9ORYZ/795-880    AC A0A0D3HR33.1
#=GS A0A2G5U6B9_9PELO/17-109     AC A0A2G5U6B9.1
#=GS A0A1R2B392_9CILI/17-111     AC A0A1R2B392.1
#=GS A0A0K8LH41_9EURO/17-109     AC A0A0K8LH41.1
#=GS A0A162U7I4_PHYB8/17-107     AC A0A162U7I4.1
#=GS G1LBT5_AILME/14-100         AC G1LBT5.1
#=GS A0A1C7N841_9FUNG/17-107     AC A0A1C7N841.1
#=GS V4SWS1_9ROSI/48-143         AC V4SWS1.1
#=GS A0A2A2LXZ0_9BILA/22-111     AC A0A2A2LXZ0.1
#=GS A0A0V0X2Y4_9BILA/231-319    AC A0A0V0X2Y4.1
#=GS W5LAT6_ASTMX/17-115         AC W5LAT6.1
#=GS A9UW12_MONBE/229-309        AC A9UW12.1
#=GS A0A024WY34_PLAFA/19-108     AC A0A024WY34.1
#=GS Q201W9_ACYPI/231-313        AC Q201W9.1
#=GS A0A1R3I165_9ROSI/234-320    AC A0A1R3I165.1
#=GS A0A0C4E8M8_MAGP6/21-108     AC A0A0C4E8M8.1
#=GS F7EED9_MONDO/22-115         AC F7EED9.1
#=GS A0A196S8A5_BLAHN/27-96      AC A0A196S8A5.1
#=GS S9U7X0_9TRYP/224-312        AC S9U7X0.1
#=GS U5HIN6_USTV1/229-310        AC U5HIN6.1
#=GS A0A059JID4_9EURO/21-109     AC A0A059JID4.1
#=GS A0A2K5HSA0_COLAP/141-226    AC A0A2K5HSA0.1
#=GS A0A2H9LLC3_9ARCH/16-105     AC A0A2H9LLC3.1
#=GS A0A0B2V1V8_TOXCA/779-875    AC A0A0B2V1V8.1
#=GS M0NHP0_9EURY/16-111         AC M0NHP0.1
#=GS F0YNB0_AURAN/231-314        AC F0YNB0.1
#=GS E9ADB9_LEIMA/238-323        AC E9ADB9.1
#=GS W2RM11_9EURO/17-112         AC W2RM11.1
#=GS A0A0C2N4Z5_THEKT/17-109     AC A0A0C2N4Z5.1
#=GS A4H3L1_LEIBR/21-106         AC A4H3L1.1
#=GS B4N4U1_DROWI/231-316        AC B4N4U1.1
#=GS J9IP67_9SPIT/32-113         AC J9IP67.1
#=GS A0A182SL32_9DIPT/17-112     AC A0A182SL32.1
#=GS E3LY25_CAERE/22-110         AC E3LY25.1
#=GS K3WB98_PYTUL/29-111         AC K3WB98.1
#=GS A0A2I4DJA5_9ROSI/221-308    AC A0A2I4DJA5.1
#=GS A0A0E0LQM6_ORYPU/21-109     AC A0A0E0LQM6.1
#=GS K1VVH0_TRIAC/20-108         AC K1VVH0.1
#=GS A0A151U3E9_CAJCA/17-115     AC A0A151U3E9.1
#=GS A0A1E5RSW8_9ASCO/20-104     AC A0A1E5RSW8.1
#=GS H2Q9Q0_PANTR/22-113         AC H2Q9Q0.1
#=GS A0A081CIF0_PSEA2/17-111     AC A0A081CIF0.1
#=GS M5BUF3_THACB/17-61          AC M5BUF3.1
#=GS A0A219APW8_9EURY/16-101     AC A0A219APW8.1
#=GS A0A1E5RBV8_9ASCO/17-108     AC A0A1E5RBV8.1
#=GS Q6BKG1_DEBHA/229-309        AC Q6BKG1.1
#=GS C0NFV7_AJECG/97-190         AC C0NFV7.1
#=GS W4JZI6_9HOMO/17-110         AC W4JZI6.1
#=GS F0XM60_GROCL/21-106         AC F0XM60.1
#=GS S9W308_CAMFR/1-73           AC S9W308.1
#=GS A0A1M2V838_TRAPU/229-312    AC A0A1M2V838.1
#=GS E3GXB7_METFV/16-106         AC E3GXB7.1
#=GS A0A093UZA2_TALMA/229-312    AC A0A093UZA2.1
#=GS A0A1S3XWE6_TOBAC/22-111     AC A0A1S3XWE6.1
#=GS A0A194XQ09_9HELO/229-313    AC A0A194XQ09.1
#=GS A0A1Q3AN60_CEPFO/201-285    AC A0A1Q3AN60.1
#=GS A0A139IIM3_9PEZI/17-112     AC A0A139IIM3.1
#=GS U4LIW1_PYROM/21-111         AC U4LIW1.1
#=GS A0A1V4C3G4_9EURY/16-113     AC A0A1V4C3G4.1
#=GS A0A1G4MBX8_LACFM/17-105     AC A0A1G4MBX8.1
#=GS A2EXW1_TRIVA/20-103         AC A2EXW1.1
#=GS A0A1L9PI79_ASPVE/17-107     AC A0A1L9PI79.1
#=GS A0A200R5J5_9MAGN/21-108     AC A0A200R5J5.1
#=GS A0A0A0KEV8_CUCSA/38-133     AC A0A0A0KEV8.1
#=GS G3AVC0_SPAPN/229-311        AC G3AVC0.1
#=GS A0A0E0J9Y5_ORYNI/17-105     AC A0A0E0J9Y5.1
#=GS A0A2I0QJN0_9EURY/16-99      AC A0A2I0QJN0.1
#=GS R7S7G9_TRAVS/31-118         AC R7S7G9.1
#=GS C1N665_MICPC/20-107         AC C1N665.1
#=GS A0A1Y1XUG0_9FUNG/17-108     AC A0A1Y1XUG0.1
#=GS I1CTB0_RHIO9/17-107         AC I1CTB0.1
#=GS A0A287DFY5_ICTTR/225-299    AC A0A287DFY5.1
#=GS C3Z9A6_BRAFL/17-114         AC C3Z9A6.1
#=GS A0A135TLR7_9PEZI/229-313    AC A0A135TLR7.1
#=GS G7DUM9_MIXOS/1-64           AC G7DUM9.1
#=GS E9HEV2_DAPPU/24-114         AC E9HEV2.1
#=GS A0A183C080_GLOPA/68-160     AC A0A183C080.1
#=GS Q5JH09_THEKO/16-105         AC Q5JH09.1
#=GS E7KM36_YEASL/17-109         AC E7KM36.1
#=GS A0A0C2W484_9HOMO/17-114     AC A0A0C2W484.1
#=GS A0A0A1SRQ6_9HYPO/21-108     AC A0A0A1SRQ6.1
#=GS A0A1U8NXW5_GOSHI/22-113     AC A0A1U8NXW5.1
#=GS RLA2_PLAF7/19-111           AC O00806.1
#=GS A0A1S3Z2P9_TOBAC/21-111     AC A0A1S3Z2P9.1
#=GS A0A162V479_PHYB8/20-105     AC A0A162V479.1
#=GS A0A0V0R719_PSEPJ/17-106     AC A0A0V0R719.1
#=GS E0SP24_IGNAA/16-108         AC E0SP24.1
#=GS A0A1S4C2S4_TOBAC/22-113     AC A0A1S4C2S4.1
#=GS D7LJ06_ARALL/17-113         AC D7LJ06.1
#=GS A0A1A9WHA0_9MUSC/231-310    AC A0A1A9WHA0.1
#=GS A0A1I8AJV9_9BILA/231-312    AC A0A1I8AJV9.1
#=GS A7AP88_BABBO/32-117         AC A7AP88.1
#=GS U3JYW6_FICAL/231-317        AC U3JYW6.1
#=GS G3XRX2_ASPNA/229-311        AC G3XRX2.1
#=GS G7L532_MEDTR/21-111         AC G7L532.1
#=GS A9A571_NITMS/16-104         AC A9A571.1
#=GS A0A0P0N1D1_9CREN/16-106     AC A0A0P0N1D1.1
#=GS M3Z077_MUSPF/22-113         AC M3Z077.1
#=GS A8MAF5_CALMQ/16-107         AC A8MAF5.1
#=GS W2SSC6_NECAM/17-110         AC W2SSC6.1
#=GS A0A0F8AUE9_LARCR/342-424    AC A0A0F8AUE9.1
#=GS A0A022RSL9_ERYGU/154-241    AC A0A022RSL9.1
#=GS A0A1U8AM89_NELNU/21-111     AC A0A1U8AM89.1
#=GS A0A139AQU1_GONPR/25-120     AC A0A139AQU1.1
#=GS A0A1F7ZU57_9EURO/229-312    AC A0A1F7ZU57.1
#=GS E7Q1V7_YEASB/20-106         AC E7Q1V7.1
#=GS A0A0A1MWW4_9FUNG/17-107     AC A0A0A1MWW4.1
#=GS A0A1D6LEZ8_MAIZE/126-209    AC A0A1D6LEZ8.1
#=GS A3GHH7_PICST/17-109         AC A3GHH7.1
#=GS M7UXI7_BOTF1/38-126         AC M7UXI7.1
#=GS A0A0D2FI72_9EURO/21-112     AC A0A0D2FI72.1
#=GS R1DDL6_EMIHU/36-131         AC R1DDL6.1
#=GS T0S7C6_9STRA/17-106         AC T0S7C6.1
#=GS W6YZ41_COCCA/229-313        AC W6YZ41.1
#=GS A0A1Y1IT36_KLENI/21-111     AC A0A1Y1IT36.1
#=GS A0A1I7S124_BURXY/295-383    AC A0A1I7S124.1
#=GS Q6FYB0_CANGA/17-108         AC Q6FYB0.1
#=GS A0A1J4MPM3_9CRYT/32-121     AC A0A1J4MPM3.1
#=GS M4EZX0_BRARP/17-112         AC M4EZX0.1
#=GS A0A1D6C207_WHEAT/21-108     AC A0A1D6C207.1
#=GS C0NGD9_AJECG/21-109         AC C0NGD9.1
#=GS A0A093YJ89_9PEZI/54-141     AC A0A093YJ89.1
#=GS A0A2K5JRF0_COLAP/198-280    AC A0A2K5JRF0.1
#=GS E9DTT9_METAQ/229-312        AC E9DTT9.1
#=GS M1CWA9_SOLTU/194-278        AC M1CWA9.1
#=GS A0A095D1X4_CRYGR/20-108     AC A0A095D1X4.1
#=GS A0A068RSE0_9FUNG/228-306    AC A0A068RSE0.1
#=GS RLA0L_HUMAN/231-316         AC Q8NHW5.1
#=GS A0A0G2HQ33_9EURO/229-309    AC A0A0G2HQ33.1
#=GS A0A182JXU0_9DIPT/17-112     AC A0A182JXU0.1
#=GS A0A1Z5JP38_FISSO/231-316    AC A0A1Z5JP38.1
#=GS W4KC26_9HOMO/21-109         AC W4KC26.1
#=GS W6LEY0_9TRYP/19-106         AC W6LEY0.1
#=GS A0A0L8GF80_OCTBM/203-291    AC A0A0L8GF80.1
#=GS A0A1S3ZEB9_TOBAC/234-320    AC A0A1S3ZEB9.1
#=GS J3JU33_DENPD/231-314        AC J3JU33.1
#=GS A0A167FL90_9ASCO/229-311    AC A0A167FL90.1
#=GS A0A1E4SZI0_9ASCO/17-109     AC A0A1E4SZI0.1
#=GS A0A091KU98_9GRUI/17-92      AC A0A091KU98.1
#=GS E6ZJZ5_SPORE/21-109         AC E6ZJZ5.1
#=GS A0A179UL05_BLAGS/17-111     AC A0A179UL05.1
#=GS A0A1R1X2Z8_9FUNG/17-108     AC A0A1R1X2Z8.1
#=GS A0A158NC71_ATTCE/17-113     AC A0A158NC71.1
#=GS J3KKX6_COCIM/17-110         AC J3KKX6.2
#=GS A0A154PNH0_9HYME/342-439    AC A0A154PNH0.1
#=GS I2JXV1_DEKBR/229-312        AC I2JXV1.1
#=GS G1Q5B0_MYOLU/20-104         AC G1Q5B0.1
#=GS V4ZKD7_9ARCH/16-110         AC V4ZKD7.1
#=GS C5L4D5_PERM5/234-317        AC C5L4D5.1
#=GS T1J5D9_STRMM/21-104         AC T1J5D9.1
#=GS I3LFV6_PIG/17-95            AC I3LFV6.2
#=GS N1QLX2_SPHMS/17-111         AC N1QLX2.1
#=GS A0A136J450_9PEZI/17-110     AC A0A136J450.1
#=GS A0A182RZI1_ANOFN/231-314    AC A0A182RZI1.2
#=GS F7B9V8_MONDO/231-316        AC F7B9V8.1
#=GS I1NLK6_ORYGL/57-118         AC I1NLK6.1
#=GS F0TCS7_METLA/16-99          AC F0TCS7.1
#=GS Q4N920_THEPA/240-320        AC Q4N920.1
#=GS F7VKW3_SORMK/229-311        AC F7VKW3.1
#=GS A0A183F257_HELBK/231-312    AC A0A183F257.1
#=GS G3W303_SARHA/1-60           AC G3W303.1
#=GS A0A1Y2GK74_9FUNG/19-105     AC A0A1Y2GK74.1
#=GS A0A182Q3T5_9DIPT/17-112     AC A0A182Q3T5.1
#=GS A0A2I4GQ42_9ROSI/234-320    AC A0A2I4GQ42.1
#=GS A0A091E3U1_FUKDA/22-113     AC A0A091E3U1.1
#=GS B5XDP1_SALSA/231-314        AC B5XDP1.1
#=GS A0A0D2JGV7_9CHLO/17-106     AC A0A0D2JGV7.1
#=GS A0A1I7T851_9PELO/17-107     AC A0A1I7T851.1
#=GS H3B2A6_LATCH/22-111         AC H3B2A6.1
#=GS RLA24_ARATH/17-110          AC Q9LXM8.1
#=GS L0AWH6_THEEQ/19-109         AC L0AWH6.1
#=GS A2DHM5_TRIVA/200-283        AC A2DHM5.1
#=GS L8H6U1_ACACA/17-116         AC L8H6U1.1
#=GS S9VTD5_SCHCR/83-168         AC S9VTD5.1
#=GS B4FI88_MAIZE/17-111         AC B4FI88.1
#=GS A0A0E0IXV6_ORYNI/327-412    AC A0A0E0IXV6.1
#=GS RLA2_SCHPO/17-109           AC P08094.1
#=GS A0A0N0PCL6_PAPMA/67-161     AC A0A0N0PCL6.1
#=GS H3BGD3_LATCH/231-311        AC H3BGD3.1
#=GS W6UYY1_ECHGR/64-168         AC W6UYY1.1
#=GS X6MXC2_RETFI/29-114         AC X6MXC2.1
#=GS G3IA30_CRIGR/22-113         AC G3IA30.1
#=GS R0GL02_9BRAS/77-173         AC R0GL02.1
#=GS A0A0D9X433_9ORYZ/234-319    AC A0A0D9X433.1
#=GS G1TRW6_RABIT/17-88          AC G1TRW6.1
#=GS A0A1B8E1V6_9PEZI/21-108     AC A0A1B8E1V6.1
#=GS A0A2H9LAG7_9ARCH/16-97      AC A0A2H9LAG7.1
#=GS A0A2K1Y7P5_POPTR/1-87       AC A0A2K1Y7P5.1
#=GS A0A287AJ36_PIG/21-103       AC A0A287AJ36.1
#=GS G3BEH3_CANTC/265-349        AC G3BEH3.1
#=GS W1NDZ0_AMBTC/21-111         AC W1NDZ0.1
#=GS W5I301_WHEAT/33-119         AC W5I301.1
#=GS A0A1V6TGX7_9EURO/21-106     AC A0A1V6TGX7.1
#=GS A0A1S3W2Q3_ERIEU/22-109     AC A0A1S3W2Q3.1
#=GS A0A1E4SLM7_9ASCO/17-106     AC A0A1E4SLM7.1
#=GS A0A061GYX7_THECC/7-79       AC A0A061GYX7.1
#=GS A0A1L9SJX0_9EURO/21-107     AC A0A1L9SJX0.1
#=GS A0A074X240_9PEZI/17-109     AC A0A074X240.1
#=GS Q16VR0_AEDAE/47-88          AC Q16VR0.1
#=GS A0A1B8GQN4_9PEZI/17-109     AC A0A1B8GQN4.1
#=GS A0A250XP39_9CHLO/233-313    AC A0A250XP39.1
#=GS A5DAS4_PICGU/229-309        AC A5DAS4.1
#=GS L8HCT7_ACACA/27-121         AC L8HCT7.1
#=GS E3MRJ2_CAERE/17-106         AC E3MRJ2.1
#=GS A0A1L9WXS0_ASPAC/229-311    AC A0A1L9WXS0.1
#=GS V5FLF3_BYSSN/17-107         AC V5FLF3.1
#=GS A0A0U1M965_TALIS/17-110     AC A0A0U1M965.1
#=GS H2MY80_ORYLA/22-112         AC H2MY80.1
#=GS A0A0L0NDZ0_9HYPO/17-109     AC A0A0L0NDZ0.1
#=GS A0A074TDT9_HAMHA/232-313    AC A0A074TDT9.1
#=GS A0A0E0LFA5_ORYPU/61-118     AC A0A0E0LFA5.1
#=GS H0GT96_SACCK/17-110         AC H0GT96.1
#=GS A0A066XRG7_COLSU/21-109     AC A0A066XRG7.1
#=GS A0A1R3J2Q2_9ROSI/17-112     AC A0A1R3J2Q2.1
#=GS F6VR08_CALJA/231-317        AC F6VR08.1
#=GS A0A1J7IM32_LUPAN/21-109     AC A0A1J7IM32.1
#=GS A0A0N4W4T8_HAEPC/17-111     AC A0A0N4W4T8.1
#=GS A0A150J3R7_9EURY/16-102     AC A0A150J3R7.1
#=GS I1IXG5_BRADI/17-112         AC I1IXG5.1
#=GS A0A158PCV1_ANGCA/231-312    AC A0A158PCV1.1
#=GS A0A026WSS2_OOCBI/17-112     AC A0A026WSS2.1
#=GS A0A0D0CNL4_9AGAR/17-111     AC A0A0D0CNL4.1
#=GS A0A2G3AJI4_CAPAN/17-111     AC A0A2G3AJI4.1
#=GS A0A1D6LEZ6_MAIZE/132-215    AC A0A1D6LEZ6.1
#=GS K1QWX2_CRAGI/231-313        AC K1QWX2.1
#=GS A0A2I4E645_9ROSI/34-131     AC A0A2I4E645.1
#=GS A0A1A6HUS9_NEOLE/43-80      AC A0A1A6HUS9.1
#=GS A0A1V6NP66_9EURO/21-106     AC A0A1V6NP66.1
#=GS A0A0L0FZJ3_9EUKA/21-106     AC A0A0L0FZJ3.1
#=GS A9PDS2_POPTR/21-108         AC A9PDS2.1
#=GS C4Y8D5_CLAL4/20-105         AC C4Y8D5.1
#=GS G5B782_HETGA/231-316        AC G5B782.1
#=GS M5G0B2_DACPD/21-112         AC M5G0B2.1
#=GS B7FV43_PHATC/27-113         AC B7FV43.1
#=GS A0A1H3DKR3_9EURY/16-110     AC A0A1H3DKR3.1
#=GS A0A0E3S6G0_9EURY/16-101     AC A0A0E3S6G0.1
#=GS K1VVK3_TRIAC/17-110         AC K1VVK3.1
#=GS A0A133UX79_9EURY/16-106     AC A0A133UX79.1
#=GS T2DPD1_PHAVU/21-111         AC T2DPD1.1
#=GS Q0TZB5_PHANO/229-315        AC Q0TZB5.1
#=GS M2W1D9_GALSU/18-114         AC M2W1D9.1
#=GS H0XI84_OTOGA/17-114         AC H0XI84.1
#=GS A4HRV4_LEIIN/21-110         AC A4HRV4.1
#=GS A0A0D9S5Q0_CHLSB/223-306    AC A0A0D9S5Q0.1
#=GS A0A075AD76_9TREM/519-589    AC A0A075AD76.1
#=GS A0A2I3MMC5_PAPAN/231-316    AC A0A2I3MMC5.1
#=GS V7CTV4_PHAVU/21-113         AC V7CTV4.1
#=GS B2WCC3_PYRTR/229-314        AC B2WCC3.1
#=GS K5X6P0_AGABU/229-311        AC K5X6P0.1
#=GS A0A061DRB7_THECC/55-124     AC A0A061DRB7.1
#=GS RLA1_CHICK/22-113           AC P18660.1
#=GS J3KEF3_COCIM/229-311        AC J3KEF3.2
#=GS A0A1R0GLY5_9FUNG/21-107     AC A0A1R0GLY5.1
#=GS A0A151B8Y5_9ARCH/18-100     AC A0A151B8Y5.1
#=GS A0A0D7BIE2_9AGAR/17-110     AC A0A0D7BIE2.1
#=GS A0A0L0S0X3_ALLMA/17-106     AC A0A0L0S0X3.1
#=GS A0A175WEH6_9PEZI/21-108     AC A0A175WEH6.1
#=GS A0A1S9D6K4_ASPOZ/21-108     AC A0A1S9D6K4.1
#=GS G0NE77_CAEBE/1-62           AC G0NE77.1
#=GS A0A1V6PXR3_9EURO/17-108     AC A0A1V6PXR3.1
#=GS C1EI19_MICCC/20-105         AC C1EI19.1
#=GS E6QYA8_CRYGW/62-150         AC E6QYA8.1
#=GS A0A1C1WQL9_9PEZI/17-104     AC A0A1C1WQL9.1
#=GS A0A094EWP3_9PEZI/61-138     AC A0A094EWP3.1
#=GS A0A2K1JIQ7_PHYPA/22-104     AC A0A2K1JIQ7.1
#=GS A5DM65_PICGU/17-110         AC A5DM65.1
#=GS W9Y6L2_9EURO/17-113         AC W9Y6L2.1
#=GS A0A1I7VB74_LOALO/21-116     AC A0A1I7VB74.1
#=GS A0A194VS72_9PEZI/229-313    AC A0A194VS72.1
#=GS A0A1A8WEG8_9APIC/32-118     AC A0A1A8WEG8.1
#=GS A0A0D3GVS4_9ORYZ/53-103     AC A0A0D3GVS4.1
#=GS A0A1R0GNF7_9FUNG/17-110     AC A0A1R0GNF7.1
#=GS A0A2K5KEW8_COLAP/177-263    AC A0A2K5KEW8.1
#=GS G1MLY7_AILME/22-101         AC G1MLY7.1
#=GS A0A151TVN8_CAJCA/17-109     AC A0A151TVN8.1
#=GS A0A1J4KUV5_9EUKA/21-105     AC A0A1J4KUV5.1
#=GS A0A2G9GDV3_9LAMI/17-115     AC A0A2G9GDV3.1
#=GS V6ARN0_9ARCH/16-99          AC V6ARN0.1
#=GS RLA0_SOYBN/234-319          AC P50346.1
#=GS D7MMU1_ARALL/25-119         AC D7MMU1.1
#=GS A0A0D2XZ60_FUSO4/17-109     AC A0A0D2XZ60.1
#=GS A0A1R0GV46_9FUNG/228-315    AC A0A1R0GV46.1
#=GS I1I0P9_BRADI/234-319        AC I1I0P9.1
#=GS A0A1Y1YA31_9FUNG/20-105     AC A0A1Y1YA31.1
#=GS V5FQX7_BYSSN/229-310        AC V5FQX7.1
#=GS A0A0R3W2W3_TAEAS/231-322    AC A0A0R3W2W3.1
#=GS A0A1X7QYP9_9SACH/17-109     AC A0A1X7QYP9.1
#=GS M7YVD5_TRIUA/17-112         AC M7YVD5.1
#=GS A0A087XBN6_POEFO/22-112     AC A0A087XBN6.2
#=GS G3AUW9_SPAPN/20-106         AC G3AUW9.1
#=GS M7BYB3_CHEMY/57-88          AC M7BYB3.1
#=GS F7VKL3_SORMK/17-109         AC F7VKL3.1
#=GS A0A0N4Z1U5_PARTI/22-110     AC A0A0N4Z1U5.1
#=GS A0A1Z5JYT7_FISSO/18-110     AC A0A1Z5JYT7.1
#=GS RL12_SULSO/16-105           AC P96040.1
#=GS A0A1J4RH26_9ARCH/16-100     AC A0A1J4RH26.1
#=GS A0A162WYM5_PHYB8/17-106     AC A0A162WYM5.1
#=GS A0A1A8X2V0_PLAMA/231-315    AC A0A1A8X2V0.1
#=GS G0NE76_CAEBE/17-103         AC G0NE76.1
#=GS E4ZVF4_LEPMJ/17-112         AC E4ZVF4.1
#=GS B8NNH5_ASPFN/21-110         AC B8NNH5.1
#=GS A0A168KSL2_MUCCL/20-104     AC A0A168KSL2.1
#=GS A0A0E0LSW6_ORYPU/9-104      AC A0A0E0LSW6.1
#=GS A0A0D3BAF4_BRAOL/233-320    AC A0A0D3BAF4.1
#=GS A0A067MW77_9HOMO/17-111     AC A0A067MW77.1
#=GS A0A177B6U9_9METZ/226-318    AC A0A177B6U9.1
#=GS T0NGK9_9EURY/16-100         AC T0NGK9.1
#=GS A0A2I3TBE8_PANTR/190-275    AC A0A2I3TBE8.1
#=GS A0A0K0DT67_STRER/17-108     AC A0A0K0DT67.1
#=GS C4R7T6_KOMPG/20-105         AC C4R7T6.1
#=GS A0A0N4UHU0_DRAME/17-113     AC A0A0N4UHU0.1
#=GS A0A0N1HZR2_LEPSE/16-106     AC A0A0N1HZR2.1
#=GS K7M324_SOYBN/52-148         AC K7M324.1
#=GS A0A0B0PNW5_GOSAR/22-113     AC A0A0B0PNW5.1
#=GS M0SVS7_MUSAM/39-121         AC M0SVS7.1
#=GS U6MA64_EIMMA/19-113         AC U6MA64.1
#=GS A0A087SAV4_AUXPR/21-61      AC A0A087SAV4.1
#=GS A0A167DYL5_9HYPO/229-312    AC A0A167DYL5.1
#=GS A0A0H1BEP8_9EURO/16-83      AC A0A0H1BEP8.1
#=GS L1JHF0_GUITH/24-116         AC L1JHF0.1
#=GS A0A1U8N2M9_GOSHI/17-112     AC A0A1U8N2M9.1
#=GS A0A1L9TGS5_9EURO/17-107     AC A0A1L9TGS5.1
#=GS T1HS79_RHOPR/17-113         AC T1HS79.1
#=GS A0A177EDM2_9MICR/21-99      AC A0A177EDM2.1
#=GS A0A0B0N7U2_GOSAR/17-113     AC A0A0B0N7U2.1
#=GS E1ZAY3_CHLVA/17-105         AC E1ZAY3.1
#=GS A0A1B0D3Y1_PHLPP/231-318    AC A0A1B0D3Y1.1
#=GS A0A0D2H405_9EURO/221-305    AC A0A0D2H405.1
#=GS M3B3K3_PSEFD/21-112         AC M3B3K3.1
#=GS S7P5H6_MYOBR/24-114         AC S7P5H6.1
#=GS A0A1Y2HW77_9FUNG/94-187     AC A0A1Y2HW77.1
#=GS A0A0F2LZB3_SPOSC/17-110     AC A0A0F2LZB3.1
#=GS A0A1V8SDK7_9PEZI/229-312    AC A0A1V8SDK7.1
#=GS G0SGP3_CHATD/229-311        AC G0SGP3.1
#=GS A0A0B0NQF7_GOSAR/17-113     AC A0A0B0NQF7.1
#=GS A0A0U5GTE5_9EURO/21-108     AC A0A0U5GTE5.1
#=GS D7L7S7_ARALL/233-319        AC D7L7S7.1
#=GS W3XPA0_PESFW/17-109         AC W3XPA0.1
#=GS A0A1X2IK02_9FUNG/17-108     AC A0A1X2IK02.1
#=GS A0A0F7IFH2_9EURY/231-337    AC A0A0F7IFH2.1
#=GS A0A0M8P144_9EURO/93-178     AC A0A0M8P144.1
#=GS A0A0N1H3J0_9EURO/17-114     AC A0A0N1H3J0.1
#=GS A0A1Y3BPC6_EURMA/21-115     AC A0A1Y3BPC6.1
#=GS A0A2I3MQ41_PAPAN/186-268    AC A0A2I3MQ41.1
#=GS G3NNI3_GASAC/17-111         AC G3NNI3.1
#=GS A0A091GFX3_9AVES/22-113     AC A0A091GFX3.1
#=GS A0A226MQU1_CALSU/22-113     AC A0A226MQU1.1
#=GS A0A151BE41_9ARCH/16-102     AC A0A151BE41.1
#=GS A0A087QVR9_APTFO/17-114     AC A0A087QVR9.1
#=GS A0A087RI00_APTFO/231-311    AC A0A087RI00.1
#=GS A0A183EK89_9BILA/18-77      AC A0A183EK89.1
#=GS Q90YW9_ICTPU/17-114         AC Q90YW9.1
#=GS F2KSR0_ARCVS/16-105         AC F2KSR0.1
#=GS A0A0S4JJB8_BODSA/18-108     AC A0A0S4JJB8.1
#=GS A0A1I8NN15_STOCA/231-314    AC A0A1I8NN15.1
#=GS Q5KFD2_CRYNJ/17-110         AC Q5KFD2.1
#=GS A0A168MT39_ABSGL/20-105     AC A0A168MT39.1
#=GS A0A1E4RFZ7_9ASCO/17-108     AC A0A1E4RFZ7.1
#=GS M3Z7F1_MUSPF/23-113         AC M3Z7F1.1
#=GS A0A059DC76_EUCGR/17-115     AC A0A059DC76.1
#=GS R9SK09_9EURY/16-99          AC R9SK09.1
#=GS A0A0B7NLC3_9FUNG/17-106     AC A0A0B7NLC3.1
#=GS A0A0V1MLG1_9BILA/231-318    AC A0A0V1MLG1.1
#=GS A0A0M0C1D8_9ARCH/16-103     AC A0A0M0C1D8.1
#=GS A0A1C7MBI5_GRIFR/17-111     AC A0A1C7MBI5.1
#=GS A0A0N0RTB3_9HYPO/16-109     AC A0A0N0RTB3.1
#=GS R9T7V4_METII/230-331        AC R9T7V4.1
#=GS A0A218P7F1_9EURY/16-105     AC A0A218P7F1.1
#=GS A0A0U5H3Y4_9EURY/16-111     AC A0A0U5H3Y4.1
#=GS A0A1Q9CL35_SYMMI/1529-1629  AC A0A1Q9CL35.1
#=GS A0A0L1IWP2_ASPNO/229-312    AC A0A0L1IWP2.1
#=GS D7TEZ4_VITVI/17-112         AC D7TEZ4.1
#=GS A0A023EES4_AEDAL/23-111     AC A0A023EES4.1
#=GS A0A0F0IBH1_ASPPU/229-312    AC A0A0F0IBH1.1
#=GS A0A218UXS9_9PASE/17-114     AC A0A218UXS9.1
#=GS I4DID8_PAPXU/231-315        AC I4DID8.1
#=GS A0A0A0LTV1_CUCSA/21-107     AC A0A0A0LTV1.1
#=GS A0A166GMZ0_9HOMO/229-312    AC A0A166GMZ0.1
#=GS S9UNB1_9TRYP/238-324        AC S9UNB1.1
#=GS M4C8H3_BRARP/17-113         AC M4C8H3.1
#=GS A0A094B8R9_9PEZI/66-153     AC A0A094B8R9.1
#=GS A0A068S1M3_9FUNG/17-106     AC A0A068S1M3.1
#=GS A0A1U8M3A5_GOSHI/17-113     AC A0A1U8M3A5.1
#=GS C5YMX6_SORBI/234-317        AC C5YMX6.1
#=GS A0A1C7MTT8_9FUNG/17-106     AC A0A1C7MTT8.1
#=GS B4MCB2_DROVI/17-77          AC B4MCB2.1
#=GS H2B281_KAZAF/19-105         AC H2B281.1
#=GS A0A1F7ZQN5_9EURO/21-107     AC A0A1F7ZQN5.1
#=GS G8B7X7_CANPC/20-109         AC G8B7X7.1
#=GS A0A2B7WI23_9EURO/17-110     AC A0A2B7WI23.1
#=GS S9YM06_CAMFR/48-139         AC S9YM06.1
#=GS A0A084QBY4_STAC4/228-312    AC A0A084QBY4.1
#=GS A0A1S4DKA2_TOBAC/163-251    AC A0A1S4DKA2.1
#=GS A0A0P1B526_9STRA/27-115     AC A0A0P1B526.1
#=GS E3QN91_COLGM/21-109         AC E3QN91.1
#=GS M0ZUF8_SOLTU/232-320        AC M0ZUF8.1
#=GS A4HFR5_LEIBR/238-323        AC A4HFR5.1
#=GS A0A063C8M0_9HYPO/17-111     AC A0A063C8M0.1
#=GS A2WMF3_ORYSI/60-118         AC A2WMF3.1
#=GS A0A087GBM9_ARAAL/33-119     AC A0A087GBM9.1
#=GS A0CGM9_PARTE/34-120         AC A0CGM9.1
#=GS A0A067BYJ2_SAPPC/29-111     AC A0A067BYJ2.1
#=GS A0A0J0XH20_9TREE/17-109     AC A0A0J0XH20.1
#=GS B9SSU4_RICCO/17-112         AC B9SSU4.1
#=GS A0A1R1XIP6_9FUNG/21-106     AC A0A1R1XIP6.1
#=GS A0A2H3J8C6_WOLCO/21-109     AC A0A2H3J8C6.1
#=GS A0A0A2LC88_PENIT/21-106     AC A0A0A2LC88.1
#=GS C6A1F6_THESM/16-103         AC C6A1F6.1
#=GS A0A1R3HD62_9ROSI/17-113     AC A0A1R3HD62.1
#=GS A0A2K5HSB2_COLAP/22-107     AC A0A2K5HSB2.1
#=GS W9VNP8_9EURO/17-114         AC W9VNP8.1
#=GS A0A1L9UJI5_9EURO/17-108     AC A0A1L9UJI5.1
#=GS A0A0L1J396_ASPNO/17-108     AC A0A0L1J396.1
#=GS A0A1I7X0J9_HETBA/169-196    AC A0A1I7X0J9.1
#=GS A0A0L7QXQ2_9HYME/22-110     AC A0A0L7QXQ2.1
#=GS A2EMI1_TRIVA/20-104         AC A2EMI1.1
#=GS A0A1Q3B9C9_CEPFO/17-116     AC A0A1Q3B9C9.1
#=GS Q2HFM8_CHAGB/229-310        AC Q2HFM8.1
#=GS A0A0M3I564_ASCLU/231-317    AC A0A0M3I564.1
#=GS A0A0J7KN60_LASNI/231-315    AC A0A0J7KN60.1
#=GS A0A066WLY2_9BASI/21-109     AC A0A066WLY2.1
#=GS M0SJD2_MUSAM/17-111         AC M0SJD2.1
#=GS A0A1X2IW59_9FUNG/17-108     AC A0A1X2IW59.1
#=GS A0A1B8EQP0_9PEZI/21-108     AC A0A1B8EQP0.1
#=GS A0A0D1YWP7_9PEZI/21-111     AC A0A0D1YWP7.1
#=GS A0A0G4IGJ5_PLABS/28-112     AC A0A0G4IGJ5.1
#=GS A0A151N4M1_ALLMI/284-366    AC A0A151N4M1.1
#=GS A0A1U8FJI2_CAPAN/234-319    AC A0A1U8FJI2.1
#=GS A0A1U8NC49_GOSHI/22-112     AC A0A1U8NC49.1
#=GS A0A0R3X2T4_HYDTA/17-123     AC A0A0R3X2T4.1
#=GS A0A183GUC4_HELBK/1-68       AC A0A183GUC4.1
#=GS A0A182IRR4_9DIPT/231-314    AC A0A182IRR4.1
#=GS G1SPK4_RABIT/192-278        AC G1SPK4.2
#=GS A0A1S2Y105_CICAR/17-112     AC A0A1S2Y105.1
#=GS E7LXY4_YEASV/229-311        AC E7LXY4.1
#=GS A0A2I4ER37_9ROSI/234-320    AC A0A2I4ER37.1
#=GS A0A1J1IKQ9_9DIPT/23-111     AC A0A1J1IKQ9.1
#=GS A0A068Y9A4_ECHMU/231-322    AC A0A068Y9A4.1
#=GS A0A2D6LPI9_9ARCH/16-99      AC A0A2D6LPI9.1
#=GS A0A0L1HZX9_9PLEO/1127-1218  AC A0A0L1HZX9.1
#=GS H0GYJ0_SACCK/229-311        AC H0GYJ0.1
#=GS H2ATS5_KAZAF/16-104         AC H2ATS5.1
#=GS K5VZJ7_PHACS/21-111         AC K5VZJ7.1
#=GS G3UJ51_LOXAF/3-76           AC G3UJ51.1
#=GS C5LCQ4_PERM5/19-108         AC C5LCQ4.1
#=GS A0A1D3CUA7_9EIME/32-119     AC A0A1D3CUA7.1
#=GS A0A0G4EZT9_VITBC/17-115     AC A0A0G4EZT9.1
#=GS A0A1G7LTU8_9EURY/16-119     AC A0A1G7LTU8.1
#=GS A0A085NNS0_9BILA/37-126     AC A0A085NNS0.1
#=GS A7F9K2_SCLS1/229-311        AC A7F9K2.1
#=GS A0A100XVM4_9EURY/16-104     AC A0A100XVM4.1
#=GS A0A2D0QBS0_ICTPU/231-315    AC A0A2D0QBS0.1
#=GS E4V023_ARTGP/229-310        AC E4V023.1
#=GS K8ERW0_9CHLO/1-66           AC K8ERW0.1
#=GS A0A2H3T3W6_FUSOX/229-312    AC A0A2H3T3W6.1
#=GS S9VPW5_9TRYP/22-107         AC S9VPW5.1
#=GS B1N3L3_ENTHI/1-61           AC B1N3L3.1
#=GS F4R8Y9_MELLP/19-107         AC F4R8Y9.1
#=GS RLA2_HUMAN/17-114           AC P05387.1
#=GS RLA2_HUMAN/17-114           DR PDB; 2JDL C; 2-10;
#=GS RLA2_HUMAN/17-114           DR PDB; 1S4J A; 1-12;
#=GS RLA2_HUMAN/17-114           DR PDB; 2W1O B; 17-69;
#=GS RLA2_HUMAN/17-114           DR PDB; 4BEH B; 217-314;
#=GS RLA2_HUMAN/17-114           DR PDB; 5DDZ B; 110-114;
#=GS RLA2_HUMAN/17-114           DR PDB; 5GU4 D; 2-6;
#=GS RLA2_HUMAN/17-114           DR PDB; 2JDL D; 3-10;
#=GS RLA2_HUMAN/17-114           DR PDB; 2LBF B; 117-169;
#=GS RLA2_HUMAN/17-114           DR PDB; 5GU4 C; 2-6;
#=GS RLA2_HUMAN/17-114           DR PDB; 2W1O A; 17-69;
#=GS L5M193_MYODS/17-114         AC L5M193.1
#=GS A0A0E0BZJ0_9ORYZ/158-214    AC A0A0E0BZJ0.1
#=GS A0A151BME5_9ARCH/16-102     AC A0A151BME5.1
#=GS C5DNK6_LACTC/229-310        AC C5DNK6.1
#=GS A0A175VXJ7_9PEZI/229-310    AC A0A175VXJ7.1
#=GS A0A194RK20_PAPMA/22-109     AC A0A194RK20.1
#=GS A0A1E3PBW4_WICAO/17-108     AC A0A1E3PBW4.1
#=GS A0A0A7UZ22_9ARCH/16-102     AC A0A0A7UZ22.1
#=GS M4BIK3_HYAAE/36-126         AC M4BIK3.1
#=GS A0A167R313_9BASI/229-314    AC A0A167R313.1
#=GS A0A099P0R0_PICKU/17-106     AC A0A099P0R0.1
#=GS A0A196SJ41_BLAHN/224-308    AC A0A196SJ41.1
#=GS A0A0D2MR80_GOSRA/22-113     AC A0A0D2MR80.1
#=GS F7CAX3_HORSE/12-95          AC F7CAX3.1
#=GS RLA1_BOVIN/22-113           AC Q56K14.1
#=GS A0A284REV0_9AGAR/229-311    AC A0A284REV0.1
#=GS W5P694_SHEEP/17-110         AC W5P694.1
#=GS RLA1_ASPFU/21-110           AC Q9HGV0.1
#=GS C1EFE4_MICCC/233-312        AC C1EFE4.1
#=GS A0A0A1NW63_9FUNG/17-107     AC A0A0A1NW63.1
#=GS Q6CM91_KLULA/20-105         AC Q6CM91.1
#=GS A0A044S0E9_ONCVO/32-126     AC A0A044S0E9.1
#=GS A0A0L7KK61_PLAFX/19-111     AC A0A0L7KK61.1
#=GS RL12_AERPE/21-109           AC Q9Y9W9.1
#=GS A0A0V1PJV8_9BILA/22-112     AC A0A0V1PJV8.1
#=GS A0A182UMH4_ANOME/17-111     AC A0A182UMH4.1
#=GS A0A158NKQ4_ATTCE/231-317    AC A0A158NKQ4.1
#=GS A0A068XIB6_HYMMI/212-301    AC A0A068XIB6.1
#=GS H2SJI9_TAKRU/22-111         AC H2SJI9.1
#=GS A0A1Q8RQ35_9PEZI/21-108     AC A0A1Q8RQ35.1
#=GS A0A0L1KYR0_9EUGL/16-107     AC A0A0L1KYR0.1
#=GS A0A1L8HDX6_XENLA/41-134     AC A0A1L8HDX6.1
#=GS A0A194S3U1_RHOGW/229-308    AC A0A194S3U1.1
#=GS A0A1G4KNG8_9SACH/17-109     AC A0A1G4KNG8.1
#=GS K7N0E2_SOYBN/21-98          AC K7N0E2.1
#=GS RLA2_LEIBR/16-104           AC O44010.1
#=GS RLA2_LEIBR/16-104           DR PDB; 1S4H A; 1-12;
#=GS F7B146_CALJA/17-88          AC F7B146.1
#=GS A0A238WQE6_HALVU/16-107     AC A0A238WQE6.1
#=GS A8CW91_LUTLO/231-316        AC A8CW91.1
#=GS A0A067NYD7_PLEOS/21-109     AC A0A067NYD7.1
#=GS A0A2B7XPB6_9EURO/17-109     AC A0A2B7XPB6.1
#=GS A0A151TC76_CAJCA/234-319    AC A0A151TC76.1
#=GS T0KKK8_COLGC/17-109         AC T0KKK8.1
#=GS A0A2I3SLL3_PANTR/171-257    AC A0A2I3SLL3.1
#=GS A0A183C7F1_GLOPA/6-69       AC A0A183C7F1.1
#=GS A0A1A9UF08_GLOAU/9-84       AC A0A1A9UF08.1
#=GS A0A1Q3D2M0_CEPFO/22-114     AC A0A1Q3D2M0.1
#=GS A0A1S3TD73_VIGRR/21-111     AC A0A1S3TD73.1
#=GS D8Q384_SCHCM/17-110         AC D8Q384.1
#=GS A0A2H2JEP8_CAEJA/207-287    AC A0A2H2JEP8.1
#=GS A0A0K8LMJ4_9EURO/21-109     AC A0A0K8LMJ4.1
#=GS K1Q358_CRAGI/17-111         AC K1Q358.1
#=GS B5IAH5_ACIB4/16-104         AC B5IAH5.1
#=GS A0A1E3PCK3_WICAO/229-312    AC A0A1E3PCK3.1
#=GS A0A067DRV3_CITSI/20-102     AC A0A067DRV3.1
#=GS A0A1A9YI64_GLOFF/31-89      AC A0A1A9YI64.1
#=GS A7TS21_VANPO/229-310        AC A7TS21.1
#=GS A0A0M0BSW2_9ARCH/16-101     AC A0A0M0BSW2.1
#=GS B6K5P4_SCHJY/21-107         AC B6K5P4.1
#=GS A0A0D9QSD9_PLAFR/19-110     AC A0A0D9QSD9.1
#=GS A0A1Q9DF72_SYMMI/10-72      AC A0A1Q9DF72.1
#=GS A0A061HKV8_BLUGR/230-313    AC A0A061HKV8.1
#=GS G1K8D7_ANOCA/22-112         AC G1K8D7.1
#=GS A0A0E0MSH6_ORYRU/17-113     AC A0A0E0MSH6.1
#=GS A7ANQ3_BABBO/19-111         AC A7ANQ3.1
#=GS A0A084RK62_STACH/228-312    AC A0A084RK62.1
#=GS A0A0C9MX48_9FUNG/497-581    AC A0A0C9MX48.1
#=GS A0A0L9TWH9_PHAAN/17-109     AC A0A0L9TWH9.1
#=GS Q5SNH7_ORYSJ/17-113         AC Q5SNH7.1
#=GS A0A068RI68_9FUNG/41-120     AC A0A068RI68.1
#=GS A0A238F5R5_9BASI/20-108     AC A0A238F5R5.1
#=GS A0A1W0XCG1_HYPDU/261-349    AC A0A1W0XCG1.1
#=GS A0A1U7VI59_NICSY/21-111     AC A0A1U7VI59.1
#=GS E0VFT8_PEDHC/22-117         AC E0VFT8.1
#=GS C4M660_ENTHI/23-106         AC C4M660.1
#=GS A0A1D6FKX3_MAIZE/95-186     AC A0A1D6FKX3.1
#=GS A0A195DHA1_9HYME/231-316    AC A0A195DHA1.1
#=GS A0A1J9QEC2_9EURO/17-110     AC A0A1J9QEC2.1
#=GS A0A176VV37_MARPO/17-112     AC A0A176VV37.1
#=GS A0A139HNZ1_9PEZI/21-111     AC A0A139HNZ1.1
#=GS E6RA36_CRYGW/229-311        AC E6RA36.1
#=GS F9WD62_TRYCI/16-107         AC F9WD62.1
#=GS RLA0_ORYSJ/234-318          AC P41095.3
#=GS A0A0E0QGC3_ORYRU/17-114     AC A0A0E0QGC3.1
#=GS A0A1S3XAP7_TOBAC/22-109     AC A0A1S3XAP7.1
#=GS A0A0D9RDT9_CHLSB/17-114     AC A0A0D9RDT9.1
#=GS A0A084FUJ3_9PEZI/21-108     AC A0A084FUJ3.1
#=GS A0A1V6P8Q5_9EURO/229-311    AC A0A1V6P8Q5.1
#=GS A9RZU5_PHYPA/234-318        AC A9RZU5.1
#=GS A0A0B2RTK1_GLYSO/88-152     AC A0A0B2RTK1.1
#=GS A0A1S3XQG2_TOBAC/21-113     AC A0A1S3XQG2.1
#=GS L0ACA9_NATGS/16-114         AC L0ACA9.1
#=GS A0A1D6LNJ7_MAIZE/49-119     AC A0A1D6LNJ7.1
#=GS A0A024VEX5_PLAFA/19-111     AC A0A024VEX5.1
#=GS A0A0V0XIZ4_TRIPS/158-245    AC A0A0V0XIZ4.1
#=GS A9UZK8_MONBE/17-107         AC A9UZK8.1
#=GS D8M1G3_BLAHO/7-100          AC D8M1G3.1
#=GS A0A2H9HZV6_9ARCH/16-100     AC A0A2H9HZV6.1
#=GS A0A0F4GDI8_9PEZI/229-312    AC A0A0F4GDI8.1
#=GS A0A1Q7MN54_9CREN/16-99      AC A0A1Q7MN54.1
#=GS V4VNI2_9ROSI/49-136         AC V4VNI2.1
#=GS A0A1X0P504_9TRYP/238-323    AC A0A1X0P504.1
#=GS A0A0E0L349_ORYPU/17-111     AC A0A0E0L349.1
#=GS A0A2C5YAF6_9HYPO/23-110     AC A0A2C5YAF6.1
#=GS A0A0N5AL53_9BILA/231-318    AC A0A0N5AL53.1
#=GS A0A151R6V4_CAJCA/17-112     AC A0A151R6V4.1
#=GS N1RNK1_FUSC4/229-312        AC N1RNK1.1
#=GS A0A067LE12_JATCU/17-113     AC A0A067LE12.1
#=GS W4GH51_9STRA/29-111         AC W4GH51.1
#=GS C5DVD1_ZYGRC/16-103         AC C5DVD1.1
#=GS A0A163JWZ5_ABSGL/17-122     AC A0A163JWZ5.1
#=GS U5FSM7_POPTR/21-91          AC U5FSM7.1
#=GS A0A077TLA7_PLACH/19-110     AC A0A077TLA7.1
#=GS A0A0B0NHP0_GOSAR/21-111     AC A0A0B0NHP0.1
#=GS E9EHH9_METAQ/17-109         AC E9EHH9.1
#=GS L1IM87_GUITH/74-183         AC L1IM87.1
#=GS E4NR76_HALBP/16-109         AC E4NR76.1
#=GS W5NQ99_SHEEP/24-114         AC W5NQ99.1
#=GS A4HWD9_LEIIN/20-107         AC A4HWD9.1
#=GS A0A0D2P4V1_GOSRA/85-181     AC A0A0D2P4V1.1
#=GS A0A1J5WQL2_9MICR/24-102     AC A0A1J5WQL2.1
#=GS U1PNM8_9EURY/16-112         AC U1PNM8.1
#=GS A0A094CSS7_9PEZI/229-311    AC A0A094CSS7.1
#=GS S6ETY1_ZYGB2/16-104         AC S6ETY1.1
#=GS S7NCJ9_MYOBR/1-92           AC S7NCJ9.1
#=GS A0A1X7T695_AMPQE/18-114     AC A0A1X7T695.1
#=GS A0A1H8RXF5_9EURY/16-109     AC A0A1H8RXF5.1
#=GS A0A2H2IP51_CAEJA/17-107     AC A0A2H2IP51.1
#=GS B9PKQ4_TOXGV/93-178         AC B9PKQ4.1
#=GS T1P8Q2_MUSDO/231-313        AC T1P8Q2.1
#=GS Q1HRM9_AEDAE/17-111         AC Q1HRM9.1
#=GS W2T6C0_NECAM/17-108         AC W2T6C0.1
#=GS A0A0E0CLG2_9ORYZ/30-125     AC A0A0E0CLG2.1
#=GS W5P2A1_SHEEP/22-113         AC W5P2A1.1
#=GS A0A2I4CN72_9TELE/17-115     AC A0A2I4CN72.1
#=GS L9KRS6_TUPCH/17-99          AC L9KRS6.1
#=GS H1VI18_COLHI/21-109         AC H1VI18.1
#=GS K9G228_PEND2/17-107         AC K9G228.1
#=GS C4LZ75_ENTHI/25-106         AC C4LZ75.1
#=GS W1QFD0_OGAPD/19-104         AC W1QFD0.1
#=GS A0A094EKN3_9PEZI/17-109     AC A0A094EKN3.1
#=GS W9CAE8_9HELO/17-111         AC W9CAE8.1
#=GS A0A124GSP2_9EURO/93-178     AC A0A124GSP2.1
#=GS B2AY94_PODAN/229-313        AC B2AY94.1
#=GS A0A1A9V0X1_GLOAU/22-109     AC A0A1A9V0X1.1
#=GS A0A1D2MYY4_ORCCI/17-110     AC A0A1D2MYY4.1
#=GS A0A199UGY2_ANACO/71-169     AC A0A199UGY2.1
#=GS Q6FR55_CANGA/20-106         AC Q6FR55.1
#=GS A0A067TH43_GALM3/21-110     AC A0A067TH43.1
#=GS I1QXF0_ORYGL/234-319        AC I1QXF0.1
#=GS A0A1U8KSV6_GOSHI/234-320    AC A0A1U8KSV6.1
#=GS A0A0D2PU07_GOSRA/103-194    AC A0A0D2PU07.1
#=GS I1KSX0_SOYBN/23-119         AC I1KSX0.1
#=GS A0A059DF41_EUCGR/21-110     AC A0A059DF41.1
#=GS A0A1S3Y5V8_TOBAC/234-319    AC A0A1S3Y5V8.1
#=GS A0A287XH08_HORVV/61-142     AC A0A287XH08.1
#=GS A0A1W0WGP9_HYPDU/22-114     AC A0A1W0WGP9.1
#=GS I1H2D7_BRADI/17-113         AC I1H2D7.1
#=GS M7NQP3_PNEMU/20-104         AC M7NQP3.2
#=GS E6ZVL3_SPORE/230-311        AC E6ZVL3.1
#=GS A0A1Y1WRK7_9FUNG/23-108     AC A0A1Y1WRK7.1
#=GS A0A0U3E7B4_9EURY/16-100     AC A0A0U3E7B4.1
#=GS A0A0J6YM92_COCIT/17-110     AC A0A0J6YM92.1
#=GS A0A0C2GB46_9BILA/17-109     AC A0A0C2GB46.1
#=GS K3X7H3_PYTUL/17-106         AC K3X7H3.1
#=GS A0A2G8KUX1_STIJA/56-132     AC A0A2G8KUX1.1
#=GS A8X663_CAEBR/17-109         AC A8X663.1
#=GS A0A0A0LJB2_CUCSA/36-120     AC A0A0A0LJB2.1
#=GS E6N4F0_9ARCH/16-102         AC E6N4F0.1
#=GS A0A0D2X0Q0_CAPO3/21-108     AC A0A0D2X0Q0.1
#=GS B8PAM8_POSPM/21-109         AC B8PAM8.1
#=GS A0A2G3A612_CAPAN/9-80       AC A0A2G3A612.1
#=GS A0A165J3I5_9PEZI/21-108     AC A0A165J3I5.1
#=GS A0A1U7Z1B9_NICSY/17-111     AC A0A1U7Z1B9.1
#=GS A0A2G2ZDK5_CAPAN/75-169     AC A0A2G2ZDK5.1
#=GS A0A1I8JKA8_9PLAT/231-313    AC A0A1I8JKA8.1
#=GS A0A1G4KKP6_9SACH/20-106     AC A0A1G4KKP6.1
#=GS A0A0V1LID2_9BILA/251-339    AC A0A0V1LID2.1
#=GS B7Q4L8_IXOSC/17-81          AC B7Q4L8.1
#=GS I3S066_MEDTR/17-111         AC I3S066.1
#=GS M1XL72_NATM8/16-111         AC M1XL72.1
#=GS A0A1U7WAL8_NICSY/17-111     AC A0A1U7WAL8.1
#=GS W9SDZ4_9ROSA/35-120         AC W9SDZ4.1
#=GS A0A194PLG0_PAPXU/22-109     AC A0A194PLG0.1
#=GS G1Q2C2_MYOLU/1-87           AC G1Q2C2.1
#=GS A0A0N4V724_ENTVE/21-113     AC A0A0N4V724.1
#=GS K2SI17_MACPH/17-110         AC K2SI17.1
#=GS A0A1U7K379_9APHY/229-311    AC A0A1U7K379.1
#=GS A0A075AJ78_9TREM/17-118     AC A0A075AJ78.1
#=GS A0A117NM83_9EURO/51-141     AC A0A117NM83.1
#=GS W3XKR0_PESFW/226-311        AC W3XKR0.1
#=GS A0A178E0X2_9PLEO/21-109     AC A0A178E0X2.1
#=GS E7QKH3_YEASZ/16-105         AC E7QKH3.1
#=GS L8WJN6_THACA/415-488        AC L8WJN6.1
#=GS G1N9Q6_MELGA/190-275        AC G1N9Q6.2
#=GS A0A1R2CS50_9CILI/246-329    AC A0A1R2CS50.1
#=GS A0A194W939_9PEZI/21-107     AC A0A194W939.1
#=GS A0A0D2TDA1_GOSRA/21-84      AC A0A0D2TDA1.1
#=GS A0A1I7SGD2_BURXY/22-94      AC A0A1I7SGD2.1
#=GS A0A078B613_STYLE/17-104     AC A0A078B613.1
#=GS A0A0G2GS86_9PEZI/229-312    AC A0A0G2GS86.1
#=GS A0A1S2XJI4_CICAR/17-113     AC A0A1S2XJI4.1
#=GS A0A2I4EUZ9_9ROSI/21-111     AC A0A2I4EUZ9.1
#=GS A0A1D6HWQ4_MAIZE/52-136     AC A0A1D6HWQ4.1
#=GS A0A0A0KRE0_CUCSA/17-113     AC A0A0A0KRE0.1
#=GS V4YCW4_9ARCH/16-111         AC V4YCW4.1
#=GS M1AFX9_SOLTU/31-117         AC M1AFX9.1
#=GS E9ETN6_METRA/17-109         AC E9ETN6.1
#=GS A0A182N4R2_9DIPT/231-314    AC A0A182N4R2.1
#=GS A0A135L8L5_PENPA/21-107     AC A0A135L8L5.1
#=GS F4Q1U7_CAVFA/17-104         AC F4Q1U7.1
#=GS A0A1D5Q7X1_MACMU/146-232    AC A0A1D5Q7X1.1
#=GS A8BNT0_GIAIC/233-312        AC A8BNT0.1
#=GS W4Z0V3_STRPU/29-122         AC W4Z0V3.1
#=GS A0A1F2P8V6_9EURY/16-107     AC A0A1F2P8V6.1
#=GS D6WKQ5_TRICA/22-110         AC D6WKQ5.1
#=GS RLA13_ARATH/22-112          AC Q8LEQ0.2
#=GS A0A078H4X7_BRANA/22-112     AC A0A078H4X7.1
#=GS RLA1_CANAL/20-105           AC Q9HFQ7.1
#=GS G1QAP5_MYOLU/231-316        AC G1QAP5.1
#=GS V7CXG5_PHAVU/88-176         AC V7CXG5.1
#=GS Q0UU36_PHANO/17-111         AC Q0UU36.1
#=GS A0A1Q9DG39_SYMMI/101-191    AC A0A1Q9DG39.1
#=GS RLA31_ARATH/40-118          AC Q9SVZ6.1
#=GS L0AZ63_THEEQ/231-312        AC L0AZ63.1
#=GS A0A1Q3BTJ9_CEPFO/21-111     AC A0A1Q3BTJ9.1
#=GS A0A0J8UTC6_COCIT/177-259    AC A0A0J8UTC6.1
#=GS A0A074RN19_9HOMO/229-311    AC A0A074RN19.1
#=GS A0A0N5AAK2_9BILA/1-57       AC A0A0N5AAK2.1
#=GS RLA0_MAIZE/234-317          AC O24573.3
#=GS A0A182F7E7_ANOAL/17-112     AC A0A182F7E7.1
#=GS A0A1E4SN09_9ASCO/20-103     AC A0A1E4SN09.1
#=GS A0A2G5U690_9PELO/17-109     AC A0A2G5U690.1
#=GS A0A0D9PDT7_METAN/229-312    AC A0A0D9PDT7.1
#=GS H2AR05_KAZAF/20-106         AC H2AR05.1
#=GS A0A1L9W0B4_ASPGL/78-163     AC A0A1L9W0B4.1
#=GS I4Y5Z0_WALMC/17-106         AC I4Y5Z0.1
#=GS H2NNM2_PONAB/22-113         AC H2NNM2.1
#=GS A0A0G2GH52_9PEZI/21-108     AC A0A0G2GH52.1
#=GS M1AAF5_SOLTU/17-112         AC M1AAF5.1
#=GS A0A1I8IGI2_9PLAT/145-234    AC A0A1I8IGI2.1
#=GS M4CEV9_BRARP/35-120         AC M4CEV9.1
#=GS A0A0S7DNV1_9EURO/17-109     AC A0A0S7DNV1.1
#=GS A0A168LE71_MUCCL/17-106     AC A0A168LE71.1
#=GS A0A2H3IYV3_9EURO/21-109     AC A0A2H3IYV3.1
#=GS A0A094HW34_9PEZI/69-156     AC A0A094HW34.1
#=GS A0A0L1IAK2_PLAFA/210-294    AC A0A0L1IAK2.1
#=GS A0A0P0XBD7_ORYSJ/14-98      AC A0A0P0XBD7.1
#=GS A0A087V1L7_9ARAC/12-78      AC A0A087V1L7.1
#=GS A0A1U7XYU9_NICSY/234-320    AC A0A1U7XYU9.1
#=GS W4IF88_PLAFA/231-315        AC W4IF88.1
#=GS A8JCC6_CHLRE/21-106         AC A8JCC6.1
#=GS A0A0C3QMV7_9HOMO/21-112     AC A0A0C3QMV7.1
#=GS A0A1D1W672_RAMVA/231-324    AC A0A1D1W672.1
#=GS A0A2B7YBS5_9EURO/17-110     AC A0A2B7YBS5.1
#=GS A1D4B8_NEOFI/229-312        AC A1D4B8.1
#=GS A0A1A6GDX9_NEOLE/38-106     AC A0A1A6GDX9.1
#=GS A0A2H3JXB2_WOLCO/229-313    AC A0A2H3JXB2.1
#=GS A0A0D2GVF2_9EURO/21-111     AC A0A0D2GVF2.1
#=GS A0A0E9NGR6_9ASCO/21-72      AC A0A0E9NGR6.1
#=GS A0A179HAK1_9HYPO/17-109     AC A0A179HAK1.1
#=GS RLA12_ARATH/22-112          AC O23095.2
#=GS J4C932_THEOR/32-115         AC J4C932.1
#=GS A0A2I3HXL5_NOMLE/22-113     AC A0A2I3HXL5.1
#=GS A0A059AAE4_EUCGR/17-113     AC A0A059AAE4.1
#=GS I0Z1Z3_COCSC/21-112         AC I0Z1Z3.1
#=GS A0A1B0G9T8_GLOMM/17-112     AC A0A1B0G9T8.2
#=GS A0A182IPH8_9DIPT/23-113     AC A0A182IPH8.1
#=GS A0A1L9UU18_9EURO/229-311    AC A0A1L9UU18.1
#=GS A0A1B6P8W9_SORBI/50-144     AC A0A1B6P8W9.1
#=GS A0A024GBI1_9STRA/17-108     AC A0A024GBI1.1
#=GS F4P184_BATDJ/23-110         AC F4P184.1
#=GS E5R1A0_ARTGP/21-109         AC E5R1A0.1
#=GS G0SZG6_RHOT2/229-298        AC G0SZG6.1
#=GS A0A2C5W9I5_9PEZI/229-311    AC A0A2C5W9I5.1
#=GS A0A2G9HH45_9LAMI/17-113     AC A0A2G9HH45.1
#=GS A0A094KMP1_9PEZI/229-311    AC A0A094KMP1.1
#=GS N0BIB8_9EURY/16-104         AC N0BIB8.1
#=GS A0A2G3BYU9_CAPCH/29-117     AC A0A2G3BYU9.1
#=GS G8BKD9_CANPC/17-110         AC G8BKD9.1
#=GS A0A1E3BSV5_9EURO/229-310    AC A0A1E3BSV5.1
#=GS A0A2G9RDD2_LITCT/22-112     AC A0A2G9RDD2.1
#=GS I0Z4G6_COCSC/235-318        AC I0Z4G6.1
#=GS W6KKL3_9TRYP/16-110         AC W6KKL3.1
#=GS Q4WJR3_ASPFU/229-312        AC Q4WJR3.1
#=GS W6MWH3_9ASCO/229-309        AC W6MWH3.1
#=GS A0A2I3T3Q7_PANTR/189-273    AC A0A2I3T3Q7.1
#=GS A0A182W074_9DIPT/17-110     AC A0A182W074.1
#=GS A0A1J1IDB7_9DIPT/30-123     AC A0A1J1IDB7.1
#=GS A0A1C1X265_9PEZI/25-112     AC A0A1C1X265.1
#=GS A0A1V6PB33_9EURO/17-107     AC A0A1V6PB33.1
#=GS A0A1N6Y0A0_9EURY/16-115     AC A0A1N6Y0A0.1
#=GS RLA1_CAEEL/22-110           AC P91913.2
#=GS A0A1J7IQV0_9PEZI/21-97      AC A0A1J7IQV0.1
#=GS A0A1X2I0F6_9FUNG/17-108     AC A0A1X2I0F6.1
#=GS A0A0L1KKR2_9EUGL/22-103     AC A0A0L1KKR2.1
#=GS A0A1Y1YRD3_9FUNG/17-108     AC A0A1Y1YRD3.1
#=GS A0A1R3RRC2_ASPC5/21-107     AC A0A1R3RRC2.1
#=GS A0A0D3HR35_9ORYZ/795-880    AC A0A0D3HR35.1
#=GS A0A1Q3CQL1_CEPFO/13-103     AC A0A1Q3CQL1.1
#=GS E7QDC1_YEASZ/17-109         AC E7QDC1.1
#=GS A0A0E0R3U5_ORYRU/714-799    AC A0A0E0R3U5.1
#=GS L8WWA9_THACA/86-173         AC L8WWA9.1
#=GS A0A0V0V610_9BILA/231-319    AC A0A0V0V610.1
#=GS E7NN88_YEASO/16-105         AC E7NN88.1
#=GS A0A0M0BT51_9ARCH/16-105     AC A0A0M0BT51.1
#=GS A0A0B1P6V1_UNCNE/17-111     AC A0A0B1P6V1.1
#=GS A0A133U8H9_9EURY/16-106     AC A0A133U8H9.1
#=GS Q759M0_ASHGO/20-103         AC Q759M0.2
#=GS A0A0E0BNJ6_9ORYZ/326-401    AC A0A0E0BNJ6.1
#=GS V4K537_EUTSA/17-112         AC V4K537.1
#=GS A0A0D1DPN9_USTMA/230-312    AC A0A0D1DPN9.1
#=GS A0A0F7FJ85_9CREN/16-105     AC A0A0F7FJ85.1
#=GS A0BPU8_PARTE/17-112         AC A0BPU8.1
#=GS A0A0D7A014_9AGAR/27-101     AC A0A0D7A014.1
#=GS A0A182L2Q8_9DIPT/23-112     AC A0A182L2Q8.1
#=GS S0ARE0_FERAC/16-100         AC S0ARE0.1
#=GS A0A0B5HN50_ARCG3/9-100      AC A0A0B5HN50.1
#=GS A0A1Q5SV16_9EURO/17-110     AC A0A1Q5SV16.1
#=GS A0A1S8W1T3_9FUNG/23-111     AC A0A1S8W1T3.1
#=GS H3GIY1_PHYRM/29-112         AC H3GIY1.1
#=GS A0A2G9RHT6_LITCT/35-111     AC A0A2G9RHT6.1
#=GS A0A287B7U0_PIG/15-101       AC A0A287B7U0.1
#=GS A0A0N1I2K6_LEPSE/20-105     AC A0A0N1I2K6.1
#=GS A0A062VDB3_9EURY/16-103     AC A0A062VDB3.1
#=GS A0A078IKY3_BRANA/22-112     AC A0A078IKY3.1
#=GS D3B7S8_POLPP/20-104         AC D3B7S8.1
#=GS A0A2B7Z926_9EURO/21-110     AC A0A2B7Z926.1
#=GS A0A0B4H789_9HYPO/17-109     AC A0A0B4H789.1
#=GS C4Y7U5_CLAL4/229-310        AC C4Y7U5.1
#=GS D7LSI5_ARALL/21-112         AC D7LSI5.1
#=GS H9JUE4_BOMMO/17-111         AC H9JUE4.1
#=GS A0A0C3Q7J1_9HOMO/17-111     AC A0A0C3Q7J1.1
#=GS E2RLZ4_CANLF/231-315        AC E2RLZ4.2
#=GS W6PWQ9_PENRF/229-312        AC W6PWQ9.1
#=GS A0A0M8MUS4_9BASI/21-109     AC A0A0M8MUS4.1
#=GS A0A251SQV9_HELAN/34-130     AC A0A251SQV9.1
#=GS B7G981_PHATC/18-108         AC B7G981.1
#=GS A0A166HZC7_9HOMO/17-114     AC A0A166HZC7.1
#=GS D8QQI4_SELML/234-319        AC D8QQI4.1
#=GS A0A067E181_CITSI/38-120     AC A0A067E181.1
#=GS M1D8Y8_SOLTU/17-117         AC M1D8Y8.1
#=GS R9P0T0_PSEHS/17-111         AC R9P0T0.1
#=GS D3ZPJ2_RAT/17-113           AC D3ZPJ2.2
#=GS A0A0D9N2G8_ASPFA/229-312    AC A0A0D9N2G8.1
#=GS I3S0D9_MEDTR/21-107         AC I3S0D9.1
#=GS A0A0F7TF09_9EURO/21-108     AC A0A0F7TF09.1
#=GS S7MP27_MYOBR/22-113         AC S7MP27.1
#=GS A0A0K0CT82_ANGCA/108-199    AC A0A0K0CT82.1
#=GS A0A0N5BY19_STREA/231-313    AC A0A0N5BY19.1
#=GS Q2H653_CHAGB/17-110         AC Q2H653.1
#=GS G0PKT9_CAEBE/17-106         AC G0PKT9.1
#=GS A0A1S3GIX3_DIPOR/17-114     AC A0A1S3GIX3.1
#=GS S9UIU7_9TRYP/21-107         AC S9UIU7.1
#=GS F4C0T2_METSG/16-103         AC F4C0T2.1
#=GS G7J8Y6_MEDTR/21-109         AC G7J8Y6.1
#=GS A0A1U7YL79_NICSY/234-318    AC A0A1U7YL79.1
#=GS A0A287WWA8_HORVV/234-305    AC A0A287WWA8.1
#=GS A0A0E0IXV1_ORYNI/736-821    AC A0A0E0IXV1.1
#=GS H0GN82_SACCK/16-105         AC H0GN82.1
#=GS A0A1X7S8G3_ZYMTR/21-109     AC A0A1X7S8G3.1
#=GS E3MRJ1_CAERE/17-106         AC E3MRJ1.1
#=GS A0A072PK09_9EURO/17-112     AC A0A072PK09.1
#=GS A0A0R3WA46_TAEAS/17-111     AC A0A0R3WA46.1
#=GS A0A1Q2YM07_9ASCO/19-105     AC A0A1Q2YM07.1
#=GS A0A1U7RT81_ALLSI/231-313    AC A0A1U7RT81.1
#=GS A0A2G3AHQ2_CAPAN/21-93      AC A0A2G3AHQ2.1
#=GS A0A257AQ40_9ARCH/17-94      AC A0A257AQ40.1
#=GS A0A1R2CB96_9CILI/32-117     AC A0A1R2CB96.1
#=GS E7LT43_YEASV/17-109         AC E7LT43.1
#=GS C5FCM0_ARTOC/21-109         AC C5FCM0.1
#=GS F6WAG2_CALJA/231-304        AC F6WAG2.1
#=GS A0A086TF39_ACRC1/228-309    AC A0A086TF39.1
#=GS R9AK78_WALI9/17-105         AC R9AK78.1
#=GS A0A1X7R2K7_9SACH/19-105     AC A0A1X7R2K7.1
#=GS A0A087S9K0_AUXPR/18-109     AC A0A087S9K0.1
#=GS A0A183LNU8_9TREM/17-112     AC A0A183LNU8.1
#=GS G1PZB1_MYOLU/24-114         AC G1PZB1.1
#=GS F7PN44_9EURY/16-112         AC F7PN44.1
#=GS G3AJG5_SPAPN/17-107         AC G3AJG5.1
#=GS H3AXH9_LATCH/22-111         AC H3AXH9.1
#=GS A0A1Q3DUU2_LENED/21-108     AC A0A1Q3DUU2.1
#=GS A0A1B0A1U6_GLOPL/17-112     AC A0A1B0A1U6.1
#=GS A0A1L1RP18_CHICK/1-71       AC A0A1L1RP18.1
#=GS A0A287B5H8_PIG/20-110       AC A0A287B5H8.1
#=GS A0A1E1K9C5_9HELO/229-313    AC A0A1E1K9C5.1
#=GS A0A1V6Q4Y7_9EURO/229-312    AC A0A1V6Q4Y7.1
#=GS G8BAY4_CANPC/17-111         AC G8BAY4.1
#=GS A0A2K5JW45_COLAP/169-255    AC A0A2K5JW45.1
#=GS A0A0G2FSV1_9PEZI/17-110     AC A0A0G2FSV1.1
#=GS T0N9U3_9EURY/16-103         AC T0N9U3.1
#=GS A0A0M9VTJ6_9HYPO/229-314    AC A0A0M9VTJ6.1
#=GS E7KB91_YEASA/17-109         AC E7KB91.1
#=GS C4PZS5_SCHMA/231-317        AC C4PZS5.1
#=GS A0A178EAV5_9PLEO/24-96      AC A0A178EAV5.1
#=GS L0JPD7_NATP1/16-116         AC L0JPD7.1
#=GS A0A251SKA1_HELAN/59-154     AC A0A251SKA1.1
#=GS Q386V3_TRYB2/238-324        AC Q386V3.1
#=GS J8PZ09_SACAR/229-311        AC J8PZ09.1
#=GS E7Q938_YEASB/16-105         AC E7Q938.1
#=GS X0KNT9_FUSOX/21-108         AC X0KNT9.1
#=GS A0A0C3GG90_9PEZI/21-109     AC A0A0C3GG90.1
#=GS A0A1H3GIP2_9EURY/16-113     AC A0A1H3GIP2.1
#=GS A0A087ZPA5_APIME/231-316    AC A0A087ZPA5.1
#=GS E3M689_CAERE/66-159         AC E3M689.1
#=GS A0A0J6YKQ7_COCIT/21-110     AC A0A0J6YKQ7.1
#=GS B9EQJ1_SALSA/17-118         AC B9EQJ1.1
#=GS A0A1E5VH99_9POAL/144-246    AC A0A1E5VH99.1
#=GS A0A0G4PAP3_PENCA/229-311    AC A0A0G4PAP3.1
#=GS I4YFS6_WALMC/20-105         AC I4YFS6.1
#=GS A0A093HA19_GAVST/201-258    AC A0A093HA19.1
#=GS A0A0A1P1Q7_9FUNG/17-107     AC A0A0A1P1Q7.1
#=GS B2WCX9_PYRTR/17-111         AC B2WCX9.1
#=GS A0A1E3BR99_9EURO/21-106     AC A0A1E3BR99.1
#=GS A0A1S3A375_ERIEU/180-265    AC A0A1S3A375.1
#=GS M7AHJ0_CHEMY/231-311        AC M7AHJ0.1
#=GS A0A1Y3NVP0_PIRSE/17-105     AC A0A1Y3NVP0.1
#=GS D7U827_VITVI/21-110         AC D7U827.1
#=GS S9WUP8_CAMFR/12-86          AC S9WUP8.1
#=GS A0A195EAQ4_9HYME/17-113     AC A0A195EAQ4.1
#=GS C5GU38_AJEDR/17-111         AC C5GU38.1
#=GS M0XWV5_HORVV/21-108         AC M0XWV5.1
#=GS A0A0J8URJ2_COCIT/17-110     AC A0A0J8URJ2.1
#=GS B6QMA1_TALMQ/17-110         AC B6QMA1.1
#=GS A0A182LZB4_9DIPT/231-314    AC A0A182LZB4.1
#=GS A0A0D3HHV9_9ORYZ/658-743    AC A0A0D3HHV9.1
#=GS B8GIY5_METPE/16-101         AC B8GIY5.1
#=GS A0A078IVX8_BRANA/233-320    AC A0A078IVX8.1
#=GS D7MJC6_ARALL/17-113         AC D7MJC6.1
#=GS A0A1E3NN13_9ASCO/17-107     AC A0A1E3NN13.1
#=GS G7Q314_MACFA/17-114         AC G7Q314.1
#=GS A0A135VYU1_9ARCH/16-99      AC A0A135VYU1.1
#=GS A0A1E5RDL2_9ASCO/229-312    AC A0A1E5RDL2.1
#=GS F7IJ35_CALJA/224-308        AC F7IJ35.1
#=GS G4YPM2_PHYSP/29-111         AC G4YPM2.1
#=GS A2G448_TRIVA/20-102         AC A2G448.1
#=GS A0A077Z0E6_TRITR/23-111     AC A0A077Z0E6.1
#=GS A0A1U7Z5Q6_NELNU/234-319    AC A0A1U7Z5Q6.1
#=GS A0A2G2WC56_CAPBA/31-117     AC A0A2G2WC56.1
#=GS J3NQY2_GAGT3/229-312        AC J3NQY2.1
#=GS H3DXJ6_PRIPA/17-108         AC H3DXJ6.1
#=GS A0A180GC38_PUCT1/229-310    AC A0A180GC38.1
#=GS K4CWH8_SOLLC/234-318        AC K4CWH8.1
#=GS Q5CPN9_CRYPI/19-111         AC Q5CPN9.1
#=GS W7JIT2_PLAFA/19-111         AC W7JIT2.1
#=GS A0A2G2WNS6_CAPBA/234-317    AC A0A2G2WNS6.1
#=GS D7MP19_ARALL/22-110         AC D7MP19.1
#=GS A0A229WZE6_9EURO/21-110     AC A0A229WZE6.1
#=GS A0A077XF25_PLACH/231-314    AC A0A077XF25.1
#=GS A0A2G3C0B0_CAPCH/22-75      AC A0A2G3C0B0.1
#=GS D8R8W3_SELML/17-69          AC D8R8W3.1
#=GS A0A091NBH8_9PASS/207-300    AC A0A091NBH8.1
#=GS T0KZS3_9MICR/17-104         AC T0KZS3.1
#=GS V4TRV2_9ROSI/20-107         AC V4TRV2.1
#=GS U3A402_9EURY/16-114         AC U3A402.1
#=GS A0A212F273_DANPL/17-111     AC A0A212F273.1
#=GS A0A087GTG4_ARAAL/17-114     AC A0A087GTG4.1
#=GS A0A1I7SGD0_BURXY/22-111     AC A0A1I7SGD0.1
#=GS A0A183GVJ1_HELBK/17-69      AC A0A183GVJ1.1
#=GS A0A0D9Y4F0_9ORYZ/17-113     AC A0A0D9Y4F0.1
#=GS A0A176VJ96_MARPO/234-305    AC A0A176VJ96.1
#=GS A0A0D3GVS2_9ORYZ/53-141     AC A0A0D3GVS2.1
#=GS D7SN28_VITVI/49-144         AC D7SN28.1
#=GS A6R5E8_AJECN/229-311        AC A6R5E8.1
#=GS L0JXF6_9EURY/16-113         AC L0JXF6.1
#=GS A0A1A9WUS3_9MUSC/22-109     AC A0A1A9WUS3.1
#=GS A0A2G2VYE9_CAPBA/19-97      AC A0A2G2VYE9.1
#=GS A0A1B0B2D6_9MUSC/63-120     AC A0A1B0B2D6.1
#=GS A2EES5_TRIVA/233-316        AC A2EES5.1
#=GS A0A2H1A7B1_CANAR/20-106     AC A0A2H1A7B1.1
#=GS A0A1B7P029_9EURO/229-312    AC A0A1B7P029.1
#=GS G3NIT1_GASAC/22-112         AC G3NIT1.1
#=GS W6MQD8_9ASCO/22-108         AC W6MQD8.1
#=GS S0DU22_GIBF5/229-312        AC S0DU22.1
#=GS A0A0G4EYJ3_VITBC/32-123     AC A0A0G4EYJ3.1
#=GS A0A231MEZ1_9EURO/17-110     AC A0A231MEZ1.1
#=GS F1SIT7_PIG/22-113           AC F1SIT7.1
#=GS A0A1I8C2N7_MELHA/22-115     AC A0A1I8C2N7.1
#=GS A0A0D8XIM3_DICVI/22-114     AC A0A0D8XIM3.1
#=GS A0A1Q1FLW4_9EURY/16-116     AC A0A1Q1FLW4.1
#=GS J9F542_WUCBA/21-117         AC J9F542.1
#=GS A0A067KSE6_JATCU/17-113     AC A0A067KSE6.1
#=GS H1Z400_9EURY/16-100         AC H1Z400.1
#=GS Q16UQ3_AEDAE/36-111         AC Q16UQ3.1
#=GS A0A180GPK0_PUCT1/19-107     AC A0A180GPK0.1
#=GS A0A1W4XV47_AGRPL/231-315    AC A0A1W4XV47.1
#=GS A0A0C2X5B9_AMAMU/17-111     AC A0A0C2X5B9.1
#=GS A0A0B2PPR3_GLYSO/21-65      AC A0A0B2PPR3.1
#=GS A0A0V1MX23_9BILA/22-112     AC A0A0V1MX23.1
#=GS A0A1B7TDA5_9ASCO/16-104     AC A0A1B7TDA5.1
#=GS E9ACI8_LEIMA/21-110         AC E9ACI8.1
#=GS Q54JK3_DICDI/17-99          AC Q54JK3.1
#=GS A0A0D3E1F6_BRAOL/22-56      AC A0A0D3E1F6.1
#=GS A0A0E0IXV2_ORYNI/745-830    AC A0A0E0IXV2.1
#=GS A0A0D2RL99_GOSRA/234-320    AC A0A0D2RL99.1
#=GS A0A182JIT4_9DIPT/17-112     AC A0A182JIT4.1
#=GS G1TIS9_RABIT/17-88          AC G1TIS9.1
#=GS A0A0R4IVH8_DANRE/22-114     AC A0A0R4IVH8.1
#=GS A0A1V4JNG3_PATFA/32-129     AC A0A1V4JNG3.1
#=GS A0A0H5BZH5_CYBJA/19-104     AC A0A0H5BZH5.1
#=GS R0HM53_9BRAS/17-115         AC R0HM53.1
#=GS A0A152AAB4_9MYCE/21-112     AC A0A152AAB4.1
#=GS A0A072VLF0_MEDTR/17-112     AC A0A072VLF0.1
#=GS C7YSC3_NECH7/21-108         AC C7YSC3.1
#=GS A0A1J4JHM5_9EUKA/17-104     AC A0A1J4JHM5.1
#=GS G0EDK8_PYRF1/16-109         AC G0EDK8.1
#=GS A0A1J9RX35_9PEZI/17-108     AC A0A1J9RX35.1
#=GS B7G9J9_PHATC/172-255        AC B7G9J9.1
#=GS A0A0E0I6V6_ORYNI/234-318    AC A0A0E0I6V6.1
#=GS G0PMZ4_CAEBE/22-127         AC G0PMZ4.1
#=GS A0A0Y9WVS6_PLABE/32-118     AC A0A0Y9WVS6.1
#=GS A0A0M8MNC0_9BASI/229-311    AC A0A0M8MNC0.1
#=GS S9W2V6_9TRYP/18-111         AC S9W2V6.1
#=GS A0A133URW2_9EURY/1-79       AC A0A133URW2.1
#=GS A0A2K5HB77_COLAP/186-268    AC A0A2K5HB77.1
#=GS A0A1B9HUE7_9TREE/20-108     AC A0A1B9HUE7.1
#=GS C4WTD6_ACYPI/16-111         AC C4WTD6.1
#=GS H6BRF5_EXODN/17-114         AC H6BRF5.1
#=GS W1PIE2_AMBTC/234-321        AC W1PIE2.1
#=GS W6MSY1_9ASCO/17-108         AC W6MSY1.1
#=GS A8J5Z0_CHLRE/239-319        AC A8J5Z0.1
#=GS A0A161KIC3_9EURY/16-106     AC A0A161KIC3.1
#=GS RL10_META3/237-338          AC A6UTF8.1
#=GS A0A0E0HUY8_ORYNI/57-118     AC A0A0E0HUY8.1
#=GS A0A0R3S4J9_9BILA/21-62      AC A0A0R3S4J9.1
#=GS A0A0D2KIL7_9EURO/17-114     AC A0A0D2KIL7.1
#=GS RLA11_ARATH/22-111          AC Q8LCW9.2
#=GS A0A087V5F6_BALRE/17-114     AC A0A087V5F6.1
#=GS M7TM82_EUTLA/21-108         AC M7TM82.1
#=GS C3Z0M5_BRAFL/231-313        AC C3Z0M5.1
#=GS A0A0P9GAK2_9ARCH/16-104     AC A0A0P9GAK2.1
#=GS A0A1J1IYU8_9DIPT/231-315    AC A0A1J1IYU8.1
#=GS B4HCG5_DROPE/17-113         AC B4HCG5.1
#=GS B3S1V3_TRIAD/17-111         AC B3S1V3.1
#=GS Q5KEJ6_CRYNJ/229-311        AC Q5KEJ6.1
#=GS F7CGS1_MACMU/17-115         AC F7CGS1.2
#=GS A0A1Y2E2E5_9PEZI/21-109     AC A0A1Y2E2E5.1
#=GS A0A061AUN1_CYBFA/229-311    AC A0A061AUN1.1
#=GS A0A094BZI5_9PEZI/229-310    AC A0A094BZI5.1
#=GS U6GUC9_EIMAC/32-122         AC U6GUC9.1
#=GS A0A0V0QJ89_PSEPJ/32-115     AC A0A0V0QJ89.1
#=GS L1JIG4_GUITH/17-109         AC L1JIG4.1
#=GS T5AAB3_OPHSC/229-312        AC T5AAB3.1
#=GS A0A0A1NW06_9FUNG/20-106     AC A0A0A1NW06.1
#=GS A0A0E0KG87_ORYPU/1241-1321  AC A0A0E0KG87.1
#=GS A0A1C3YJQ9_GIBZE/32-123     AC A0A1C3YJQ9.1
#=GS A0A075ASU5_9FUNG/231-308    AC A0A075ASU5.1
#=GS A0A199VDV9_ANACO/234-319    AC A0A199VDV9.1
#=GS D2V2C3_NAEGR/29-113         AC D2V2C3.1
#=GS B9HHM2_POPTR/234-321        AC B9HHM2.1
#=GS A0A0V0J1I4_SCHSO/231-317    AC A0A0V0J1I4.1
#=GS A0A0B0PL55_GOSAR/234-319    AC A0A0B0PL55.1
#=GS J9P5J5_CANLF/22-113         AC J9P5J5.1
#=GS A0A1E1JSS7_9HELO/17-111     AC A0A1E1JSS7.1
#=GS B1L761_KORCO/26-110         AC B1L761.1
#=GS A0A0F7ZTX5_9HYPO/21-108     AC A0A0F7ZTX5.1
#=GS A0A0Q3LWE1_AMAAE/22-114     AC A0A0Q3LWE1.1
#=GS F5HKA3_ANOGA/17-111         AC F5HKA3.1
#=GS R8BER4_TOGMI/17-110         AC R8BER4.1
#=GS A0A0U1M605_TALIS/229-311    AC A0A0U1M605.1
#=GS F0VMM1_NEOCL/19-110         AC F0VMM1.1
#=GS K6UJU1_9APIC/19-110         AC K6UJU1.1
#=GS L5MKB1_MYODS/17-78          AC L5MKB1.1
#=GS H2Q703_PANTR/229-314        AC H2Q703.2
#=GS A0A183H3K2_9BILA/29-130     AC A0A183H3K2.1
#=GS A0A1U7RWY4_ALLSI/17-110     AC A0A1U7RWY4.1
#=GS A0A2H3Z2L6_PHODC/17-121     AC A0A2H3Z2L6.1
#=GS A0A0E3SPN0_METBA/16-104     AC A0A0E3SPN0.1
#=GS A0A1B0BII7_9MUSC/17-112     AC A0A1B0BII7.1
#=GS C5YM25_SORBI/21-108         AC C5YM25.1
#=GS A0A0V1J7C5_TRIPS/22-112     AC A0A0V1J7C5.1
#=GS G2ML77_9EURY/16-117         AC G2ML77.1
#=GS Q6P5K3_DANRE/231-315        AC Q6P5K3.1
#=GS A0A0K0EK08_STRER/22-112     AC A0A0K0EK08.1
#=GS A8XSD1_CAEBR/17-109         AC A8XSD1.1
#=GS A0A1V1SWN4_9FUNG/21-108     AC A0A1V1SWN4.1
#=GS A0A177DS57_ALTAL/229-313    AC A0A177DS57.1
#=GS H0ECZ5_GLAL7/229-312        AC H0ECZ5.1
#=GS A0A094H2W4_9PEZI/229-311    AC A0A094H2W4.1
#=GS M0TAL6_MUSAM/21-67          AC M0TAL6.1
#=GS A0A093VEU7_TALMA/21-109     AC A0A093VEU7.1
#=GS A0A087Y7H1_POEFO/17-115     AC A0A087Y7H1.2
#=GS Q6BI47_DEBHA/17-109         AC Q6BI47.1
#=GS A0A0L0RVY2_ALLMA/17-106     AC A0A0L0RVY2.1
#=GS A0A2K5KWB9_CERAT/220-302    AC A0A2K5KWB9.1
#=GS A0A133VAL2_9EURY/16-100     AC A0A133VAL2.1
#=GS G4ZU26_PHYSP/17-105         AC G4ZU26.1
#=GS M5EC80_MALS4/17-110         AC M5EC80.1
#=GS A3LWF9_PICST/229-311        AC A3LWF9.1
#=GS A0A0L0FQ07_9EUKA/230-317    AC A0A0L0FQ07.1
#=GS A0A024G4P5_9STRA/231-312    AC A0A024G4P5.1
#=GS W1QDM2_OGAPD/20-107         AC W1QDM2.1
#=GS A0A256ZQJ4_9EURY/16-98      AC A0A256ZQJ4.1
#=GS A0A024US91_9STRA/16-107     AC A0A024US91.1
#=GS A0A0F0I5P4_ASPPU/17-108     AC A0A0F0I5P4.1
#=GS A0A1R3HIN8_COCAP/17-112     AC A0A1R3HIN8.1
#=GS A0A078GVP7_BRANA/17-112     AC A0A078GVP7.1
#=GS A0A0C2WBR1_AMAMU/229-311    AC A0A0C2WBR1.1
#=GS G0NTG4_CAEBE/17-110         AC G0NTG4.1
#=GS B4UN30_CANGA/19-105         AC B4UN30.1
#=GS V6TXW6_GIAIN/233-312        AC V6TXW6.1
#=GS A0A164VXJ4_9HOMO/17-114     AC A0A164VXJ4.1
#=GS Q4D991_TRYCC/21-108         AC Q4D991.1
#=GS U1NK80_9EURY/16-112         AC U1NK80.1
#=GS B9T6Y4_RICCO/9-97           AC B9T6Y4.1
#=GS S0E701_GIBF5/21-108         AC S0E701.1
#=GS A0A1R3J6G9_9ROSI/234-321    AC A0A1R3J6G9.1
#=GS Q0W052_METAR/10-102         AC Q0W052.1
#=GS A0A084GAJ0_9PEZI/228-312    AC A0A084GAJ0.1
#=GS W1QFP7_OGAPD/50-141         AC W1QFP7.1
#=GS H0A9U8_HALSG/16-103         AC H0A9U8.1
#=GS A0A1A8VRR1_9APIC/19-110     AC A0A1A8VRR1.1
#=GS A0A1H9F352_9EURY/16-113     AC A0A1H9F352.1
#=GS F8D7E1_HALXS/16-110         AC F8D7E1.1
#=GS M7UCK7_BOTF1/229-311        AC M7UCK7.1
#=GS G0P187_CAEBE/17-107         AC G0P187.1
#=GS B8C7F9_THAPS/17-110         AC B8C7F9.1
#=GS D8Q5T1_SCHCM/229-310        AC D8Q5T1.1
#=GS B0DP12_LACBS/21-115         AC B0DP12.1
#=GS A0A093ZMG2_9PEZI/17-108     AC A0A093ZMG2.1
#=GS G3B4H5_CANTC/229-312        AC G3B4H5.1
#=GS A0A1B7TGH6_9ASCO/16-106     AC A0A1B7TGH6.1
#=GS A0A0B2WK83_9HYPO/21-106     AC A0A0B2WK83.1
#=GS A0A178BD91_9PLEO/229-314    AC A0A178BD91.1
#=GS A0A067MHP0_9HOMO/21-109     AC A0A067MHP0.1
#=GS A0A0V1NWC4_9BILA/231-319    AC A0A0V1NWC4.1
#=GS A0A093XEK5_9PEZI/229-309    AC A0A093XEK5.1
#=GS A0A096N8E2_PAPAN/17-114     AC A0A096N8E2.1
#=GS A0A1E3PGQ7_9ASCO/20-104     AC A0A1E3PGQ7.1
#=GS A0A2I3FX62_NOMLE/12-102     AC A0A2I3FX62.1
#=GS A5UKU7_METS3/16-100         AC A5UKU7.1
#=GS K4C2D6_SOLLC/234-320        AC K4C2D6.1
#=GS RLA2_PIG/17-114             AC Q29315.1
#=GS D7DR73_METV3/16-98          AC D7DR73.1
#=GS D2A6C6_TRICA/17-111         AC D2A6C6.1
#=GS A0A166REW4_9EURY/16-106     AC A0A166REW4.1
#=GS A0A2I4EF58_9ROSI/17-114     AC A0A2I4EF58.1
#=GS A0A1C7LJP6_GRIFR/21-109     AC A0A1C7LJP6.1
#=GS B8MDW1_TALSN/17-110         AC B8MDW1.1
#=GS A0A0D2V3D2_GOSRA/234-319    AC A0A0D2V3D2.1
#=GS A0A1B9IKQ8_9TREE/17-112     AC A0A1B9IKQ8.1
#=GS A0A061D7L4_BABBI/32-117     AC A0A061D7L4.1
#=GS A0A164TUF4_9HOMO/229-312    AC A0A164TUF4.1
#=GS RLA32_ARATH/34-119          AC Q9LVC9.1
#=GS M9M6D0_PSEA3/230-312        AC M9M6D0.1
#=GS A0A096MMQ6_PAPAN/22-113     AC A0A096MMQ6.1
#=GS A0A2H3T526_FUSOX/21-108     AC A0A2H3T526.1
#=GS A0A1G4JPD3_9SACH/19-104     AC A0A1G4JPD3.1
#=GS B8NZ89_POSPM/229-314        AC B8NZ89.1
#=GS A0A1S8A5I8_ROSNE/229-312    AC A0A1S8A5I8.1
#=GS A0A1A6FUT8_NEOLE/221-300    AC A0A1A6FUT8.1
#=GS RLA0_SCHPO/229-311          AC O74864.1
#=GS A0A087U9F3_9ARAC/22-115     AC A0A087U9F3.1
#=GS A0A091H039_BUCRH/211-297    AC A0A091H039.1
#=GS A0A1U7LLG9_9ASCO/17-110     AC A0A1U7LLG9.1
#=GS H0H0V1_SACCK/16-104         AC H0H0V1.1
#=GS A0A200RBZ7_9MAGN/21-107     AC A0A200RBZ7.1
#=GS RLA1_DICDI/24-112           AC P22684.1
#=GS A0A099P561_PICKU/50-137     AC A0A099P561.1
#=GS A0A287AH11_PIG/22-112       AC A0A287AH11.1
#=GS A0A0C9MGG0_9FUNG/55-134     AC A0A0C9MGG0.1
#=GS F1PUX4_CANLF/231-316        AC F1PUX4.1
#=GS A0A0N0DQX7_9TRYP/21-109     AC A0A0N0DQX7.1
#=GS B4FVI4_MAIZE/17-110         AC B4FVI4.1
#=GS A0A1G9T2L5_9EURY/16-108     AC A0A1G9T2L5.1
#=GS A0CRF6_PARTE/66-150         AC A0CRF6.1
#=GS A0A059DFA0_EUCGR/12-119     AC A0A059DFA0.1
#=GS A0A0D2F3Q6_9EURO/229-314    AC A0A0D2F3Q6.1
#=GS A0A2G3D4G5_CAPCH/257-342    AC A0A2G3D4G5.1
#=GS A0A2K5HIN7_COLAP/22-113     AC A0A2K5HIN7.1
#=GS W7M5R1_GIBM7/17-109         AC W7M5R1.1
#=GS F4WLI8_ACREC/22-111         AC F4WLI8.1
#=GS G8JSD1_ERECY/17-107         AC G8JSD1.1
#=GS A0A0V1CZ50_TRIBR/204-292    AC A0A0V1CZ50.1
#=GS A0A1Y2G3A1_9BASI/229-311    AC A0A1Y2G3A1.1
#=GS A0A1J4JNM8_9EUKA/21-105     AC A0A1J4JNM8.1
#=GS V4BY94_LOTGI/22-111         AC V4BY94.1
#=GS A0A1C7N8Z8_9FUNG/20-105     AC A0A1C7N8Z8.1
#=GS G1Q120_MYOLU/20-86          AC G1Q120.1
#=GS A0A0K9RP60_SPIOL/234-321    AC A0A0K9RP60.1
#=GS A0A0B7N8G9_9FUNG/228-307    AC A0A0B7N8G9.1
#=GS A0A0D2DYF4_9EURO/17-112     AC A0A0D2DYF4.1
#=GS A0A1E3QWM9_9ASCO/229-313    AC A0A1E3QWM9.1
#=GS A0A0B7MX51_9FUNG/41-126     AC A0A0B7MX51.1
#=GS RLA2_HORSE/17-114           AC Q6X9Z5.1
#=GS A0A1D8PRG5_CANAL/20-107     AC A0A1D8PRG5.1
#=GS A0A0R3TE92_HYMNN/231-320    AC A0A0R3TE92.1
#=GS A0A0C3H9C6_9PEZI/229-311    AC A0A0C3H9C6.1
#=GS A8WQU3_CAEBR/17-109         AC A8WQU3.1
#=GS A0A133VEB7_9EURY/16-103     AC A0A133VEB7.1
#=GS A0A2I4HWR3_9ROSI/21-111     AC A0A2I4HWR3.1
#=GS A0A0L7LYM1_PLAF4/146-228    AC A0A0L7LYM1.1
#=GS A0A182Y7C3_ANOST/780-863    AC A0A182Y7C3.1
#=GS A0A0D1Z610_9EURO/17-113     AC A0A0D1Z610.1
#=GS S7W9Q8_SPRLO/22-102         AC S7W9Q8.1
#=GS A0A0C2FRR9_9BILA/17-71      AC A0A0C2FRR9.1
#=GS A0A094GZL7_9PEZI/229-311    AC A0A094GZL7.1
#=GS A0A218XIZ0_PUNGR/6-118      AC A0A218XIZ0.1
#=GS L8FUV3_PSED2/229-311        AC L8FUV3.1
#=GS A0A1I8APF6_9BILA/17-109     AC A0A1I8APF6.1
#=GS V4TVA5_9ROSI/11-95          AC V4TVA5.1
#=GS A0A0D3EKJ1_9ORYZ/17-113     AC A0A0D3EKJ1.1
#=GS A0A061G3F9_THECC/21-112     AC A0A061G3F9.1
#=GS C6TGA6_SOYBN/234-318        AC C6TGA6.1
#=GS H0W149_CAVPO/231-317        AC H0W149.2
#=GS A0A074VXI6_9PEZI/229-319    AC A0A074VXI6.1
#=GS V7C7B8_PHAVU/234-319        AC V7C7B8.1
#=GS A0A0U9HJT9_KLENI/234-319    AC A0A0U9HJT9.1
#=GS H0EQQ0_GLAL7/21-110         AC H0EQQ0.1
#=GS C5FX42_ARTOC/17-111         AC C5FX42.1
#=GS A0A0G4E965_VITBC/231-319    AC A0A0G4E965.1
#=GS A0A1S2XW64_CICAR/21-111     AC A0A1S2XW64.1
#=GS M2TDW5_COCSN/229-313        AC M2TDW5.1
#=GS I3T2S0_MEDTR/7-118          AC I3T2S0.1
#=GS A0A1L1RN82_CHICK/1-76       AC A0A1L1RN82.1
#=GS A0A226NQY4_COLVI/243-330    AC A0A226NQY4.1
#=GS B8B8R7_ORYSI/17-115         AC B8B8R7.1
#=GS A0A0G2JBQ0_9EURO/17-111     AC A0A0G2JBQ0.1
#=GS A0A094EC41_9PEZI/64-151     AC A0A094EC41.1
#=GS Q6CKV3_KLULA/16-105         AC Q6CKV3.1
#=GS A0A0E0K0L1_ORYPU/17-112     AC A0A0E0K0L1.1
#=GS A0A0D3HHW1_9ORYZ/658-743    AC A0A0D3HHW1.1
#=GS F7BM66_MACMU/17-114         AC F7BM66.1
#=GS Q6L1X7_PICTO/16-100         AC Q6L1X7.1
#=GS C5DBU5_LACTC/19-105         AC C5DBU5.1
#=GS A0A1B8AC72_FUSPO/228-310    AC A0A1B8AC72.1
#=GS A0A1Y1YKC9_9FUNG/17-107     AC A0A1Y1YKC9.1
#=GS A0A075ANS7_9FUNG/20-102     AC A0A075ANS7.1
#=GS F9WYC2_ZYMTI/17-110         AC F9WYC2.1
#=GS S9WA15_9TRYP/21-107         AC S9WA15.1
#=GS F2SIX0_TRIRC/17-112         AC F2SIX0.1
#=GS A0A0V0SDH7_9BILA/231-319    AC A0A0V0SDH7.1
#=GS A0A218W8L1_PUNGR/17-114     AC A0A218W8L1.1
#=GS A0A137NWZ4_CONC2/228-307    AC A0A137NWZ4.1
#=GS S7ZH75_PENO1/229-311        AC S7ZH75.1
#=GS I7LL69_METBM/16-104         AC I7LL69.1
#=GS A0A1I7S900_BURXY/56-149     AC A0A1I7S900.1
#=GS A0A2G9NI84_9ARCH/16-93      AC A0A2G9NI84.1
#=GS A0A044ULC7_ONCVO/119-214    AC A0A044ULC7.1
#=GS A0A178Z3H4_9EURO/21-111     AC A0A178Z3H4.1
#=GS K7F8D5_PELSI/22-111         AC K7F8D5.1
#=GS A0A1F6R522_9ARCH/16-101     AC A0A1F6R522.1
#=GS A0A0E0FJ28_ORYNI/60-118     AC A0A0E0FJ28.1
#=GS A0A0N0V7H4_FUSLA/17-108     AC A0A0N0V7H4.1
#=GS M7YAR9_TRIUA/21-109         AC M7YAR9.1
#=GS A5DN89_PICGU/20-105         AC A5DN89.1
#=GS A0A0E0I0E0_ORYNI/17-107     AC A0A0E0I0E0.1
#=GS M5XF09_PRUPE/234-317        AC M5XF09.1
#=GS A0A0H2RJJ8_9HOMO/21-108     AC A0A0H2RJJ8.1
#=GS A0A1L9RP28_ASPWE/21-108     AC A0A1L9RP28.1
#=GS A0A124F9H8_9EURY/16-104     AC A0A124F9H8.1
#=GS V4TGU5_9ROSI/234-317        AC V4TGU5.1
#=GS M5C4H8_THACB/229-311        AC M5C4H8.1
#=GS A9JSD4_XENTR/17-110         AC A9JSD4.1
#=GS A0A0D2IYS6_9EURO/17-112     AC A0A0D2IYS6.1
#=GS A0A0C9ZBQ9_9HOMO/17-112     AC A0A0C9ZBQ9.1
#=GS A0A167XW61_9HYPO/17-111     AC A0A167XW61.1
#=GS K0SM04_THAOC/27-107         AC K0SM04.1
#=GS K2S4D9_MACPH/21-109         AC K2S4D9.1
#=GS A0A061GVP8_THECC/17-111     AC A0A061GVP8.1
#=GS Q38EY6_TRYB2/18-112         AC Q38EY6.1
#=GS F7CGR0_MACMU/17-121         AC F7CGR0.1
#=GS R7T067_DICSQ/21-110         AC R7T067.1
#=GS RLA2_YEAST/16-105           AC P05319.1
#=GS A0A0H2UHJ3_RAT/22-113       AC A0A0H2UHJ3.1
#=GS G3NIT7_GASAC/22-114         AC G3NIT7.1
#=GS A0A061B6S7_RHOTO/20-107     AC A0A061B6S7.1
#=GS A0A194S8B0_RHOGW/21-108     AC A0A194S8B0.1
#=GS M0U057_MUSAM/23-121         AC M0U057.1
#=GS A0A225X224_9STRA/17-105     AC A0A225X224.1
#=GS A0A2K5HHF5_COLAP/8-103      AC A0A2K5HHF5.1
#=GS A0A067T767_GALM3/229-310    AC A0A067T767.1
#=GS A0A1C1CZY2_9EURO/17-114     AC A0A1C1CZY2.1
#=GS E1F8R2_GIAIA/21-105         AC E1F8R2.1
#=GS M0TF88_MUSAM/24-116         AC M0TF88.1
#=GS A0A165HH78_9BASI/36-127     AC A0A165HH78.1
#=GS A0A0W4ZHM2_PNEJ7/235-313    AC A0A0W4ZHM2.1
#=GS F4X3G3_ACREC/231-317        AC F4X3G3.1
#=GS A0A1E3NTQ8_9ASCO/19-105     AC A0A1E3NTQ8.1
#=GS A0A1D2RFD7_9EURY/230-319    AC A0A1D2RFD7.1
#=GS V4NHE6_EUTSA/21-79          AC V4NHE6.1
#=GS S9WWH1_9TRYP/238-324        AC S9WWH1.1
#=GS A0A1J4JQL0_9EUKA/21-102     AC A0A1J4JQL0.1
#=GS A0A2H9N7Y3_9ARCH/16-105     AC A0A2H9N7Y3.1
#=GS A0A0H1BP61_9EURO/229-311    AC A0A0H1BP61.1
#=GS G0RRC1_HYPJQ/17-108         AC G0RRC1.1
#=GS A0A1S3BFW0_CUCME/17-113     AC A0A1S3BFW0.1
#=GS G8YTA6_PICSO/20-106         AC G8YTA6.1
#=GS A0A2I3GRF4_NOMLE/179-258    AC A0A2I3GRF4.1
#=GS G3AEY9_SPAPN/20-106         AC G3AEY9.1
#=GS A0A1S3BRK9_CUCME/36-119     AC A0A1S3BRK9.1
#=GS E9AGM1_LEIIN/18-110         AC E9AGM1.1
#=GS N1QEP8_SPHMS/229-314        AC N1QEP8.1
#=GS A0A251TKT2_HELAN/36-119     AC A0A251TKT2.1
#=GS A0A183KGV5_9TREM/21-113     AC A0A183KGV5.1
#=GS F0ZBJ8_DICPU/20-101         AC F0ZBJ8.1
#=GS A0A0E0QDY5_ORYRU/234-318    AC A0A0E0QDY5.1
#=GS RLA0_YEAST/229-311          AC P05317.2
#=GS A0A2C6KUF7_9APIC/232-314    AC A0A2C6KUF7.1
#=GS B4JNV5_DROGR/17-113         AC B4JNV5.1
#=GS A0A0L0GDQ9_9EUKA/33-116     AC A0A0L0GDQ9.1
#=GS A0A1X2IE10_9FUNG/177-269    AC A0A1X2IE10.1
#=GS E2AZT8_CAMFO/231-317        AC E2AZT8.1
#=GS K7G2U8_PELSI/231-314        AC K7G2U8.1
#=GS A2YJY3_ORYSI/17-108         AC A2YJY3.1
#=GS A0A1H6IP30_9EURY/16-112     AC A0A1H6IP30.1
#=GS G3VF68_SARHA/231-316        AC G3VF68.1
#=GS A0A0V1DG80_TRIBR/22-119     AC A0A0V1DG80.1
#=GS A0A1F5CT60_9ARCH/16-105     AC A0A1F5CT60.1
#=GS D7LJ05_ARALL/17-111         AC D7LJ05.1
#=GS A0A0D2J5A2_9EURO/238-322    AC A0A0D2J5A2.1
#=GS A0A0N4UEJ8_DRAME/172-263    AC A0A0N4UEJ8.1
#=GS M1W189_CLAP2/30-122         AC M1W189.1
#=GS A0A287DVN8_HORVV/18-75      AC A0A287DVN8.1
#=GS A0A067G0Q0_CITSI/234-317    AC A0A067G0Q0.1
#=GS A0A1J7ITX5_LUPAN/23-116     AC A0A1J7ITX5.1
#=GS M2UGS4_COCH5/21-110         AC M2UGS4.1
#=GS C4YB78_CLAL4/19-104         AC C4YB78.1
#=GS H6C837_EXODN/229-313        AC H6C837.1
#=GS A0A1U7YND4_NICSY/17-112     AC A0A1U7YND4.1
#=GS A0A0E0F292_9ORYZ/228-313    AC A0A0E0F292.1
#=GS A0A1Q3C7G1_CEPFO/56-120     AC A0A1Q3C7G1.1
#=GS W4FS31_9STRA/17-106         AC W4FS31.1
#=GS E7M034_YEASV/16-105         AC E7M034.1
#=GS A0A061J7F0_TRYRA/238-326    AC A0A061J7F0.1
#=GS A0A2C5ZI94_9HYPO/229-312    AC A0A2C5ZI94.1
#=GS A0A2B7ZUN6_9EURO/17-110     AC A0A2B7ZUN6.1
#=GS A0A0F0EMV8_9PSED/109-187    AC A0A0F0EMV8.1
#=GS B4KV97_DROMO/231-316        AC B4KV97.1
#=GS A0A1E4TXH0_PACTA/229-312    AC A0A1E4TXH0.1
#=GS A0A1Y2AJT3_9FUNG/228-310    AC A0A1Y2AJT3.1
#=GS A0A1G4IUU4_9SACH/229-311    AC A0A1G4IUU4.1
#=GS K0TFL1_THAOC/49-138         AC K0TFL1.1
#=GS A0A1U8KKI1_GOSHI/22-113     AC A0A1U8KKI1.1
#=GS A0A1S3X6F5_TOBAC/21-111     AC A0A1S3X6F5.1
#=GS A0A2K5NWR8_CERAT/17-109     AC A0A2K5NWR8.1
#=GS W5MLY8_LEPOC/22-93          AC W5MLY8.1
#=GS A0A199VEM0_ANACO/17-115     AC A0A199VEM0.1
#=GS T1PF19_MUSDO/22-111         AC T1PF19.1
#=GS A0A0D3HHV8_9ORYZ/624-709    AC A0A0D3HHV8.1
#=GS M4EUY7_BRARP/22-112         AC M4EUY7.1
#=GS A0A158PSF6_BRUPA/286-370    AC A0A158PSF6.1
#=GS A0A0N4XBJ9_HAEPC/68-160     AC A0A0N4XBJ9.1
#=GS A0A1E3QDP6_LIPST/229-313    AC A0A1E3QDP6.1
#=GS A0A1L9R8B4_ASPWE/17-108     AC A0A1L9R8B4.1
#=GS A8R3I0_BABBI/231-312        AC A8R3I0.1
#=GS A0A1E3P2T7_WICAO/19-105     AC A0A1E3P2T7.1
#=GS J5PMA5_SACK1/20-105         AC J5PMA5.1
#=GS A0A0D3ELE4_9ORYZ/7-115      AC A0A0D3ELE4.1
#=GS M0M5T9_9EURY/16-112         AC M0M5T9.1
#=GS A0A094H0I7_9PEZI/17-109     AC A0A094H0I7.1
#=GS B0WU22_CULQU/23-112         AC B0WU22.1
#=GS A0A0D3EC30_BRAOL/23-120     AC A0A0D3EC30.1
#=GS A0A0S6XAD9_9FUNG/229-313    AC A0A0S6XAD9.1
#=GS A0A1E7FR21_9STRA/27-111     AC A0A1E7FR21.1
#=GS G3VDC9_SARHA/17-115         AC G3VDC9.1
#=GS R0GFX7_9BRAS/35-120         AC R0GFX7.1
#=GS I1LMP8_SOYBN/234-319        AC I1LMP8.1
#=GS A0A0R0LXA0_9MICR/16-104     AC A0A0R0LXA0.1
#=GS A0A182RJC9_ANOFN/23-112     AC A0A182RJC9.1
#=GS A0A094CIJ4_9PEZI/77-164     AC A0A094CIJ4.1
#=GS B6Q832_TALMQ/21-109         AC B6Q832.1
#=GS M0DJK2_9EURY/16-112         AC M0DJK2.1
#=GS A0A1R1PUK3_ZANCU/21-106     AC A0A1R1PUK3.1
#=GS A0A058ZYT0_EUCGR/21-109     AC A0A058ZYT0.1
#=GS A0A1S3CIR4_CUCME/234-319    AC A0A1S3CIR4.1
#=GS A0DVJ7_PARTE/17-108         AC A0DVJ7.1
#=GS C5GER0_AJEDR/21-109         AC C5GER0.1
#=GS A0A1X7R336_9SACH/17-109     AC A0A1X7R336.1
#=GS Q2NEW3_METST/16-100         AC Q2NEW3.1
#=GS A0A0C2M0P3_THEKT/17-108     AC A0A0C2M0P3.1
#=GS A0A1S4AKW7_TOBAC/17-110     AC A0A1S4AKW7.1
#=GS A0A202DFA6_9ARCH/228-334    AC A0A202DFA6.1
#=GS A0A0L7KVA4_9NEOP/22-109     AC A0A0L7KVA4.1
#=GS A0A078F3D4_BRANA/233-320    AC A0A078F3D4.1
#=GS A0A1E4T3B0_9ASCO/17-106     AC A0A1E4T3B0.1
#=GS A0A2G2YRN7_CAPAN/28-111     AC A0A2G2YRN7.1
#=GS D5GNA1_TUBMM/45-128         AC D5GNA1.1
#=GS A0A2A5VEK9_9EURY/16-101     AC A0A2A5VEK9.1
#=GS A0A1R2BHC1_9CILI/32-116     AC A0A1R2BHC1.1
#=GS B7FMX7_MEDTR/17-112         AC B7FMX7.1
#=GS A0A1S3E061_CICAR/8-83       AC A0A1S3E061.1
#=GS A0A1X7VE32_AMPQE/192-281    AC A0A1X7VE32.1
#=GS M1VWC1_CLAP2/229-312        AC M1VWC1.1
#=GS A0A0K6GHH3_9HOMO/17-111     AC A0A0K6GHH3.1
#=GS A0A0F7VC17_TOXGV/232-313    AC A0A0F7VC17.1
#=GS A0A1Y1Z7A6_9FUNG/17-105     AC A0A1Y1Z7A6.1
#=GS G3HAW3_CRIGR/139-219        AC G3HAW3.1
#=GS L7JTI6_TRAHO/16-100         AC L7JTI6.1
#=GS S3BVM3_OPHP1/17-109         AC S3BVM3.1
#=GS F9FSZ0_FUSOF/21-108         AC F9FSZ0.1
#=GS E1EWH0_GIAIA/17-108         AC E1EWH0.1
#=GS L9JGU4_TUPCH/19-108         AC L9JGU4.1
#=GS D7UBY3_VITVI/17-114         AC D7UBY3.1
#=GS A0A066XTU9_COLSU/229-312    AC A0A066XTU9.1
#=GS E4WRU1_OIKDI/20-106         AC E4WRU1.1
#=GS A0A178EIN5_9PLEO/229-314    AC A0A178EIN5.1
#=GS V5F309_KALBG/21-109         AC V5F309.1
#=GS A5K457_PLAVS/32-118         AC A5K457.1
#=GS A0A1F3BG54_9ARCH/16-95      AC A0A1F3BG54.1
#=GS A0A0E0FHF9_ORYNI/17-113     AC A0A0E0FHF9.1
#=GS A0A2I2YLT3_GORGO/20-96      AC A0A2I2YLT3.1
#=GS A0A0V0VGV8_9BILA/22-119     AC A0A0V0VGV8.1
#=GS A0A1Y2GWT0_9FUNG/228-307    AC A0A1Y2GWT0.1
#=GS R4G8I3_RHOPR/21-115         AC R4G8I3.1
#=GS N6WM01_9EURY/16-103         AC N6WM01.1
#=GS A0A135V5K2_9PEZI/17-110     AC A0A135V5K2.1
#=GS A0A177TNM8_9BASI/229-313    AC A0A177TNM8.1
#=GS A0A059ABQ2_EUCGR/17-112     AC A0A059ABQ2.1
#=GS J0WYZ6_AURST/706-795        AC J0WYZ6.1
#=GS S2J0M7_MUCC1/20-104         AC S2J0M7.1
#=GS A0A0B7N6X9_9FUNG/158-216    AC A0A0B7N6X9.1
#=GS V3ZK14_LOTGI/17-109         AC V3ZK14.1
#=GS A0A077XEA9_PLACH/32-118     AC A0A077XEA9.1
#=GS A0A093UZW5_TALMA/17-110     AC A0A093UZW5.1
#=GS W9W2E2_9EURO/21-113         AC W9W2E2.1
#=GS A0A1L0BAW8_9ASCO/17-108     AC A0A1L0BAW8.1
#=GS A0A0K0JQB1_BRUMA/17-117     AC A0A0K0JQB1.1
#=GS A0A0W1R5P7_9EURY/16-109     AC A0A0W1R5P7.1
#=GS A0A1B8G011_9PEZI/229-311    AC A0A1B8G011.1
#=GS A0A179F7U8_METCM/21-108     AC A0A179F7U8.1
#=GS A0A1Y1XXR8_9FUNG/17-108     AC A0A1Y1XXR8.1
#=GS A0A1A5ZUZ3_9TREE/17-111     AC A0A1A5ZUZ3.1
#=GS A0A1U7TF63_TARSY/18-88      AC A0A1U7TF63.1
#=GS A0A0L1I3Y4_PLAFA/19-99      AC A0A0L1I3Y4.1
#=GS Q4YZB5_PLABA/32-118         AC Q4YZB5.1
#=GS S9X613_SCHCR/21-107         AC S9X613.1
#=GS A0A0E0F295_9ORYZ/228-313    AC A0A0E0F295.1
#=GS A0A096UKU5_WHEAT/17-111     AC A0A096UKU5.1
#=GS W9XMM7_9EURO/21-112         AC W9XMM7.1
#=GS Q6P8D0_XENTR/231-313        AC Q6P8D0.1
#=GS W6PV96_PENRF/17-108         AC W6PV96.1
#=GS A0A168L2K5_CORDF/229-311    AC A0A168L2K5.1
#=GS C1H261_PARBA/17-112         AC C1H261.1
#=GS B4Q638_DROSI/22-111         AC B4Q638.1
#=GS A0A2A9MM56_9APIC/232-313    AC A0A2A9MM56.1
#=GS C5GCV5_AJEDR/229-311        AC C5GCV5.1
#=GS A0A1G4JIL8_9SACH/20-106     AC A0A1G4JIL8.1
#=GS A0A1A6HPZ3_NEOLE/55-127     AC A0A1A6HPZ3.1
#=GS E1QQ70_VULDI/16-112         AC E1QQ70.1
#=GS A0A0D9NRF7_METAN/21-108     AC A0A0D9NRF7.1
#=GS G3UM10_LOXAF/1-90           AC G3UM10.1
#=GS L9W1T8_9EURY/16-111         AC L9W1T8.1
#=GS M7XM82_RHOT1/20-107         AC M7XM82.1
#=GS A0A163JE40_ABSGL/17-108     AC A0A163JE40.1
#=GS A0A1B9GCS6_9TREE/17-112     AC A0A1B9GCS6.1
#=GS A0A250X6Z6_9CHLO/17-107     AC A0A250X6Z6.1
#=GS A0A195F9X6_9HYME/17-113     AC A0A195F9X6.1
#=GS A0A1Y3NCR8_PIRSE/21-105     AC A0A1Y3NCR8.1
#=GS A0A182WRI6_ANOQN/17-111     AC A0A182WRI6.1
#=GS Q2UN68_ASPOR/21-108         AC Q2UN68.1
#=GS C4M661_ENTHI/25-111         AC C4M661.1
#=GS A0A2G2XN91_CAPBA/21-112     AC A0A2G2XN91.1
#=GS A0A183CJ92_GLOPA/22-114     AC A0A183CJ92.1
#=GS A0A0M3K9J4_ANISI/17-115     AC A0A0M3K9J4.1
#=GS W9I222_FUSOX/17-109         AC W9I222.1
#=GS A0A226ENU3_FOLCA/22-112     AC A0A226ENU3.1
#=GS H2NWC9_PONAB/207-286        AC H2NWC9.1
#=GS Q74MP7_NANEQ/16-100         AC Q74MP7.1
#=GS K8Z4E8_NANGC/17-111         AC K8Z4E8.1
#=GS A0A1U7UFL5_TARSY/231-316    AC A0A1U7UFL5.1
#=GS A0A1G4MEP8_LACFM/17-109     AC A0A1G4MEP8.1
#=GS M3XVC4_MUSPF/231-316        AC M3XVC4.1
#=GS A0A1Y1IF90_KLENI/17-114     AC A0A1Y1IF90.1
#=GS A8BCP0_GIAIC/17-108         AC A8BCP0.1
#=GS A7RLY2_NEMVE/17-112         AC A7RLY2.1
#=GS A0A1B9GGC3_9TREE/20-108     AC A0A1B9GGC3.1
#=GS A0A0K9Q2S3_ZOSMR/21-106     AC A0A0K9Q2S3.1
#=GS A0A1S2XD74_CICAR/17-112     AC A0A1S2XD74.1
#=GS A0A0F4XBV2_HANUV/229-312    AC A0A0F4XBV2.1
#=GS Q8AVI3_XENLA/231-314        AC Q8AVI3.1
#=GS A0A0E0BEZ8_9ORYZ/234-319    AC A0A0E0BEZ8.1
#=GS A0A1S4CMP3_TOBAC/17-111     AC A0A1S4CMP3.1
#=GS L8FTW4_PSED2/75-162         AC L8FTW4.1
#=GS G7E9A5_MIXOS/229-311        AC G7E9A5.1
#=GS A0A0C7N0K4_9SACH/229-310    AC A0A0C7N0K4.1
#=GS A0A0M3QTA0_DROBS/22-111     AC A0A0M3QTA0.1
#=GS A0A1S4C137_TOBAC/34-120     AC A0A1S4C137.1
#=GS A0A0D3G894_9ORYZ/17-112     AC A0A0D3G894.1
#=GS A0A1I8HRR0_9PLAT/231-309    AC A0A1I8HRR0.1
#=GS A0A177VN65_9BASI/17-111     AC A0A177VN65.1
#=GS D8SKL7_SELML/234-321        AC D8SKL7.1
#=GS A0A0C3C085_9HOMO/17-111     AC A0A0C3C085.1
#=GS A0A139HAW0_9PEZI/229-314    AC A0A139HAW0.1
#=GS RLA1_DROME/22-111           AC P08570.2
#=GS A0A2I0MI96_COLLI/48-145     AC A0A2I0MI96.1
#=GS I2GW86_TETBL/19-104         AC I2GW86.1
#=GS F2L4Y4_THEU7/16-109         AC F2L4Y4.1
#=GS W9Y5G9_9EURO/21-111         AC W9Y5G9.1
#=GS M3WIQ1_FELCA/231-316        AC M3WIQ1.1
#=GS A0A177CXC3_9PLEO/33-122     AC A0A177CXC3.1
#=GS A0A168NKM2_ABSGL/20-104     AC A0A168NKM2.1
#=GS I2G477_USTH4/21-109         AC I2G477.1
#=GS A0A1L9SL36_9EURO/229-311    AC A0A1L9SL36.1
#=GS A0A0P1A9A3_9STRA/9-81       AC A0A0P1A9A3.1
#=GS L2FXN9_COLGN/229-310        AC L2FXN9.1
#=GS A0A182EPR6_ONCOC/21-115     AC A0A182EPR6.1
#=GS J9EXX5_WUCBA/205-293        AC J9EXX5.1
#=GS V4LTA0_EUTSA/17-112         AC V4LTA0.1
#=GS M2XBC1_GALSU/24-117         AC M2XBC1.1
#=GS D5GI14_TUBMM/21-110         AC D5GI14.1
#=GS A0A1E4U2D2_PACTA/22-109     AC A0A1E4U2D2.1
#=GS D3AX76_POLPP/227-306        AC D3AX76.1
#=GS A0A182KXJ9_9DIPT/231-313    AC A0A182KXJ9.2
#=GS A0A0K9PW46_ZOSMR/234-317    AC A0A0K9PW46.1
#=GS RLA0_MOUSE/231-316          AC P14869.3
#=GS L1JF24_GUITH/17-115         AC L1JF24.1
#=GS A0A1E5VEP5_9POAL/60-119     AC A0A1E5VEP5.1
#=GS A0A1S3TPG3_VIGRR/234-318    AC A0A1S3TPG3.1
#=GS A0A177CK25_9PLEO/21-109     AC A0A177CK25.1
#=GS A0A0E9NCI1_9ASCO/17-85      AC A0A0E9NCI1.1
#=GS A0A0J0XUV6_9TREE/35-121     AC A0A0J0XUV6.1
#=GS A0A1E7FVD7_9STRA/17-105     AC A0A1E7FVD7.1
#=GS M4B8F7_HYAAE/28-116         AC M4B8F7.1
#=GS F0UHQ1_AJEC8/229-310        AC F0UHQ1.1
#=GS A0A0C7MVK1_9SACH/17-107     AC A0A0C7MVK1.1
#=GS A0A068X9N1_HYMMI/17-118     AC A0A068X9N1.1
#=GS A0A017SGB0_9EURO/17-103     AC A0A017SGB0.1
#=GS Q4U8Y0_THEAN/32-115         AC Q4U8Y0.1
#=GS A9S0Q1_PHYPA/234-317        AC A9S0Q1.1
#=GS A0A0D1Y8T5_9EURO/21-113     AC A0A0D1Y8T5.1
#=GS A0A1U7X7K6_NICSY/135-212    AC A0A1U7X7K6.1
#=GS A0A150JIS6_9EURY/16-103     AC A0A150JIS6.1
#=GS A0A1S9DDW1_ASPOZ/17-108     AC A0A1S9DDW1.1
#=GS A0A061EH68_THECC/54-138     AC A0A061EH68.1
#=GS K3WAY4_PYTUL/231-313        AC K3WAY4.1
#=GS J7RX09_KAZNA/17-109         AC J7RX09.1
#=GS A0A1U7T3E9_TARSY/22-113     AC A0A1U7T3E9.1
#=GS A0A0K9PQU4_ZOSMR/18-118     AC A0A0K9PQU4.1
#=GS A0A0E0I9A7_ORYNI/81-178     AC A0A0E0I9A7.1
#=GS L9Y8J9_9EURY/16-116         AC L9Y8J9.1
#=GS A0A087XNW5_POEFO/231-313    AC A0A087XNW5.1
#=GS A0A067D2A1_SAPPC/26-111     AC A0A067D2A1.1
#=GS A0A0D2P7A3_GOSRA/22-113     AC A0A0D2P7A3.1
#=GS A0A1J1H567_PLARL/19-111     AC A0A1J1H567.1
#=GS A0A2G2WB13_CAPBA/17-113     AC A0A2G2WB13.1
#=GS J3NN59_GAGT3/21-108         AC J3NN59.1
#=GS A0A1B7TDG3_9ASCO/20-105     AC A0A1B7TDG3.1
#=GS A0A2I3RVV0_PANTR/20-101     AC A0A2I3RVV0.1
#=GS A4I600_LEIIN/16-104         AC A4I600.1
#=GS S8DMC0_9LAMI/49-136         AC S8DMC0.1
#=GS A0A218P4I0_THECE/16-104     AC A0A218P4I0.1
#=GS A0A0E0IXV7_ORYNI/327-412    AC A0A0E0IXV7.1
#=GS A0A0G4LSW0_9PEZI/21-108     AC A0A0G4LSW0.1
#=GS G4UBW2_NEUT9/229-312        AC G4UBW2.1
#=GS A0A1L9NCS2_ASPTU/229-311    AC A0A1L9NCS2.1
#=GS A0A1L9TIX9_9EURO/21-108     AC A0A1L9TIX9.1
#=GS A0A0L0CK74_LUCCU/231-314    AC A0A0L0CK74.1
#=GS A0A0D3ALH8_BRAOL/34-119     AC A0A0D3ALH8.1
#=GS G1XQL0_ARTOA/229-311        AC G1XQL0.1
#=GS RLA3_ORYSJ/57-118           AC P56724.3
#=GS A0A1V6Q418_9EURO/21-106     AC A0A1V6Q418.1
#=GS C5MFP2_CANTT/229-312        AC C5MFP2.1
#=GS A0A2C6A8K6_9HYPO/21-108     AC A0A2C6A8K6.1
#=GS R0GMM5_9BRAS/22-112         AC R0GMM5.1
#=GS A0A0K6GBI9_9HOMO/229-310    AC A0A0K6GBI9.1
#=GS A0A0P7TND6_9TELE/17-114     AC A0A0P7TND6.1
#=GS A0A0H5C780_CYBJA/21-106     AC A0A0H5C780.1
#=GS Q6BTV6_DEBHA/17-105         AC Q6BTV6.1
#=GS A0A0D9S4H7_CHLSB/192-278    AC A0A0D9S4H7.1
#=GS A0A067R8K2_ZOONE/231-315    AC A0A067R8K2.1
#=GS A0A1D6BQM7_WHEAT/234-318    AC A0A1D6BQM7.1
#=GS A0A093ZJN5_9PEZI/44-121     AC A0A093ZJN5.1
#=GS W9XZP7_9EURO/224-308        AC W9XZP7.1
#=GS U1PKY5_9EURY/16-115         AC U1PKY5.1
#=GS U3JJL0_FICAL/22-114         AC U3JJL0.1
#=GS A0A0P9AUI5_9ARCH/16-101     AC A0A0P9AUI5.1
#=GS G7PXE7_MACFA/22-112         AC G7PXE7.1
#=GS W2Q1X9_PHYPN/17-105         AC W2Q1X9.1
#=GS A0A182U088_9DIPT/17-111     AC A0A182U088.1
#=GS A0A1F5DF57_9ARCH/16-101     AC A0A1F5DF57.1
#=GS A0A2K1ITT4_PHYPA/98-184     AC A0A2K1ITT4.1
#=GS J2ZEE5_9EURY/16-109         AC J2ZEE5.1
#=GS G1NWS2_MYOLU/231-316        AC G1NWS2.1
#=GS A0A022RU39_ERYGU/233-320    AC A0A022RU39.1
#=GS H2KQZ8_CLOSI/21-112         AC H2KQZ8.1
#=GS A0A067F116_CITSI/17-112     AC A0A067F116.1
#=GS A0A0L0BXI3_LUCCU/5-60       AC A0A0L0BXI3.1
#=GS A0A063BWC6_9HYPO/229-315    AC A0A063BWC6.1
#=GS A0A1V6UUG5_9EURO/17-108     AC A0A1V6UUG5.1
#=GS A0A1L9VCL0_ASPGL/17-107     AC A0A1L9VCL0.1
#=GS A0A1J4KKP6_9EUKA/232-314    AC A0A1J4KKP6.1
#=GS E2BWC5_HARSA/231-315        AC E2BWC5.1
#=GS A0A1G4JJI9_9SACH/229-310    AC A0A1G4JJI9.1
#=GS A0A2A9PK64_9HYPO/82-174     AC A0A2A9PK64.1
#=GS A0A024UX89_PLAFA/231-315    AC A0A024UX89.1
#=GS K4CF45_SOLLC/22-111         AC K4CF45.1
#=GS S9VM59_9TRYP/220-308        AC S9VM59.1
#=GS A0A0G4IPZ6_PLABS/234-311    AC A0A0G4IPZ6.1
#=GS E2M4E2_MONPE/46-139         AC E2M4E2.1
#=GS A0A256YGZ4_9CREN/16-109     AC A0A256YGZ4.1
#=GS A0A0K9PWV9_ZOSMR/44-130     AC A0A0K9PWV9.1
#=GS A0A0F9Y671_TRIHA/229-313    AC A0A0F9Y671.1
#=GS F7HNN5_MACMU/22-113         AC F7HNN5.1
#=GS A0A2G9NQ49_9ARCH/16-92      AC A0A2G9NQ49.1
#=GS A0A1Y2HZP0_9FUNG/17-109     AC A0A1Y2HZP0.1
#=GS L8H393_ACACA/1461-1531      AC L8H393.1
#=GS A0A2A2HDV9_9EURY/16-99      AC A0A2A2HDV9.1
#=GS A0A2I0P1I2_9EURY/10-100     AC A0A2I0P1I2.1
#=GS A0A1A9VWL6_GLOAU/7-76       AC A0A1A9VWL6.1
#=GS A0A2G2W1T7_CAPBA/187-274    AC A0A2G2W1T7.1
#=GS Q75CU7_ASHGO/229-308        AC Q75CU7.2
#=GS I2GZZ8_TETBL/20-104         AC I2GZZ8.1
#=GS A0A0P0WMX1_ORYSJ/1-74       AC A0A0P0WMX1.1
#=GS A0A0C7N185_9SACH/17-110     AC A0A0C7N185.1
#=GS R1G7Z8_BOTPV/21-109         AC R1G7Z8.1
#=GS RLA3_SCHPO/21-109           AC P17477.1
#=GS A0A0A1U4I2_ENTIV/36-123     AC A0A0A1U4I2.1
#=GS A0A2H3X6R2_PHODC/135-220    AC A0A2H3X6R2.1
#=GS A0A0D9X3U7_9ORYZ/65-115     AC A0A0D9X3U7.1
#=GS A0A1S2XP76_CICAR/13-88      AC A0A1S2XP76.1
#=GS F8PYH4_SERL3/229-310        AC F8PYH4.1
#=GS A0A175YBF6_DAUCA/17-114     AC A0A175YBF6.1
#=GS A0A0N4X6I9_HAEPC/21-80      AC A0A0N4X6I9.1
#=GS A0A1Q2YE93_9ASCO/229-311    AC A0A1Q2YE93.1
#=GS A0A0E0IXY6_ORYNI/652-736    AC A0A0E0IXY6.1
#=GS C5KGG1_PERM5/234-317        AC C5KGG1.1
#=GS A0A1E5RJW4_HANUV/20-104     AC A0A1E5RJW4.1
#=GS A0A0L6W8Y5_9AGAR/64-152     AC A0A0L6W8Y5.1
#=GS A0A218UML4_9PASE/22-113     AC A0A218UML4.1
#=GS A0A2H3YNH3_PHODC/25-121     AC A0A2H3YNH3.1
#=GS A0A256ZZM1_9ARCH/16-100     AC A0A256ZZM1.1
#=GS A0A0R3UEI3_9CEST/231-318    AC A0A0R3UEI3.2
#=GS E2BUQ0_HARSA/17-110         AC E2BUQ0.1
#=GS A0A0V1LRZ9_9BILA/22-119     AC A0A0V1LRZ9.1
#=GS A0A1U7KDA2_9APHY/17-110     AC A0A1U7KDA2.1
#=GS A0A0F0I7D7_ASPPU/21-107     AC A0A0F0I7D7.1
#=GS J9I3W2_9SPIT/17-105         AC J9I3W2.1
#=GS A0A0C4EXG3_PUCT1/5-65       AC A0A0C4EXG3.1
#=GS A0A2I3RA27_PANTR/20-96      AC A0A2I3RA27.1
#=GS A0A059CSI3_EUCGR/13-119     AC A0A059CSI3.1
#=GS E7NGH5_YEASO/20-105         AC E7NGH5.1
#=GS B8B251_ORYSI/410-466        AC B8B251.1
#=GS A0A0G4MST5_9PEZI/229-311    AC A0A0G4MST5.1
#=GS A0A0K9RSB2_SPIOL/234-319    AC A0A0K9RSB2.1
#=GS V4GP54_9EURY/16-119         AC V4GP54.1
#=GS F0XRQ9_GROCL/17-110         AC F0XRQ9.1
#=GS A0A151W9I7_HYPMA/248-328    AC A0A151W9I7.1
#=GS A0A182ZN95_BIOGL/231-317    AC A0A182ZN95.2
#=GS A0A1X7R0S5_9SACH/22-107     AC A0A1X7R0S5.1
#=GS M1AAF6_SOLTU/34-122         AC M1AAF6.1
#=GS A0A166HTJ9_DAUCA/18-119     AC A0A166HTJ9.1
#=GS A0A1Y1JE51_PLAGO/32-118     AC A0A1Y1JE51.1
#=GS A0A139I9S3_9PEZI/627-710    AC A0A139I9S3.1
#=GS A0A1J4J6E7_9EUKA/21-105     AC A0A1J4J6E7.1
#=GS A0A1S2Z8L7_CICAR/21-111     AC A0A1S2Z8L7.1
#=GS Q9FLV1_ARATH/21-110         AC Q9FLV1.1
#=GS F2PRE9_TRIEC/21-104         AC F2PRE9.1
#=GS A0A1V6N4Z7_9EURY/16-101     AC A0A1V6N4Z7.1
#=GS X6MM70_RETFI/25-137         AC X6MM70.1
#=GS A0A0E0F2E2_9ORYZ/697-782    AC A0A0E0F2E2.1
#=GS A0A251VBQ7_HELAN/21-110     AC A0A251VBQ7.1
#=GS M7NX35_PNEMU/229-306        AC M7NX35.1
#=GS F6TQ53_MACMU/22-113         AC F6TQ53.1
#=GS A0A0W0FKD7_9AGAR/229-312    AC A0A0W0FKD7.1
#=GS A0A0B0N5W8_GOSAR/234-320    AC A0A0B0N5W8.1
#=GS A0A091M6C9_CARIC/17-107     AC A0A091M6C9.1
#=GS A0A059JFE7_9EURO/229-310    AC A0A059JFE7.1
#=GS A0A015I1B3_9GLOM/21-109     AC A0A015I1B3.1
#=GS A0A0L0C2H7_LUCCU/17-112     AC A0A0L0C2H7.1
#=GS A0A1R3JD19_COCAP/234-319    AC A0A1R3JD19.1
#=GS A0A0D2CMX9_9EURO/21-111     AC A0A0D2CMX9.1
#=GS A0A026WMK5_OOCBI/22-109     AC A0A026WMK5.1
#=GS A0A0L0BKJ7_LUCCU/14-48      AC A0A0L0BKJ7.1
#=GS G0QXJ2_ICHMG/32-122         AC G0QXJ2.1
#=GS A0A179HNC8_9HYPO/229-310    AC A0A179HNC8.1
#=GS A0A0C9X1J7_9AGAR/21-109     AC A0A0C9X1J7.1
#=GS A0A1Y2G908_9FUNG/19-106     AC A0A1Y2G908.1
#=GS A8WQU5_CAEBR/17-110         AC A8WQU5.1
#=GS A0A0D2A2J8_9PEZI/230-313    AC A0A0D2A2J8.1
#=GS A0A183F454_HELBK/17-108     AC A0A183F454.1
#=GS A0A0K9Q845_SPIOL/1-81       AC A0A0K9Q845.1
#=GS I3N2E2_ICTTR/22-113         AC I3N2E2.1
#=GS F2U5W8_SALR5/21-106         AC F2U5W8.1
#=GS Q2QY46_ORYSJ/234-319        AC Q2QY46.1
#=GS F4IGR4_ARATH/42-129         AC F4IGR4.1
#=GS F2SXS7_TRIRC/164-252        AC F2SXS7.2
#=GS A0A2D0QDI5_ICTPU/17-114     AC A0A2D0QDI5.1
#=GS Q16FG5_AEDAE/32-105         AC Q16FG5.1
#=GS A0A100INH0_ASPNG/21-107     AC A0A100INH0.1
#=GS A0A1E5RDQ1_HANUV/229-312    AC A0A1E5RDQ1.1
#=GS F7GMF8_MACMU/22-113         AC F7GMF8.1
#=GS A0CXL4_PARTE/21-105         AC A0CXL4.1
#=GS A0A060SRB2_PYCCI/229-312    AC A0A060SRB2.1
#=GS A0A1W4X9G2_AGRPL/22-112     AC A0A1W4X9G2.1
#=GS A0A1E3PWL7_LIPST/29-73      AC A0A1E3PWL7.1
#=GS K1QVV8_CRAGI/65-159         AC K1QVV8.1
#=GS S8CWB2_9LAMI/241-328        AC S8CWB2.1
#=GS S7PTT8_GLOTA/21-109         AC S7PTT8.1
#=GS A0A1V6SKG6_9EURO/21-106     AC A0A1V6SKG6.1
#=GS A0A0D1W4W7_9EURO/229-315    AC A0A0D1W4W7.1
#=GS A0A1E3PBX2_WICAO/20-106     AC A0A1E3PBX2.1
#=GS S8D3D7_9LAMI/19-119         AC S8D3D7.1
#=GS A0A1D1V394_RAMVA/192-285    AC A0A1D1V394.1
#=GS A0A091IK07_CALAN/233-319    AC A0A091IK07.1
#=GS M3ILW0_CANMX/229-286        AC M3ILW0.1
#=GS A0A0A2KP39_PENEN/17-107     AC A0A0A2KP39.1
#=GS R1GAY5_BOTPV/17-109         AC R1GAY5.1
#=GS S7PZG6_MYOBR/231-316        AC S7PZG6.1
#=GS S2JPN3_MUCC1/20-104         AC S2JPN3.1
#=GS Q0UPB2_PHANO/22-113         AC Q0UPB2.1
#=GS A0A2B7YC76_9EURO/229-310    AC A0A2B7YC76.1
#=GS S6E2M7_ZYGB2/19-105         AC S6E2M7.1
#=GS A0A1L1RQY9_CHICK/22-90      AC A0A1L1RQY9.1
#=GS G0VJ49_NAUCC/17-110         AC G0VJ49.1
#=GS C4R8M3_KOMPG/19-106         AC C4R8M3.1
#=GS A3CSJ8_METMJ/16-104         AC A3CSJ8.1
#=GS A0CPJ7_PARTE/17-111         AC A0CPJ7.1
#=GS A0A078B6E4_STYLE/17-107     AC A0A078B6E4.1
#=GS B8N1E9_ASPFN/229-312        AC B8N1E9.1
#=GS B3MPX0_DROAN/17-112         AC B3MPX0.1
#=GS S9V9M3_9TRYP/18-111         AC S9V9M3.1
#=GS V4MJB8_EUTSA/234-316        AC V4MJB8.1
#=GS G3H8J3_CRIGR/22-95          AC G3H8J3.1
#=GS A0A0R3S1N2_9BILA/231-319    AC A0A0R3S1N2.1
#=GS A0A194WVZ2_9HELO/21-110     AC A0A194WVZ2.1
#=GS G3JMH3_CORMM/17-147         AC G3JMH3.1
#=GS Q8TI79_METAC/16-103         AC Q8TI79.1
#=GS A0A1E4TT32_PACTA/17-108     AC A0A1E4TT32.1
#=GS A0A0D3HR36_9ORYZ/870-955    AC A0A0D3HR36.1
#=GS T1KYW1_TETUR/231-314        AC T1KYW1.1
#=GS Q2U017_ASPOR/17-108         AC Q2U017.1
#=GS A0A1B8GEA0_9PEZI/21-108     AC A0A1B8GEA0.1
#=GS V8N9J7_OPHHA/213-296        AC V8N9J7.1
#=GS B3L4I3_PLAKH/32-118         AC B3L4I3.1
#=GS A0A0D9X3U6_9ORYZ/65-153     AC A0A0D9X3U6.1
#=GS A0A072P706_9EURO/237-321    AC A0A072P706.1
#=GS A0A2H2Z705_9HYPO/229-314    AC A0A2H2Z705.1
#=GS A0A059EMT3_9MICR/16-101     AC A0A059EMT3.1
#=GS D8LYC9_BLAHO/24-107         AC D8LYC9.1
#=GS W5H8V6_WHEAT/13-119         AC W5H8V6.1
#=GS A0A0D1ZSR8_9EURO/229-314    AC A0A0D1ZSR8.1
#=GS A0A0N4Z2R5_PARTI/17-107     AC A0A0N4Z2R5.1
#=GS A9RKJ0_PHYPA/17-113         AC A9RKJ0.1
#=GS K3ZY88_SETIT/17-111         AC K3ZY88.1
#=GS A0A0L1IY86_ASPNO/21-107     AC A0A0L1IY86.1
#=GS H0ZGQ3_TAEGU/231-317        AC H0ZGQ3.1
#=GS A0A182E6D2_ONCOC/231-319    AC A0A182E6D2.1
#=GS A0A1Y3N8I7_PIRSE/21-106     AC A0A1Y3N8I7.1
#=GS A0A0K9P964_ZOSMR/234-315    AC A0A0K9P964.1
#=GS A0A2G8KXI9_STIJA/203-265    AC A0A2G8KXI9.1
#=GS A0A256ZBA7_9ARCH/16-104     AC A0A256ZBA7.1
#=GS A0A0G4LXV4_9PEZI/22-114     AC A0A0G4LXV4.1
#=GS A9PAR7_POPTR/17-113         AC A9PAR7.1
#=GS U3K7C4_FICAL/17-114         AC U3K7C4.1
#=GS C5YA36_SORBI/17-111         AC C5YA36.1
#=GS A0A165WR98_9HOMO/21-109     AC A0A165WR98.1
#=GS A0A0R0M2M0_9MICR/23-107     AC A0A0R0M2M0.1
#=GS W9SDU7_9ROSA/135-223        AC W9SDU7.1
#=GS A0A0D1ZG47_9EURO/17-113     AC A0A0D1ZG47.1
#=GS A0A182HAP0_AEDAL/17-111     AC A0A182HAP0.1
#=GS M3ZAZ1_NOMLE/17-114         AC M3ZAZ1.1
#=GS A0A1L9T462_9EURO/17-62      AC A0A1L9T462.1
#=GS A0A0B2W1V0_TOXCA/29-121     AC A0A0B2W1V0.1
#=GS A0A1Z9U994_9EURY/16-101     AC A0A1Z9U994.1
#=GS A0A1S4CUG0_TOBAC/21-112     AC A0A1S4CUG0.1
#=GS A0A096PA80_OSTTA/17-106     AC A0A096PA80.1
#=GS A0A024G6R9_9STRA/26-113     AC A0A024G6R9.1
#=GS G5C8G4_HETGA/17-114         AC G5C8G4.1
#=GS W5Q9W4_SHEEP/17-113         AC W5Q9W4.1
#=GS A0A139IKA9_9PEZI/285-370    AC A0A139IKA9.1
#=GS A0A1C1CI82_9EURO/229-314    AC A0A1C1CI82.1
#=GS A0A1S4CPG9_TOBAC/34-120     AC A0A1S4CPG9.1
#=GS A0A075AV84_9FUNG/382-470    AC A0A075AV84.1
#=GS A0A1I7RYW0_BURXY/231-313    AC A0A1I7RYW0.1
#=GS A0A196SHP8_BLAHN/17-108     AC A0A196SHP8.1
#=GS A0A0V1AFD5_9BILA/231-319    AC A0A0V1AFD5.1
#=GS A0A162VM69_DIDRA/229-315    AC A0A162VM69.1
#=GS A0A2G9P6C6_9ARCH/16-96      AC A0A2G9P6C6.1
#=GS D7KQB4_ARALL/22-112         AC D7KQB4.1
#=GS A0A0A1P0P5_9FUNG/17-107     AC A0A0A1P0P5.1
#=GS A0A2H9L0X7_9ARCH/19-102     AC A0A2H9L0X7.1
#=GS A0A2B7GQ56_9EURY/16-115     AC A0A2B7GQ56.1
#=GS A0A2C9LL00_BIOGL/78-161     AC A0A2C9LL00.1
#=GS I1S0X6_GIBZE/21-107         AC I1S0X6.1
#=GS A0A2H2IGU5_CAEJA/231-311    AC A0A2H2IGU5.1
#=GS U5FYU7_POPTR/21-108         AC U5FYU7.1
#=GS A0A0F4ZAS3_9PEZI/17-108     AC A0A0F4ZAS3.1
#=GS F6HNI3_VITVI/234-319        AC F6HNI3.1
#=GS A0A1W0X4G6_HYPDU/70-165     AC A0A1W0X4G6.1
#=GS E9AI48_LEIBR/20-106         AC E9AI48.1
#=GS A0A1U8H2V8_CAPAN/234-317    AC A0A1U8H2V8.1
#=GS A0B920_METTP/16-104         AC A0B920.1
#=GS Q17PA3_AEDAE/25-95          AC Q17PA3.1
#=GS A0A1A9VSY7_GLOAU/17-112     AC A0A1A9VSY7.1
#=GS A0A182Q7D3_9DIPT/231-314    AC A0A182Q7D3.1
#=GS A0A183PY38_9TREM/17-105     AC A0A183PY38.1
#=GS A0A0D2D885_9EURO/229-314    AC A0A0D2D885.1
#=GS A0A1H6SS31_9EURY/16-116     AC A0A1H6SS31.1
#=GS H2N5Q2_PONAB/209-291        AC H2N5Q2.1
#=GS U4LUU2_PYROM/228-313        AC U4LUU2.1
#=GS A0A0S6XHP9_9FUNG/21-99      AC A0A0S6XHP9.1
#=GS A0A0L1HJH2_9PLEO/229-313    AC A0A0L1HJH2.1
#=GS B7PRG2_IXOSC/231-318        AC B7PRG2.1
#=GS A0A0N0DGT6_FUSLA/21-108     AC A0A0N0DGT6.1
#=GS A0A1Y1Y099_9FUNG/20-97      AC A0A1Y1Y099.1
#=GS A0A151ZSZ5_9MYCE/17-112     AC A0A151ZSZ5.1
#=GS J9VVZ9_CRYNH/229-311        AC J9VVZ9.1
#=GS V4YHH6_9ARCH/16-111         AC V4YHH6.1
#=GS A0A194UQP5_9PEZI/229-312    AC A0A194UQP5.1
#=GS A0A0L9TJZ6_PHAAN/30-118     AC A0A0L9TJZ6.1
#=GS F3KMH2_9ARCH/16-96          AC F3KMH2.1
#=GS F9G530_FUSOF/17-109         AC F9G530.1
#=GS A0A1U7YTX1_NELNU/17-113     AC A0A1U7YTX1.1
#=GS S7NHZ5_MYOBR/24-115         AC S7NHZ5.1
#=GS A0A1V6YBK1_PENNA/229-311    AC A0A1V6YBK1.1
#=GS W3X6Q8_PESFW/21-109         AC W3X6Q8.1
#=GS A0A0K9QR72_SPIOL/21-107     AC A0A0K9QR72.1
#=GS C4WU73_ACYPI/23-110         AC C4WU73.1
#=GS A0A091UZ55_PHALP/17-109     AC A0A091UZ55.1
#=GS A0A094ZI98_SCHHA/21-113     AC A0A094ZI98.1
#=GS A0A1Q2YKP6_9ASCO/17-107     AC A0A1Q2YKP6.1
#=GS A0A094AH38_9PEZI/229-309    AC A0A094AH38.1
#=GS A0A1V1TQE8_9FUNG/229-311    AC A0A1V1TQE8.1
#=GS B4KFI9_DROMO/22-111         AC B4KFI9.1
#=GS A0A1E4S7N9_CYBJA/12-101     AC A0A1E4S7N9.1
#=GS W7A5U6_9APIC/231-315        AC W7A5U6.1
#=GS A0A1Y1JFP4_PLAGO/231-315    AC A0A1Y1JFP4.1
#=GS A0A067FNS1_CITSI/234-318    AC A0A067FNS1.1
#=GS A0A135V5J4_9PEZI/229-313    AC A0A135V5J4.1
#=GS G3T9P3_LOXAF/22-112         AC G3T9P3.1
#=GS M5X177_PRUPE/21-109         AC M5X177.1
#=GS A0A199VHP1_ANACO/22-114     AC A0A199VHP1.1
#=GS W5K7A3_ASTMX/17-113         AC W5K7A3.1
#=GS M4A9A3_XIPMA/17-115         AC M4A9A3.1
#=GS Q6CEP2_YARLI/231-313        AC Q6CEP2.1
#=GS A0A202EDE9_9EURY/16-114     AC A0A202EDE9.1
#=GS G3AQQ2_SPAPN/16-109         AC G3AQQ2.1
#=GS A0A2I3TSD2_PANTR/231-317    AC A0A2I3TSD2.1
#=GS Q16FZ1_AEDAE/17-95          AC Q16FZ1.1
#=GS A0A022PS20_ERYGU/234-321    AC A0A022PS20.1
#=GS A0A0P6VKK7_9EURY/16-103     AC A0A0P6VKK7.1
#=GS L2GQ90_VITCO/22-105         AC L2GQ90.1
#=GS A2DY95_TRIVA/20-102         AC A2DY95.1
#=GS A0A1Y1Y9T3_9FUNG/20-105     AC A0A1Y1Y9T3.1
#=GS A0A1E4RUY7_CYBJA/21-106     AC A0A1E4RUY7.1
#=GS J4DNE2_THEOR/231-312        AC J4DNE2.1
#=GS G3T948_LOXAF/231-317        AC G3T948.1
#=GS A0A1S4AV90_TOBAC/234-321    AC A0A1S4AV90.1
#=GS A0A061ED56_THECC/69-142     AC A0A061ED56.1
#=GS W9SKG9_9ROSA/21-110         AC W9SKG9.1
#=GS S8C6W4_9LAMI/2-52           AC S8C6W4.1
#=GS M3X004_FELCA/24-108         AC M3X004.2
#=GS E7NG69_YEASO/17-109         AC E7NG69.1
#=GS E3RLB1_PYRTT/17-111         AC E3RLB1.1
#=GS A8MQR4_ARATH/200-284        AC A8MQR4.1
#=GS A0A1I8BD55_MELHA/231-313    AC A0A1I8BD55.1
#=GS A0A1V8T4W8_9PEZI/17-112     AC A0A1V8T4W8.1
#=GS A0A2H3YLN1_PHODC/21-109     AC A0A2H3YLN1.1
#=GS G1M6P5_AILME/22-113         AC G1M6P5.1
#=GS S9V9X6_9TRYP/16-105         AC S9V9X6.1
#=GS A0A074ZID6_9TREM/21-112     AC A0A074ZID6.1
#=GS U6H304_9EIME/19-112         AC U6H304.1
#=GS G3PS60_GASAC/17-104         AC G3PS60.1
#=GS M4B8T5_HYAAE/28-115         AC M4B8T5.1
#=GS A0A091D9Z9_FUKDA/229-315    AC A0A091D9Z9.1
#=GS A0A0E0IXV4_ORYNI/654-739    AC A0A0E0IXV4.1
#=GS A0A1S3UE79_VIGRR/17-112     AC A0A1S3UE79.1
#=GS F4WYW0_ACREC/17-61          AC F4WYW0.1
#=GS R0G0H9_9BRAS/234-318        AC R0G0H9.1
#=GS A0A1B8CAT0_9PEZI/21-108     AC A0A1B8CAT0.1
#=GS E9ILW5_SOLIN/17-113         AC E9ILW5.1
#=GS A0A2I3MQG2_PAPAN/22-113     AC A0A2I3MQG2.1
#=GS A0A074S6L3_9HOMO/21-110     AC A0A074S6L3.1
#=GS S2J866_MUCC1/228-307        AC S2J866.1
#=GS A0A1X7R2V9_9SACH/16-105     AC A0A1X7R2V9.1
#=GS A0A1L9NML1_ASPTU/21-107     AC A0A1L9NML1.1
#=GS W7FKR8_PLAF8/32-117         AC W7FKR8.1
#=GS A8NUM6_COPC7/300-393        AC A8NUM6.2
#=GS A0A2C6LB69_9APIC/75-163     AC A0A2C6LB69.1
#=GS A0A0D9VGL6_9ORYZ/17-112     AC A0A0D9VGL6.1
#=GS D2RF87_ARCPA/16-105         AC D2RF87.1
#=GS A0A1V6R8B9_9EURO/21-106     AC A0A1V6R8B9.1
#=GS L2FSJ0_COLGN/69-101         AC L2FSJ0.1
#=GS A0A0E0JF30_ORYPU/75-171     AC A0A0E0JF30.1
#=GS A0A1B8G3N9_9PEZI/17-108     AC A0A1B8G3N9.1
#=GS A0A0G2ECT6_9EURO/21-110     AC A0A0G2ECT6.1
#=GS A0A2D3USJ5_9PEZI/229-312    AC A0A2D3USJ5.1
#=GS A0A0B1P9P9_UNCNE/230-309    AC A0A0B1P9P9.1
#=GS A0A0R3PM18_ANGCS/143-222    AC A0A0R3PM18.1
#=GS S8FH24_FOMPI/17-111         AC S8FH24.1
#=GS A0A101IXS4_9EURY/16-102     AC A0A101IXS4.1
#=GS G3UKL4_LOXAF/1-89           AC G3UKL4.1
#=GS A0A0D0BC83_9HOMO/17-111     AC A0A0D0BC83.1
#=GS L9L0I8_TUPCH/87-156         AC L9L0I8.1
#=GS A0A1I7XW15_9BILA/22-112     AC A0A1I7XW15.1
#=GS A0A0G4LCF4_9PEZI/229-312    AC A0A0G4LCF4.1
#=GS W9QSW8_9ROSA/17-114         AC W9QSW8.1
#=GS A0A151NXA7_ALLMI/43-140     AC A0A151NXA7.1
#=GS Q6CEU7_YARLI/20-103         AC Q6CEU7.1
#=GS A0A0N4ZGK9_PARTI/231-312    AC A0A0N4ZGK9.1
#=GS A0A1V6ULT6_9EURO/229-311    AC A0A1V6ULT6.1
#=GS A0A1D2VQU0_9ASCO/22-110     AC A0A1D2VQU0.1
#=GS Q6CPR5_KLULA/17-108         AC Q6CPR5.1
#=GS RL10_PYRFU/233-338          AC Q8TZJ8.1
#=GS A0A2I3LJV3_PAPAN/13-96      AC A0A2I3LJV3.1
#=GS A0A251TCN0_HELAN/233-317    AC A0A251TCN0.1
#=GS K4C9G1_SOLLC/60-154         AC K4C9G1.1
#=GS W9X182_9EURO/17-113         AC W9X182.1
#=GS A9P8B5_POPTR/19-123         AC A9P8B5.1
#=GS A0A1B8DA65_9PEZI/21-108     AC A0A1B8DA65.1
#=GS A0A1S2Z6N6_CICAR/21-107     AC A0A1S2Z6N6.1
#=GS A0A0N5A9J1_9BILA/26-125     AC A0A0N5A9J1.1
#=GS A0A183NH97_9TREM/231-316    AC A0A183NH97.1
#=GS A0A0L9UMT8_PHAAN/21-111     AC A0A0L9UMT8.1
#=GS R1E4V9_9ARCH/18-100         AC R1E4V9.1
#=GS I1PW42_ORYGL/17-112         AC I1PW42.1
#=GS A0A094FY99_9PEZI/229-311    AC A0A094FY99.1
#=GS A2E256_TRIVA/17-103         AC A2E256.1
#=GS H0XV37_OTOGA/230-315        AC H0XV37.1
#=GS A0A2G3DFD8_CAPCH/17-111     AC A0A2G3DFD8.1
#=GS A5DVW4_LODEL/20-109         AC A5DVW4.1
#=GS A0A1P8B2C7_ARATH/4-90       AC A0A1P8B2C7.1
#=GS A0A1R2AZ84_9CILI/17-111     AC A0A1R2AZ84.1
#=GS A0A0D9QIQ1_PLAFR/32-118     AC A0A0D9QIQ1.1
#=GS B0WRG9_CULQU/47-131         AC B0WRG9.1
#=GS A0A226NVT6_COLVI/241-326    AC A0A226NVT6.1
#=GS A0A1J4JMG0_9EUKA/232-314    AC A0A1J4JMG0.1
#=GS A0A0C9M7A6_9FUNG/17-105     AC A0A0C9M7A6.1
#=GS A0A1A9UTG0_GLOAU/3-74       AC A0A1A9UTG0.1
#=GS A0A1E4SGD9_9ASCO/17-108     AC A0A1E4SGD9.1
#=GS A0A0H2S4J3_9HOMO/17-110     AC A0A0H2S4J3.1
#=GS A0A096P8Y9_OSTTA/20-103     AC A0A096P8Y9.1
#=GS A0A1L9WW95_ASPAC/21-107     AC A0A1L9WW95.1
#=GS A0A1I8CYJ6_9BILA/118-197    AC A0A1I8CYJ6.1
#=GS A0A0E0AJG8_9ORYZ/17-103     AC A0A0E0AJG8.1
#=GS F8VWS0_HUMAN/195-280        AC F8VWS0.1
#=GS A0A1Z5KM38_FISSO/17-104     AC A0A1Z5KM38.1
#=GS A0A197JV26_9FUNG/17-108     AC A0A197JV26.1
#=GS A0A0L0NLB5_9HYPO/229-311    AC A0A0L0NLB5.1
#=GS A0A1Z5SUK8_HORWE/17-110     AC A0A1Z5SUK8.1
#=GS A0A1S3EZM8_DIPOR/231-316    AC A0A1S3EZM8.1
#=GS C5DQR5_ZYGRC/17-107         AC C5DQR5.1
#=GS B4IAY7_DROSE/231-316        AC B4IAY7.1
#=GS A0A178ZUX0_9EURO/17-113     AC A0A178ZUX0.1
#=GS G1XBG0_ARTOA/17-110         AC G1XBG0.1
#=GS A0A093GFI5_DRYPU/22-113     AC A0A093GFI5.1
#=GS N1JL89_BLUG1/17-109         AC N1JL89.1
#=GS F7GL87_CALJA/22-105         AC F7GL87.1
#=GS A0A0D2PJ47_GOSRA/17-113     AC A0A0D2PJ47.1
#=GS M0M6Q8_HALMO/16-112         AC M0M6Q8.1
#=GS C5DTK9_ZYGRC/19-103         AC C5DTK9.1
#=GS H2C850_9CREN/16-103         AC H2C850.1
#=GS B8AYR2_ORYSI/92-187         AC B8AYR2.1
#=GS A0A162DFT0_9CRUS/17-113     AC A0A162DFT0.1
#=GS W6L3U8_9TRYP/18-111         AC W6L3U8.1
#=GS M0S1D5_MUSAM/22-111         AC M0S1D5.1
#=GS A0A2H1FI83_9ARCH/16-98      AC A0A2H1FI83.1
#=GS G1UBJ1_METIK/239-342        AC G1UBJ1.1
#=GS A0A1S2Z8L6_CICAR/21-108     AC A0A1S2Z8L6.1
#=GS M3W9K1_FELCA/17-105         AC M3W9K1.2
#=GS A0A024UJC7_9STRA/231-312    AC A0A024UJC7.1
#=GS A0A2G3BB75_CAPCH/17-111     AC A0A2G3BB75.1
#=GS A0A0G4ILF5_PLABS/17-108     AC A0A0G4ILF5.1
#=GS A0A1Z5SSV4_HORWE/259-337    AC A0A1Z5SSV4.1
#=GS A0A2I4DGW4_9ROSI/234-320    AC A0A2I4DGW4.1
#=GS A0A0A7LDJ0_9EURY/16-104     AC A0A0A7LDJ0.1
#=GS M2QPS8_CERS8/17-111         AC M2QPS8.1
#=GS A0A1Y3GGN5_9EURY/16-106     AC A0A1Y3GGN5.1
#=GS J9P6M3_CANLF/17-114         AC J9P6M3.1
#=GS C5DJC7_LACTC/17-109         AC C5DJC7.1
#=GS G0R6F8_ICHMG/32-121         AC G0R6F8.1
#=GS A8Q9T2_MALGO/17-111         AC A8Q9T2.1
#=GS A0A0B2V4S9_TOXCA/231-317    AC A0A0B2V4S9.1
#=GS A0A0F9XXS0_TRIHA/17-109     AC A0A0F9XXS0.1
#=GS A0A0N5BEW2_STREA/22-113     AC A0A0N5BEW2.1
#=GS A0A226EPN2_FOLCA/231-314    AC A0A226EPN2.1
#=GS V2XB59_MONRO/17-112         AC V2XB59.1
#=GS A0A060HQZ0_9ARCH/25-110     AC A0A060HQZ0.1
#=GS A0A0L1KLU9_9EUGL/239-320    AC A0A0L1KLU9.1
#=GS J9DQC1_EDHAE/16-101         AC J9DQC1.1
#=GS Q4Z1F1_PLABA/230-313        AC Q4Z1F1.1
#=GS D7LJ08_ARALL/17-97          AC D7LJ08.1
#=GS N1Q2T6_DOTSN/17-112         AC N1Q2T6.1
#=GS A0A1V6U041_9EURO/17-106     AC A0A1V6U041.1
#=GS A0A1R3KNQ4_9ROSI/263-354    AC A0A1R3KNQ4.1
#=GS A0A0C3BHN9_HEBCY/392-479    AC A0A0C3BHN9.1
#=GS A0A1E3HN70_9TREE/17-110     AC A0A1E3HN70.1
#=GS G4N024_MAGO7/21-108         AC G4N024.1
#=GS A0A078JQ43_BRANA/132-219    AC A0A078JQ43.1
#=GS A0A0F7TRC2_9EURO/17-108     AC A0A0F7TRC2.1
#=GS M5G067_DACPD/17-114         AC M5G067.1
#=GS A0A1J6HXL0_NICAT/17-115     AC A0A1J6HXL0.1
#=GS A0DBJ7_PARTE/34-121         AC A0DBJ7.1
#=GS A0A1B0CXC1_LUTLO/17-111     AC A0A1B0CXC1.1
#=GS A0A098VPF9_9MICR/17-107     AC A0A098VPF9.1
#=GS Q8PY50_METMA/16-103         AC Q8PY50.1
#=GS RLA3_YEAST/19-105           AC P10622.3
#=GS A0A1V6TFM1_9EURO/229-310    AC A0A1V6TFM1.1
#=GS A0A1J7HS47_LUPAN/21-110     AC A0A1J7HS47.1
#=GS Q6DJI6_XENLA/17-110         AC Q6DJI6.1
#=GS Q7R992_PLAYO/32-118         AC Q7R992.1
#=GS D8T6I7_SELML/21-110         AC D8T6I7.1
#=GS E1BCL5_BOVIN/22-113         AC E1BCL5.1
#=GS G5C6T4_HETGA/22-113         AC G5C6T4.1
#=GS A0A1U7VRD1_NICSY/234-321    AC A0A1U7VRD1.1
#=GS A0RWZ8_CENSY/16-97          AC A0RWZ8.1
#=GS A0A150V845_9PEZI/17-111     AC A0A150V845.1
#=GS U6GWB9_EIMAC/114-199        AC U6GWB9.1
#=GS M2P7L9_CERS8/229-312        AC M2P7L9.1
#=GS C1G9U4_PARBD/229-312        AC C1G9U4.1
#=GS A0A1I0MZ83_9EURY/16-114     AC A0A1I0MZ83.1
#=GS A0A1Y2AVT0_9TREE/20-109     AC A0A1Y2AVT0.1
#=GS A0A1U7TWB6_TARSY/359-447    AC A0A1U7TWB6.1
#=GS A0A1I8Q3B2_STOCA/17-112     AC A0A1I8Q3B2.1
#=GS M0MKC4_9EURY/16-115         AC M0MKC4.1
#=GS A4I5Z9_LEIIN/16-104         AC A4I5Z9.1
#=GS G1Q6L0_MYOLU/22-94          AC G1Q6L0.1
#=GS A4H884_LEIBR/18-111         AC A4H884.1
#=GS A0A0C4DMY0_MAGP6/229-312    AC A0A0C4DMY0.1
#=GS G0V8E7_NAUCC/17-110         AC G0V8E7.1
#=GS Q4XZW7_PLACH/19-110         AC Q4XZW7.1
#=GS A0A0L0HJ29_SPIPN/17-109     AC A0A0L0HJ29.1
#=GS N4TZ83_FUSC1/229-312        AC N4TZ83.1
#=GS W2GXL1_PHYPR/231-311        AC W2GXL1.1
#=GS A0A1A8YSH4_9APIC/19-110     AC A0A1A8YSH4.1
#=GS A0A0R3S4J9_9BILA/71-142     AC A0A0R3S4J9.1
#=GS A8J0R4_CHLRE/17-108         AC A8J0R4.1
#=GS G2QYJ8_THITE/17-111         AC G2QYJ8.1
#=GS A0A086SV71_ACRC1/17-109     AC A0A086SV71.1
#=GS A0A1U7TQH8_TARSY/22-113     AC A0A1U7TQH8.1
#=GS A0A2H9L1X7_9ARCH/16-95      AC A0A2H9L1X7.1
#=GS M2ULJ2_COCH5/229-313        AC M2ULJ2.1
#=GS V2Y0H6_MONRO/266-349        AC V2Y0H6.1
#=GS U6K4S7_9EIME/19-116         AC U6K4S7.1
#=GS A0A183DAA1_9BILA/1-56       AC A0A183DAA1.1
#=GS A0A167M5G2_PHYB8/228-309    AC A0A167M5G2.1
#=GS X0DB90_FUSOX/229-312        AC X0DB90.1
#=GS A0A256IDY7_9EURY/16-109     AC A0A256IDY7.1
#=GS A0A084G738_9PEZI/17-109     AC A0A084G738.1
#=GS T0KT72_COLGC/21-108         AC T0KT72.1
#=GS Q4Z0X6_PLABA/19-110         AC Q4Z0X6.1
#=GS A0A139AXR1_GONPR/271-362    AC A0A139AXR1.1
#=GS I1NL08_ORYGL/17-113         AC I1NL08.1
#=GS A0A1R3JFZ4_COCAP/36-118     AC A0A1R3JFZ4.1
#=GS F2U585_SALR5/20-117         AC F2U585.1
#=GS A0A2G3B4K3_CAPCH/87-160     AC A0A2G3B4K3.1
#=GS Q6CDT9_YARLI/19-106         AC Q6CDT9.1
#=GS A0A087GR80_ARAAL/17-114     AC A0A087GR80.1
#=GS A0A1J4JX05_9EUKA/232-314    AC A0A1J4JX05.1
#=GS A0A2C5YYM2_9HYPO/22-109     AC A0A2C5YYM2.1
#=GS A0A183C033_GLOPA/155-240    AC A0A183C033.1
#=GS B5DGW8_SALSA/17-113         AC B5DGW8.1
#=GS A0A2I4BBJ0_9TELE/231-314    AC A0A2I4BBJ0.1
#=GS Q7RRQ9_PLAYO/231-314        AC Q7RRQ9.1
#=GS H0GSD6_SACCK/20-105         AC H0GSD6.1
#=GS A0A1Q8R9V9_9PEZI/17-110     AC A0A1Q8R9V9.1
#=GS C9SMK1_VERA1/17-109         AC C9SMK1.1
#=GS A0A1E5VPT4_9POAL/210-295    AC A0A1E5VPT4.1
#=GS F7AM53_HORSE/8-88           AC F7AM53.1
#=GS A0A0L8GED2_OCTBM/231-319    AC A0A0L8GED2.1
#=GS A0A2I4GKU7_9ROSI/17-112     AC A0A2I4GKU7.1
#=GS H0GDR6_SACCK/20-105         AC H0GDR6.1
#=GS A0A1W9MNW6_9EURY/16-101     AC A0A1W9MNW6.1
#=GS A0A0E0E5Z4_9ORYZ/59-118     AC A0A0E0E5Z4.1
#=GS A0A0N0NL08_9EURO/21-82      AC A0A0N0NL08.1
#=GS A0A1J4JRU1_9EUKA/21-105     AC A0A1J4JRU1.1
#=GS A0A068XPD1_HYMMI/22-116     AC A0A068XPD1.2
#=GS A0A1I8ILV6_9PLAT/18-111     AC A0A1I8ILV6.1
#=GS A0A0E0DS56_9ORYZ/85-180     AC A0A0E0DS56.1
#=GS A0A152A266_9MYCE/27-119     AC A0A152A266.1
#=GS A0A2D3UXG0_9PEZI/17-109     AC A0A2D3UXG0.1
#=GS A0A1R2BXR4_9CILI/32-118     AC A0A1R2BXR4.1
#=GS A0A1Z5JYN3_FISSO/231-316    AC A0A1Z5JYN3.1
#=GS U5HD23_USTV1/20-106         AC U5HD23.1
#=GS G8Y5Z3_PICSO/17-105         AC G8Y5Z3.1
#=GS A0A1J7FMU4_LUPAN/29-117     AC A0A1J7FMU4.1
#=GS T0S967_9STRA/53-138         AC T0S967.1
#=GS G7XCX2_ASPKW/17-108         AC G7XCX2.1
#=GS A0A1R3H1F3_COCAP/22-113     AC A0A1R3H1F3.1
#=GS A0A1X7R0N4_9SACH/22-107     AC A0A1X7R0N4.1
#=GS Q4DLC3_TRYCC/16-106         AC Q4DLC3.1
#=GS A0A0R3QKX6_9BILA/113-208    AC A0A0R3QKX6.1
#=GS A0A1A5ZVJ1_9TREE/20-104     AC A0A1A5ZVJ1.1
#=GS G1MPP5_AILME/1-90           AC G1MPP5.1
#=GS A0A067L8U4_JATCU/234-320    AC A0A067L8U4.1
#=GS F6Z0Y9_CALJA/22-113         AC F6Z0Y9.1
#=GS U7PTK4_SPOS1/229-311        AC U7PTK4.1
#=GS H2LZD6_ORYLA/188-271        AC H2LZD6.1
#=GS R8BRQ1_TOGMI/229-311        AC R8BRQ1.1
#=GS A0A0E0JF31_ORYPU/17-113     AC A0A0E0JF31.1
#=GS A0A0D9UXS2_9ORYZ/17-113     AC A0A0D9UXS2.1
#=GS A0A096MPE9_PAPAN/191-278    AC A0A096MPE9.2
#=GS J9VJJ1_CRYNH/20-108         AC J9VJJ1.1
#=GS G9ND76_HYPVG/229-313        AC G9ND76.1
#=GS A0A2K1IJU3_PHYPA/21-107     AC A0A2K1IJU3.1
#=GS A0C509_PARTE/21-105         AC A0C509.1
#=GS E2BUM9_HARSA/17-114         AC E2BUM9.1
#=GS W4INA0_PLAFA/19-111         AC W4INA0.1
#=GS A0A1S4BJ93_TOBAC/17-111     AC A0A1S4BJ93.1
#=GS A0A1V8V4P4_9PEZI/229-312    AC A0A1V8V4P4.1
#=GS Q4E3A3_TRYCC/238-323        AC Q4E3A3.1
#=GS U4L904_PYROM/17-110         AC U4L904.1
#=GS A0A2I4DX25_9ROSI/17-115     AC A0A2I4DX25.1
#=GS M0H478_9EURY/16-110         AC M0H478.1
#=GS H3D0A0_TETNG/231-314        AC H3D0A0.1
#=GS V4KQ04_EUTSA/23-112         AC V4KQ04.1
#=GS A0A117NPJ8_9EURO/229-311    AC A0A117NPJ8.1
#=GS A0A0D3HR37_9ORYZ/841-926    AC A0A0D3HR37.1
#=GS A0A087XFL5_POEFO/17-114     AC A0A087XFL5.1
#=GS A0A0N9Z3I0_9ARCH/41-127     AC A0A0N9Z3I0.1
#=GS A0A1Y1UTV2_9TREE/20-112     AC A0A1Y1UTV2.1
#=GS A0A196SI88_BLAHN/17-108     AC A0A196SI88.1
#=GS A0A218WMV4_PUNGR/17-110     AC A0A218WMV4.1
#=GS D7TJ45_VITVI/17-113         AC D7TJ45.1
#=GS A0A1Y1Z5D5_9FUNG/17-107     AC A0A1Y1Z5D5.1
#=GS S9VUQ9_SCHCR/17-108         AC S9VUQ9.1
#=GS U6M027_EIMMA/32-123         AC U6M027.1
#=GS R4XBQ8_TAPDE/229-312        AC R4XBQ8.1
#=GS V5G7B6_BYSSN/21-107         AC V5G7B6.1
#=GS A0A1I8BXG9_MELHA/17-113     AC A0A1I8BXG9.1
#=GS A0A225VL95_9STRA/17-107     AC A0A225VL95.1
#=GS A0A2I4GXN8_9ROSI/17-115     AC A0A2I4GXN8.1
#=GS A0A1I8I1D2_9PLAT/231-314    AC A0A1I8I1D2.1
#=GS W7A2C2_9APIC/32-118         AC W7A2C2.1
#=GS A0A1C1X9P8_9PEZI/21-103     AC A0A1C1X9P8.1
#=GS A4S8E4_OSTLU/20-103         AC A4S8E4.1
#=GS V9EVD5_PHYPR/17-105         AC V9EVD5.1
#=GS A0A1Y1Z0X1_9PLEO/21-111     AC A0A1Y1Z0X1.1
#=GS A0A256YS35_9ARCH/18-104     AC A0A256YS35.1
#=GS G4UAY1_NEUT9/17-109         AC G4UAY1.1
#=GS D3BDB6_POLPP/22-110         AC D3BDB6.1
#=GS A0A151IQ35_9HYME/17-113     AC A0A151IQ35.1
#=GS A0A1E1LDV2_9HELO/21-110     AC A0A1E1LDV2.1
#=GS A0A0E0IXY5_ORYNI/749-833    AC A0A0E0IXY5.1
#=GS F1MH76_BOVIN/32-129         AC F1MH76.2
#=GS F8AI14_PYRYC/16-107         AC F8AI14.1
#=GS A0A1S2XND4_CICAR/234-320    AC A0A1S2XND4.1
#=GS A0A1U8AJ68_NELNU/21-109     AC A0A1U8AJ68.1
#=GS A0A196SCN4_BLAHN/27-112     AC A0A196SCN4.1
#=GS A0A0V1AEA5_9BILA/22-118     AC A0A0V1AEA5.1
#=GS L0B229_THEEQ/32-114         AC L0B229.1
#=GS A0A081CL76_PSEA2/230-312    AC A0A081CL76.1
#=GS V9FK70_PHYPR/17-107         AC V9FK70.1
#=GS A0A2G9HT09_9LAMI/234-320    AC A0A2G9HT09.1
#=GS A0A1E3I367_9TREE/20-107     AC A0A1E3I367.1
#=GS A2YQN3_ORYSI/21-109         AC A2YQN3.1
#=GS A0A177UL10_9BASI/21-108     AC A0A177UL10.1
#=GS A0A0G2E143_9EURO/229-313    AC A0A0G2E143.1
#=GS A0A225AMX8_9EURO/17-110     AC A0A225AMX8.1
#=GS A0A023B145_GRENI/22-108     AC A0A023B145.1
#=GS A0A0R3SKJ7_HYMDI/22-116     AC A0A0R3SKJ7.1
#=GS F6U184_CALJA/17-114         AC F6U184.1
#=GS A0A0E0F293_9ORYZ/289-374    AC A0A0E0F293.1
#=GS A0A0L7LDY8_9NEOP/231-315    AC A0A0L7LDY8.1
#=GS A0A1L0C390_9ASCO/22-112     AC A0A1L0C390.1
#=GS A0A0Y9WLP9_PLABE/231-314    AC A0A0Y9WLP9.1
#=GS Q8IIX0_PLAF7/32-117         AC Q8IIX0.1
#=GS A0A1R3JRZ8_COCAP/17-90      AC A0A1R3JRZ8.1
#=GS I4Y734_WALMC/229-311        AC I4Y734.1
#=GS A0A0A0AS24_CHAVO/17-92      AC A0A0A0AS24.1
#=GS A0A183QTZ7_9TREM/17-113     AC A0A183QTZ7.1
#=GS A0A1I7XQ74_HETBA/17-86      AC A0A1I7XQ74.1
#=GS A0A067MUE5_9HOMO/229-310    AC A0A067MUE5.1
#=GS A0A2I3G4D8_NOMLE/22-113     AC A0A2I3G4D8.1
#=GS T1FSI2_HELRO/70-158         AC T1FSI2.1
#=GS B4FWI0_MAIZE/234-317        AC B4FWI0.1
#=GS A0A0A1U0R6_ENTIV/16-107     AC A0A0A1U0R6.1
#=GS A0A256XUC6_9CREN/16-104     AC A0A256XUC6.1
#=GS A0A137PHB4_CONC2/22-107     AC A0A137PHB4.1
#=GS G3GZV3_CRIGR/17-104         AC G3GZV3.1
#=GS A0A1B9IQN4_9TREE/229-312    AC A0A1B9IQN4.1
#=GS A0A0D2C1Z2_9EURO/229-313    AC A0A0D2C1Z2.1
#=GS F4B473_ACIHW/16-104         AC F4B473.1
#=GS W2KQU3_PHYPR/29-111         AC W2KQU3.1
#=GS A0A0D3AEY7_BRAOL/233-320    AC A0A0D3AEY7.1
#=GS J3KXZ7_ORYBR/53-119         AC J3KXZ7.1
#=GS A0A1L7WCX0_9HELO/229-313    AC A0A1L7WCX0.1
#=GS J3MHB1_ORYBR/13-118         AC J3MHB1.1
#=GS A0A0L9TFC9_PHAAN/21-111     AC A0A0L9TFC9.1
#=GS A0A061DE94_BABBI/1-50       AC A0A061DE94.1
#=GS A2FVM1_TRIVA/233-315        AC A2FVM1.1
#=GS A0A194S3Y8_RHOGW/17-108     AC A0A194S3Y8.1
#=GS W0T8C6_KLUMD/20-106         AC W0T8C6.1
#=GS A0A166DWS0_9HOMO/17-111     AC A0A166DWS0.1
#=GS S7MT67_MYOBR/46-137         AC S7MT67.1
#=GS E9F097_METRA/229-312        AC E9F097.1
#=GS A0A1D2RG82_9EURY/16-98      AC A0A1D2RG82.1
#=GS L5M5Z6_MYODS/22-113         AC L5M5Z6.1
#=GS A0CMI6_PARTE/34-121         AC A0CMI6.1
#=GS B2W137_PYRTR/21-111         AC B2W137.1
#=GS A0A2H0ZNE1_CANAR/17-110     AC A0A2H0ZNE1.1
#=GS M4AV29_XIPMA/17-115         AC M4AV29.1
#=GS A0A2A4J9D4_HELVI/231-314    AC A0A2A4J9D4.1
#=GS A0A168N9Z6_MUCCL/17-105     AC A0A168N9Z6.1
#=GS A0A0B2R6U0_GLYSO/17-110     AC A0A0B2R6U0.1
#=GS A0A1E4RQH5_9ASCO/20-107     AC A0A1E4RQH5.1
#=GS A0A179V3C1_BLAGS/229-311    AC A0A179V3C1.1
#=GS A0A1W0E439_9MICR/45-128     AC A0A1W0E439.1
#=GS A0A0L0SP47_ALLMA/22-108     AC A0A0L0SP47.1
#=GS E7NKY9_YEASO/229-311        AC E7NKY9.1
#=GS S7Q4E7_GLOTA/229-311        AC S7Q4E7.1
#=GS A0A0V1AEJ0_9BILA/22-112     AC A0A0V1AEJ0.1
#=GS B3H4N7_ARATH/25-118         AC B3H4N7.1
#=GS A0A0C3F7P0_9HOMO/21-110     AC A0A0C3F7P0.1
#=GS A0A1E5RMB6_9ASCO/20-105     AC A0A1E5RMB6.1
#=GS A3LX37_PICST/20-107         AC A3LX37.1
#=GS D5VSW5_METIM/16-102         AC D5VSW5.1
#=GS A0A022RIN3_ERYGU/16-121     AC A0A022RIN3.1
#=GS M0SDS5_MUSAM/22-112         AC M0SDS5.1
#=GS A0A100I3T1_ASPNG/229-311    AC A0A100I3T1.1
#=GS A0A133UM47_9EURY/1-73       AC A0A133UM47.1
#=GS A0A2H3BGV2_9AGAR/21-109     AC A0A2H3BGV2.1
#=GS A0A0D9MTF5_ASPFA/17-108     AC A0A0D9MTF5.1
#=GS A0A1S2YDT8_CICAR/21-111     AC A0A1S2YDT8.1
#=GS A0A146F798_9EURO/21-107     AC A0A146F798.1
#=GS A0A1E3PMU6_9ASCO/17-61      AC A0A1E3PMU6.1
#=GS S7W8T3_SPRLO/16-102         AC S7W8T3.1
#=GS A0A1U8K031_GOSHI/22-113     AC A0A1U8K031.1
#=GS S7NST8_MYOBR/31-118         AC S7NST8.1
#=GS A0A0C9YM38_9AGAR/17-111     AC A0A0C9YM38.1
#=GS A0A238F6L2_9BASI/17-110     AC A0A238F6L2.1
#=GS Q8II61_PLAF7/231-315        AC Q8II61.1
#=GS RLA3_MAIZE/61-119           AC O24413.3
#=GS A0A1E5RPD8_HANUV/16-104     AC A0A1E5RPD8.1
#=GS A0A0Q4BHZ0_9EURY/16-101     AC A0A0Q4BHZ0.1
#=GS A0A074YMA1_AURPU/21-107     AC A0A074YMA1.1
#=GS A0A1I6KSV4_9EURY/16-113     AC A0A1I6KSV4.1
#=GS G7JC94_MEDTR/234-320        AC G7JC94.1
#=GS A0A0N5DW44_TRIMR/227-309    AC A0A0N5DW44.1
#=GS A0A078I6E4_BRANA/233-320    AC A0A078I6E4.1
#=GS A0A0E0PN70_ORYRU/17-112     AC A0A0E0PN70.1
#=GS A0A261CDM3_9PELO/231-311    AC A0A261CDM3.1
#=GS A0A2G2VQP1_CAPBA/17-111     AC A0A2G2VQP1.1
#=GS A0A133UQP3_9EURY/16-56      AC A0A133UQP3.1
#=GS G8YUR0_PICSO/20-105         AC G8YUR0.1
#=GS A0A1D2M8R4_ORCCI/23-116     AC A0A1D2M8R4.1
#=GS A0A1V9XA52_9ACAR/22-109     AC A0A1V9XA52.1
#=GS A0A0C3JF45_PISTI/17-111     AC A0A0C3JF45.1
#=GS A0A1V8SYB1_9PEZI/17-112     AC A0A1V8SYB1.1
#=GS S7PBN4_MYOBR/33-122         AC S7PBN4.1
#=GS A0A0G2H8J9_9EURO/17-109     AC A0A0G2H8J9.1
#=GS A0A0R3X8C1_HYDTA/80-120     AC A0A0R3X8C1.1
#=GS RLA1_MOUSE/22-113           AC P47955.1
#=GS A0A256Z7W2_9CREN/16-109     AC A0A256Z7W2.1
#=GS A0A094F6H5_9PEZI/229-309    AC A0A094F6H5.1
#=GS A0A166NB92_EXIGL/17-111     AC A0A166NB92.1
#=GS I1QAM5_ORYGL/17-106         AC I1QAM5.1
#=GS A0A1Y1X8M2_9FUNG/21-106     AC A0A1Y1X8M2.1
#=GS A0A074SSC8_9HOMO/17-113     AC A0A074SSC8.1
#=GS Q4D4B9_TRYCC/26-114         AC Q4D4B9.1
#=GS A0A1B8ELM9_9PEZI/229-311    AC A0A1B8ELM9.1
#=GS M4EA18_BRARP/15-83          AC M4EA18.1
#=GS A0A2I3SYL8_PANTR/231-316    AC A0A2I3SYL8.1
#=GS L5M6N6_MYODS/28-119         AC L5M6N6.1
#=GS A0A182K8J7_9DIPT/231-314    AC A0A182K8J7.1
#=GS A0A133V725_9EURY/16-100     AC A0A133V725.1
#=GS F2SUF2_TRIRC/55-136         AC F2SUF2.2
#=GS A0A0N5DYS2_TRIMR/317-405    AC A0A0N5DYS2.1
#=GS A0A1F5DF17_9ARCH/16-100     AC A0A1F5DF17.1
#=GS S7N152_MYOBR/231-316        AC S7N152.1
#=GS I1CVJ5_RHIO9/228-308        AC I1CVJ5.1
#=GS E2BW93_HARSA/231-315        AC E2BW93.1
#=GS A0A1L9X5F1_ASPAC/17-108     AC A0A1L9X5F1.1
#=GS D4A4D5_RAT/17-114           AC D4A4D5.1
#=GS A0A0K0ERM7_STRER/192-273    AC A0A0K0ERM7.1
#=GS A0A1I7X7T8_HETBA/17-109     AC A0A1I7X7T8.1
#=GS A8PH06_COPC7/948-1036       AC A8PH06.2
#=GS Q754C5_ASHGO/17-107         AC Q754C5.1
#=GS M1ABN6_SOLTU/17-115         AC M1ABN6.1
#=GS I2K134_DEKBR/19-107         AC I2K134.1
#=GS C5A429_THEGJ/16-105         AC C5A429.1
#=GS A0A010RW72_9PEZI/21-108     AC A0A010RW72.1
#=GS W0T703_KLUMD/16-106         AC W0T703.1
#=GS A0A0V0SKA9_9BILA/22-112     AC A0A0V0SKA9.1
#=GS M3XMA1_MUSPF/22-113         AC M3XMA1.1
#=GS T0LYU1_9EURY/10-100         AC T0LYU1.1
#=GS A0A146FPX4_9EURO/229-311    AC A0A146FPX4.1
#=GS Q6PBJ9_DANRE/17-114         AC Q6PBJ9.1
#=GS A0A0W4ZS34_PNEJ7/20-104     AC A0A0W4ZS34.1
#=GS A0A1S3LAA3_SALSA/192-275    AC A0A1S3LAA3.1
#=GS S9VZJ3_SCHCR/229-308        AC S9VZJ3.1
#=GS A0A1S3GCH2_DIPOR/231-316    AC A0A1S3GCH2.1
#=GS A0A1U8PLU2_GOSHI/234-319    AC A0A1U8PLU2.1
#=GS A0A044SL55_ONCVO/231-319    AC A0A044SL55.1
#=GS G8BW19_TETPH/20-106         AC G8BW19.1
#=GS A0A0B4GUI5_9HYPO/229-312    AC A0A0B4GUI5.1
#=GS A0A1D2M106_ORCCI/23-97      AC A0A1D2M106.1
#=GS V7BXT2_PHAVU/21-100         AC V7BXT2.1
#=GS A0A0D1EBT5_USTMA/21-108     AC A0A0D1EBT5.1
#=GS A0A1U8M2Z4_GOSHI/17-113     AC A0A1U8M2Z4.1
#=GS K5W2Y3_PHACS/229-311        AC K5W2Y3.1
#=GS J7RTY6_KAZNA/20-106         AC J7RTY6.1
#=GS T0MSU0_9EURY/16-100         AC T0MSU0.1
#=GS J9P5Q4_CANLF/181-266        AC J9P5Q4.1
#=GS F4IGR3_ARATH/17-97          AC F4IGR3.1
#=GS A0A165TLM8_9APHY/229-313    AC A0A165TLM8.1
#=GS A0A1S3YXL9_TOBAC/234-318    AC A0A1S3YXL9.1
#=GS G3S7X2_GORGO/22-113         AC G3S7X2.2
#=GS A0A2I3LPW8_PAPAN/169-254    AC A0A2I3LPW8.1
#=GS G8ZTC2_TORDC/229-311        AC G8ZTC2.1
#=GS A0A1E5RRC8_HANUV/20-105     AC A0A1E5RRC8.1
#=GS G1NVF5_MYOLU/24-113         AC G1NVF5.1
#=GS RLA2_ENCCU/16-103           AC Q8SRM2.1
#=GS M5WI07_PRUPE/16-118         AC M5WI07.1
#=GS A0A1U8JT39_GOSHI/17-112     AC A0A1U8JT39.1
#=GS J9VNN9_CRYNH/17-110         AC J9VNN9.1
#=GS K7MPL5_SOYBN/171-237        AC K7MPL5.1
#=GS V4LZ75_EUTSA/233-320        AC V4LZ75.1
#=GS A0A1E4T230_9ASCO/20-106     AC A0A1E4T230.1
#=GS E7QIC0_YEASZ/229-311        AC E7QIC0.1
#=GS A0A0E0L354_ORYPU/17-114     AC A0A0E0L354.1
#=GS A0A163J8I6_ABSGL/17-109     AC A0A163J8I6.1
#=GS A0A0C2N9U2_THEKT/26-113     AC A0A0C2N9U2.1
#=GS G0NH49_CAEBE/17-107         AC G0NH49.1
#=GS Q8ZWM8_PYRAE/16-110         AC Q8ZWM8.1
#=GS D8T6P9_SELML/20-109         AC D8T6P9.1
#=GS C4IYY6_MAIZE/17-111         AC C4IYY6.1
#=GS A0A1C8ZS83_9CREN/16-105     AC A0A1C8ZS83.1
#=GS A0A068RJR1_9FUNG/20-106     AC A0A068RJR1.1
#=GS A0A2H2I833_CAEJA/22-110     AC A0A2H2I833.1
#=GS RLA1_YEAST/20-105           AC P05318.4
#=GS W4J152_PLAFP/32-117         AC W4J152.1
#=GS Q754A9_ASHGO/19-104         AC Q754A9.1
#=GS C3ZD79_BRAFL/22-108         AC C3ZD79.1
#=GS L5M929_MYODS/22-113         AC L5M929.1
#=GS A0A0D3BUD3_BRAOL/17-113     AC A0A0D3BUD3.1
#=GS A0A1F6QVG1_9ARCH/16-97      AC A0A1F6QVG1.1
#=GS B2B826_PODAN/21-109         AC B2B826.1
#=GS F6GUT3_VITVI/220-303        AC F6GUT3.1
#=GS A0A0G4MN03_9PEZI/22-114     AC A0A0G4MN03.1
#=GS Q6P699_XENLA/22-112         AC Q6P699.1
#=GS H2MY82_ORYLA/22-104         AC H2MY82.1
#=GS RLA23_ARATH/17-114          AC Q9LH85.1
#=GS A0A2H3YEY2_PHODC/17-109     AC A0A2H3YEY2.1
#=GS L2GSK8_VAVCU/16-100         AC L2GSK8.1
#=GS A0A0B2WQL5_9HYPO/229-311    AC A0A0B2WQL5.1
#=GS I1CK49_RHIO9/20-105         AC I1CK49.1
#=GS K0KKH2_WICCF/17-108         AC K0KKH2.1
#=GS A0A067E8D7_CITSI/8-79       AC A0A067E8D7.1
#=GS A0A2I0QM29_9EURY/16-104     AC A0A2I0QM29.1
#=GS A0A162AYP0_DAUCA/21-109     AC A0A162AYP0.1
#=GS K0B577_9ARCH/16-101         AC K0B577.1
#=GS Q4CPY1_TRYCC/26-114         AC Q4CPY1.1
#=GS A0A109FIC0_9BASI/21-107     AC A0A109FIC0.1
#=GS A0A1X0P2R9_9TRYP/16-104     AC A0A1X0P2R9.1
#=GS T0LF15_9EURY/16-102         AC T0LF15.1
#=GS E9II14_SOLIN/231-317        AC E9II14.1
#=GS A0A1S3C0X1_CUCME/21-107     AC A0A1S3C0X1.1
#=GS J9P0A3_CANLF/22-113         AC J9P0A3.1
#=GS G8BV04_TETPH/229-313        AC G8BV04.1
#=GS M0RED7_MUSAM/164-247        AC M0RED7.1
#=GS B6JXU8_SCHJY/21-107         AC B6JXU8.1
#=GS Q28IA8_XENTR/22-112         AC Q28IA8.1
#=GS A0A1M5SGQ3_9EURY/16-115     AC A0A1M5SGQ3.1
#=GS A0A023EQJ9_AEDAL/231-314    AC A0A023EQJ9.1
#=GS W9Y0B7_9EURO/21-111         AC W9Y0B7.1
#=GS F0Y4H4_AURAN/17-106         AC F0Y4H4.1
#=GS A0A1Y2BTF4_9FUNG/23-109     AC A0A1Y2BTF4.1
#=GS E3K826_PUCGT/229-311        AC E3K826.2
#=GS A0BSK2_PARTE/34-121         AC A0BSK2.1
#=GS I1P0Y0_ORYGL/17-112         AC I1P0Y0.1
#=GS A0A1X0NVF0_9TRYP/18-110     AC A0A1X0NVF0.1
#=GS G8YLE4_PICSO/17-107         AC G8YLE4.1
#=GS A0A0F4Z5T7_TALEM/17-109     AC A0A0F4Z5T7.1
#=GS A0A066XKX5_COLSU/17-109     AC A0A066XKX5.1
#=GS A0A1D8PTS0_CANAL/17-107     AC A0A1D8PTS0.1
#=GS A0A0K9PHD8_ZOSMR/1-59       AC A0A0K9PHD8.1
#=GS A0A287DVN5_HORVV/17-65      AC A0A287DVN5.1
#=GS A0A1D2VMW4_9ASCO/17-111     AC A0A1D2VMW4.1
#=GS A0A0D2TAV8_GOSRA/17-119     AC A0A0D2TAV8.1
#=GS A0A1E4TEH8_9ASCO/229-312    AC A0A1E4TEH8.1
#=GS A0A194V1X1_9PEZI/17-109     AC A0A194V1X1.1
#=GS A0A1E3PJJ4_9ASCO/19-105     AC A0A1E3PJJ4.1
#=GS A5DLA6_PICGU/20-104         AC A5DLA6.1
#=GS G8BZ00_TETPH/17-109         AC G8BZ00.1
#=GS V4T6T5_9ROSI/234-318        AC V4T6T5.1
#=GS A0A0V0VGT8_9BILA/22-112     AC A0A0V0VGT8.1
#=GS A0A1U8LK33_GOSHI/17-113     AC A0A1U8LK33.1
#=GS A0A1S2Z4H3_CICAR/21-107     AC A0A1S2Z4H3.1
#=GS A0A2I0NQ81_9EURY/16-103     AC A0A2I0NQ81.1
#=GS D8R8E7_SELML/234-319        AC D8R8E7.1
#=GS A0A067LNR8_JATCU/234-318    AC A0A067LNR8.1
#=GS H6BU64_EXODN/21-112         AC H6BU64.1
#=GS A0A091HAZ8_BUCRH/17-114     AC A0A091HAZ8.1
#=GS F0XY67_AURAN/34-111         AC F0XY67.1
#=GS A0A1U7RP91_ALLSI/22-112     AC A0A1U7RP91.1
#=GS Q4UE75_THEAN/19-109         AC Q4UE75.1
#=GS A0A218VSM0_PUNGR/21-70      AC A0A218VSM0.1
#=GS A0A0N4T4L2_BRUPA/244-324    AC A0A0N4T4L2.1
#=GS A0A133UTM5_9EURY/16-56      AC A0A133UTM5.1
#=GS M9PBK5_DROME/22-111         AC M9PBK5.1
#=GS A0A0N1P224_9EURO/229-314    AC A0A0N1P224.1
#=GS A0A0K9PVD0_ZOSMR/17-109     AC A0A0K9PVD0.1
#=GS F7AW35_MACMU/22-113         AC F7AW35.2
#=GS B6SIT5_MAIZE/17-112         AC B6SIT5.1
#=GS A0A2K5KWH4_CERAT/22-110     AC A0A2K5KWH4.1
#=GS A0A0P7BL39_9HYPO/17-109     AC A0A0P7BL39.1
#=GS A0A2H9LDN6_9ARCH/16-98      AC A0A2H9LDN6.1
#=GS A0A0S4JKG7_BODSA/23-108     AC A0A0S4JKG7.1
#=GS A0A0D2AN11_9PEZI/17-112     AC A0A0D2AN11.1
#=GS A0A1B9I520_9TREE/229-311    AC A0A1B9I520.1
#=GS A0A094AX03_9PEZI/44-121     AC A0A094AX03.1
#=GS M1V6L3_CYAM1/230-322        AC M1V6L3.1
#=GS A0A2I4BAI9_9TELE/22-113     AC A0A2I4BAI9.1
#=GS A0A1U7YQR0_NICSY/86-173     AC A0A1U7YQR0.1
#=GS A0A1U8BF93_NELNU/17-113     AC A0A1U8BF93.1
#=GS A0A1U7Z297_NELNU/17-115     AC A0A1U7Z297.1
#=GS A0A1W4UQ67_DROFC/22-111     AC A0A1W4UQ67.1
#=GS F7E879_CALJA/230-310        AC F7E879.1
#=GS A0A0U5FW20_9EURO/17-108     AC A0A0U5FW20.1
#=GS A0A1E4TVQ4_PACTA/16-109     AC A0A1E4TVQ4.1
#=GS A0A2H3JZ74_WOLCO/17-111     AC A0A2H3JZ74.1
#=GS R0KLL1_NOSB1/25-106         AC R0KLL1.1
#=GS A0A067REX0_ZOONE/17-116     AC A0A067REX0.1
#=GS A0A0F8BWR6_CERFI/17-107     AC A0A0F8BWR6.1
#=GS D2VHP6_NAEGR/17-106         AC D2VHP6.1
#=GS A0A1D2VPN0_9ASCO/229-310    AC A0A1D2VPN0.1
#=GS Q7SGE3_NEUCR/17-109         AC Q7SGE3.1
#=GS S3CZH8_OPHP1/229-310        AC S3CZH8.1
#=GS V5BL26_TRYCR/241-326        AC V5BL26.1
#=GS A0A0M3JSL1_ANISI/29-120     AC A0A0M3JSL1.1
#=GS A0A0E0R3U7_ORYRU/610-695    AC A0A0E0R3U7.1
#=GS G2Q3A8_MYCTT/17-111         AC G2Q3A8.1
#=GS A0A2I4HSP5_9ROSI/21-109     AC A0A2I4HSP5.1
#=GS A0A2G3D260_CAPCH/22-113     AC A0A2G3D260.1
#=GS A0A1D6BND8_WHEAT/35-109     AC A0A1D6BND8.1
#=GS A0A2H3GYS0_FUSOX/17-79      AC A0A2H3GYS0.1
#=GS A0A1S4AZ85_TOBAC/21-110     AC A0A1S4AZ85.1
#=GS A0A2G1WN97_9EURY/16-113     AC A0A2G1WN97.1
#=GS Q6BSI9_DEBHA/20-105         AC Q6BSI9.1
#=GS A0A077Z107_TRITR/35-123     AC A0A077Z107.1
#=GS G3WPE0_SARHA/1-92           AC G3WPE0.1
#=GS T0K4W9_COLGC/229-310        AC T0K4W9.1
#=GS K4CA45_SOLLC/234-317        AC K4CA45.1
#=GS Q586I4_TRYB2/16-106         AC Q586I4.1
#=GS A0A167NQL5_PHYB8/17-106     AC A0A167NQL5.1
#=GS A0A1U7K826_9APHY/21-109     AC A0A1U7K826.1
#=GS A0A1X0P9L8_9TRYP/26-115     AC A0A1X0P9L8.1
#=GS E3LVY9_CAERE/231-311        AC E3LVY9.1
#=GS M4FD84_BRARP/17-112         AC M4FD84.1
#=GS A0A087H8R3_ARAAL/233-321    AC A0A087H8R3.1
#=GS G3YEG4_ASPNA/21-107         AC G3YEG4.1
#=GS W2QGN3_PHYPN/17-107         AC W2QGN3.1
#=GS A0A0V1LS45_9BILA/22-112     AC A0A0V1LS45.1
#=GS I1KB09_SOYBN/21-94          AC I1KB09.1
#=GS M4B6X6_HYAAE/29-112         AC M4B6X6.1
#=GS A0A0R3W4L0_TAEAS/22-118     AC A0A0R3W4L0.1
#=GS A0A0U5GFZ4_9EURO/17-113     AC A0A0U5GFZ4.1
#=GS A0A160VQR0_9EURY/233-340    AC A0A160VQR0.1
#=GS F0VPW1_NEOCL/232-310        AC F0VPW1.1
#=GS A0A178EKG0_9PLEO/17-110     AC A0A178EKG0.1
#=GS A0A1G4J1X5_9SACH/229-309    AC A0A1G4J1X5.1
#=GS M3IJZ2_CANMX/20-105         AC M3IJZ2.1
#=GS E7KS17_YEASL/229-311        AC E7KS17.1
#=GS RLA1_RAT/22-113             AC P19944.1
#=GS Q38BQ9_TRYB2/26-113         AC Q38BQ9.1
#=GS D0MXQ7_PHYIT/29-111         AC D0MXQ7.1
#=GS A0A1Y1ZWG9_9PLEO/229-314    AC A0A1Y1ZWG9.1
#=GS A0A0E0MJB9_ORYPU/614-697    AC A0A0E0MJB9.1
#=GS A0A1I8CZZ8_9BILA/231-310    AC A0A1I8CZZ8.1
#=GS I1Q4Z4_ORYGL/61-118         AC I1Q4Z4.1
#=GS A0A1Y1XQ87_9FUNG/228-310    AC A0A1Y1XQ87.1
#=GS W2PYA7_PHYPN/29-111         AC W2PYA7.1
#=GS G3TUC7_LOXAF/231-299        AC G3TUC7.1
#=GS A0A1Z9NE72_9EURY/16-101     AC A0A1Z9NE72.1
#=GS U1HYS7_ENDPU/21-112         AC U1HYS7.1
#=GS W7HS07_9PEZI/17-111         AC W7HS07.1
#=GS G3P132_GASAC/231-315        AC G3P132.1
#=GS A0A1B8DEF1_9PEZI/229-311    AC A0A1B8DEF1.1
#=GS A0A199UTC7_ANACO/64-122     AC A0A199UTC7.1
#=GS A0A0C3DCU0_9HOMO/21-132     AC A0A0C3DCU0.1
#=GS K1X998_MARBU/229-312        AC K1X998.1
#=GS B6K1E5_SCHJY/17-110         AC B6K1E5.1
#=GS A0A0N5E261_TRIMR/17-111     AC A0A0N5E261.1
#=GS Q6H764_ORYSJ/17-112         AC Q6H764.1
#=GS A0A183QWQ0_9TREM/21-115     AC A0A183QWQ0.1
#=GS A0A0D3GQT8_9ORYZ/17-107     AC A0A0D3GQT8.1
#=GS D3TQL8_GLOMM/231-310        AC D3TQL8.1
#=GS A0A168KLH5_MUCCL/18-77      AC A0A168KLH5.1
#=GS A0A1S3EUC2_DIPOR/22-113     AC A0A1S3EUC2.1
#=GS A0A1W6K1Y5_9CREN/16-103     AC A0A1W6K1Y5.1
#=GS A0A2I2Y879_GORGO/17-104     AC A0A2I2Y879.1
#=GS A0A1Q8RVR3_9PEZI/229-311    AC A0A1Q8RVR3.1
#=GS M5GG71_DACPD/229-314        AC M5GG71.1
#=GS A0A0D2DFZ1_9EURO/231-315    AC A0A0D2DFZ1.1
#=GS A0A0H5C2Z7_CYBJA/48-138     AC A0A0H5C2Z7.1
#=GS A0A1V6Y3Z3_PENNA/21-106     AC A0A1V6Y3Z3.1
#=GS A0A0A1NI62_9FUNG/17-107     AC A0A0A1NI62.1
#=GS A0A1W3JEY8_CIOIN/231-310    AC A0A1W3JEY8.1
#=GS A0A2K5KIF9_CERAT/16-91      AC A0A2K5KIF9.1
#=GS A0A151VSD3_HYPMA/21-108     AC A0A151VSD3.1
#=GS A0A165QIZ8_EXIGL/229-312    AC A0A165QIZ8.1
#=GS A0A2H3WXP7_PHODC/21-112     AC A0A2H3WXP7.1
#=GS A0A1A9ZBX7_GLOPL/231-310    AC A0A1A9ZBX7.1
#=GS A9PF35_POPTR/234-319        AC A9PF35.1
#=GS A0A0L7KA06_PLAFX/231-315    AC A0A0L7KA06.1
#=GS Q6M0L2_METMP/16-98          AC Q6M0L2.1
#=GS D6GVC7_PARA5/16-97          AC D6GVC7.1
#=GS A0A0E0QDL9_ORYRU/21-109     AC A0A0E0QDL9.1
#=GS A0A167PNH9_9HYPO/21-107     AC A0A167PNH9.1
#=GS A2R7V9_ASPNC/17-109         AC A2R7V9.1
#=GS A0A261BGB9_9PELO/17-110     AC A0A261BGB9.1
#=GS D0P2Q4_PHYIT/17-105         AC D0P2Q4.1
#=GS A0A0D9XP25_9ORYZ/234-319    AC A0A0D9XP25.1
#=GS A0A0C9VZ89_9HOMO/45-132     AC A0A0C9VZ89.1
#=GS A0A2I4F8C8_9ROSI/17-111     AC A0A2I4F8C8.1
#=GS B4FNM4_MAIZE/234-317        AC B4FNM4.1
#=GS I0A2Q6_FERFK/8-98           AC I0A2Q6.1
#=GS A0A1S4BZ62_TOBAC/197-274    AC A0A1S4BZ62.1
#=GS A0A0S7E5T9_9EURO/21-109     AC A0A0S7E5T9.1
#=GS J0S2F1_9EURY/16-101         AC J0S2F1.1
#=GS G3TSS3_LOXAF/22-111         AC G3TSS3.1
#=GS A0A0G2EVD1_9PEZI/17-108     AC A0A0G2EVD1.1
#=GS E1Z395_CHLVA/9-91           AC E1Z395.1
#=GS W5KAP6_ASTMX/22-113         AC W5KAP6.1
#=GS M0F7S9_9EURY/16-113         AC M0F7S9.1
#=GS A0A1Y2BBF8_9TREE/229-313    AC A0A1Y2BBF8.1
#=GS F2UBA3_SALR5/17-109         AC F2UBA3.1
#=GS Q6CW89_KLULA/229-310        AC Q6CW89.1
#=GS B0WL94_CULQU/45-116         AC B0WL94.1
#=GS A0A1Y2F242_9FUNG/16-102     AC A0A1Y2F242.1
#=GS A0A0K0G0T9_9BILA/22-113     AC A0A0K0G0T9.1
#=GS C6T463_SOYBN/34-124         AC C6T463.1
#=GS A0A0D0DPZ2_9HOMO/21-111     AC A0A0D0DPZ2.1
#=GS D7UBL2_VITVI/37-120         AC D7UBL2.1
#=GS A0A1R1PZJ7_ZANCU/228-316    AC A0A1R1PZJ7.1
#=GS A0A1A6H9V5_NEOLE/146-231    AC A0A1A6H9V5.1
#=GS J6EH42_SACK1/229-311        AC J6EH42.1
#=GS M1CZP0_SOLTU/234-317        AC M1CZP0.1
#=GS H0WNL0_OTOGA/231-316        AC H0WNL0.1
#=GS F6SB08_MACMU/216-303        AC F6SB08.2
#=GS A0A0S4T5F9_HYMMI/22-112     AC A0A0S4T5F9.1
#=GS A0A154P6B2_9HYME/22-109     AC A0A154P6B2.1
#=GS A0CYN7_PARTE/21-105         AC A0CYN7.1
#=GS A0A1V6TP84_9EURO/17-108     AC A0A1V6TP84.1
#=GS A0A1Q3EPG8_LENED/281-364    AC A0A1Q3EPG8.1
#=GS A0A1R2BQI6_9CILI/17-109     AC A0A1R2BQI6.1
#=GS S7P7S2_MYOBR/231-316        AC S7P7S2.1
#=GS A0A099P5Q7_PICKU/20-105     AC A0A099P5Q7.1
#=GS U7PYC8_SPOS1/17-110         AC U7PYC8.1
#=GS A0A176VRF1_MARPO/234-321    AC A0A176VRF1.1
#=GS Q90YX0_ICTPU/22-112         AC Q90YX0.1
#=GS W9RA28_9ROSA/21-110         AC W9RA28.1
#=GS A0A1L1RJ73_CHICK/27-111     AC A0A1L1RJ73.1
#=GS K5VUP2_AGABU/21-108         AC K5VUP2.1
#=GS W1QLU9_OGAPD/229-310        AC W1QLU9.1
#=GS M2N3C2_BAUCO/17-120         AC M2N3C2.1
#=GS G4YI50_PHYSP/17-107         AC G4YI50.1
#=GS A0A066VKJ8_9HOMO/21-67      AC A0A066VKJ8.1
#=GS Q17BC2_AEDAE/24-111         AC Q17BC2.1
#=GS W0JL94_9EURY/16-112         AC W0JL94.1
#=GS A0A1X7RV68_ZYMTR/229-312    AC A0A1X7RV68.1
#=GS F2DBD4_HORVV/234-318        AC F2DBD4.1
#=GS M2NEE3_BAUCO/21-115         AC M2NEE3.1
#=GS A0A1D2QX80_9EURY/16-108     AC A0A1D2QX80.1
#=GS M7Z059_TRIUA/176-261        AC M7Z059.1
#=GS A0A1J4UBW0_9ARCH/20-95      AC A0A1J4UBW0.1
#=GS A0A1Q2YDU1_9ASCO/56-146     AC A0A1Q2YDU1.1
#=GS A0A1S3Y7X7_TOBAC/17-113     AC A0A1S3Y7X7.1
#=GS A0A084QIT6_STAC4/21-110     AC A0A084QIT6.1
#=GS W7EZF0_PLAF8/231-315        AC W7EZF0.1
#=GS A0A010RTY6_9PEZI/229-313    AC A0A010RTY6.1
#=GS A0A1D6FKZ4_MAIZE/186-280    AC A0A1D6FKZ4.1
#=GS B6HQS8_PENRW/17-108         AC B6HQS8.1
#=GS A5E624_LODEL/20-108         AC A5E624.1
#=GS A0A0M3JS03_ANISI/14-97      AC A0A0M3JS03.1
#=GS A0A1Y2BC65_9FUNG/17-111     AC A0A1Y2BC65.1
#=GS A0A1S3IJH9_LINUN/231-313    AC A0A1S3IJH9.1
#=GS A0A2B4RB66_STYPI/231-316    AC A0A2B4RB66.1
#=GS A0A166A0Z1_9EURY/16-99      AC A0A166A0Z1.1
#=GS W9VQX0_9EURO/229-314        AC W9VQX0.1
#=GS W0TDQ9_KLUMD/19-103         AC W0TDQ9.1
#=GS G8Y0P6_PICSO/229-308        AC G8Y0P6.1
#=GS A0A1Y2HCY1_9FUNG/20-107     AC A0A1Y2HCY1.1
#=GS B9SI03_RICCO/234-322        AC B9SI03.1
#=GS A0A1G4BJ12_9PEZI/229-313    AC A0A1G4BJ12.1
#=GS V4L2B1_EUTSA/71-161         AC V4L2B1.1
#=GS A0A1L0GBQ2_9ASCO/20-105     AC A0A1L0GBQ2.1
#=GS A0A0L0G6P1_9EUKA/16-109     AC A0A0L0G6P1.1
#=GS Q8TZC6_METKA/16-104         AC Q8TZC6.1
#=GS A0A287AUY0_PIG/19-85        AC A0A287AUY0.1
#=GS A0A093Z0Q4_9PEZI/229-310    AC A0A093Z0Q4.1
#=GS A7EZ61_SCLS1/21-109         AC A7EZ61.1
#=GS G7WNB0_METH6/16-100         AC G7WNB0.1
#=GS A0A0V1DG86_TRIBR/22-112     AC A0A0V1DG86.1
#=GS A0A1Y1WMZ9_9FUNG/229-313    AC A0A1Y1WMZ9.1
#=GS A0A176W912_MARPO/133-221    AC A0A176W912.1
#=GS E4ZUZ7_LEPMJ/229-315        AC E4ZUZ7.1
#=GS A0A182NTH5_9DIPT/23-112     AC A0A182NTH5.1
#=GS A0A218ZSR5_9EURY/16-104     AC A0A218ZSR5.1
#=GS C1N791_MICPC/233-314        AC C1N791.1
#=GS Q4Q6R6_LEIMA/16-105         AC Q4Q6R6.1
#=GS B6YSY0_THEON/16-104         AC B6YSY0.1
#=GS A0A1Q3BZQ6_CEPFO/21-111     AC A0A1Q3BZQ6.1
#=GS G7XSX5_ASPKW/21-107         AC G7XSX5.1
#=GS A0A067RBI1_ZOONE/22-116     AC A0A067RBI1.1
#=GS G0W3R9_NAUDC/19-105         AC G0W3R9.1
#=GS C6SWA9_SOYBN/17-113         AC C6SWA9.1
#=GS G0PCW9_CAEBE/22-110         AC G0PCW9.1
#=GS U6JF89_ECHGR/22-120         AC U6JF89.1
#=GS A0A1D3D5I5_9EIME/19-74      AC A0A1D3D5I5.1
#=GS B9LTD4_HALLT/16-111         AC B9LTD4.1
#=GS A0A1A0H941_9ASCO/20-105     AC A0A1A0H941.1
#=GS A2DQV0_TRIVA/17-105         AC A2DQV0.1
#=GS A0A2K1XFX6_POPTR/21-109     AC A0A2K1XFX6.1
#=GS H2QZH4_PANTR/22-113         AC H2QZH4.1
#=GS I1Q9G9_ORYGL/10-102         AC I1Q9G9.1
#=GS A0A2I3N7Z9_PAPAN/208-291    AC A0A2I3N7Z9.1
#=GS A0A1Y2AAC0_9PLEO/17-111     AC A0A1Y2AAC0.1
#=GS B4M1P7_DROVI/17-114         AC B4M1P7.1
#=GS L1J787_GUITH/239-322        AC L1J787.1
#=GS A0A2K2BKH7_POPTR/21-106     AC A0A2K2BKH7.1
#=GS A0A1R2BJ76_9CILI/17-109     AC A0A1R2BJ76.1
#=GS Q1HR99_AEDAE/231-314        AC Q1HR99.1
#=GS A0A0D2UYW6_GOSRA/234-320    AC A0A0D2UYW6.1
#=GS A0A0D1CLB4_USTMA/17-110     AC A0A0D1CLB4.1
#=GS A0A1D3L0C0_9EURY/16-99      AC A0A1D3L0C0.1
#=GS A0A090LFB6_STRRB/17-109     AC A0A090LFB6.1
#=GS A0A284R8H5_9AGAR/105-193    AC A0A284R8H5.1
#=GS A0A1S3CUK5_DIACI/229-313    AC A0A1S3CUK5.1
#=GS A0A166E3Q5_DAUCA/21-109     AC A0A166E3Q5.1
#=GS A0A044TKS4_ONCVO/18-117     AC A0A044TKS4.1
#=GS A0A0R0F6M5_SOYBN/234-304    AC A0A0R0F6M5.1
#=GS G4UEF2_NEUT9/21-108         AC G4UEF2.1
#=GS Q0PXX2_DIACI/17-113         AC Q0PXX2.1
#=GS A0A179H1U0_9HYPO/21-108     AC A0A179H1U0.1
#=GS G8C263_TETPH/19-105         AC G8C263.1
#=GS D7M5K2_ARALL/22-112         AC D7M5K2.1
#=GS A0A183WUA2_TRIRE/214-293    AC A0A183WUA2.1
#=GS D0NVM9_PHYIT/231-311        AC D0NVM9.1
#=GS C4QYM0_KOMPG/27-117         AC C4QYM0.1
#=GS B4QKR0_DROSI/231-316        AC B4QKR0.1
#=GS A0A1X1BJ56_9APIC/32-115     AC A0A1X1BJ56.1
#=GS A4HFR6_LEIBR/238-323        AC A4HFR6.1
#=GS A0A0F8WAD3_9EURO/48-135     AC A0A0F8WAD3.1
#=GS A0A0E0IXY8_ORYNI/551-635    AC A0A0E0IXY8.1
#=GS A5E0C0_LODEL/17-109         AC A5E0C0.1
#=GS A0A095C8H8_CRYGR/17-110     AC A0A095C8H8.1
#=GS A0A165SAS5_9APHY/37-125     AC A0A165SAS5.1
#=GS A0A0B2V8V0_TOXCA/17-117     AC A0A0B2V8V0.1
#=GS A0A0F8CTR8_9EURY/16-101     AC A0A0F8CTR8.1
#=GS A0A1E5VM95_9POAL/1-67       AC A0A1E5VM95.1
#=GS A0A1J4UEZ7_9ARCH/19-100     AC A0A1J4UEZ7.1
#=GS H3E637_PRIPA/22-107         AC H3E637.1
#=GS A0A0B2UKZ5_9MICR/24-105     AC A0A0B2UKZ5.1
#=GS A0A0A2W3V9_BEABA/17-89      AC A0A0A2W3V9.1
#=GS A0A1V6NYZ1_9EURO/21-108     AC A0A1V6NYZ1.1
#=GS F4C0T3_METSG/234-323        AC F4C0T3.1
#=GS A0A212FEQ6_DANPL/231-315    AC A0A212FEQ6.1
#=GS I7IS73_BABMR/32-119         AC I7IS73.1
#=GS B0WQZ4_CULQU/231-314        AC B0WQZ4.1
#=GS B0W7R3_CULQU/15-98          AC B0W7R3.1
#=GS S8EKB5_FOMPI/41-129         AC S8EKB5.1
#=GS A0A0K0FUR6_9BILA/17-108     AC A0A0K0FUR6.1
#=GS A0A177UE67_9BASI/229-313    AC A0A177UE67.1
#=GS R7YJP5_CONA1/17-113         AC R7YJP5.1
#=GS A0A2C5ZKV5_9HYPO/17-110     AC A0A2C5ZKV5.1
#=GS L5LSG8_MYODS/29-104         AC L5LSG8.1
#=GS A0A0C3A0X3_9HOMO/229-313    AC A0A0C3A0X3.1
#=GS Q4N5C0_THEPA/19-109         AC Q4N5C0.1
#=GS A0A1A0HJJ5_9ASCO/24-114     AC A0A1A0HJJ5.1
#=GS U4UXJ9_DENPD/55-149         AC U4UXJ9.1
#=GS A0A1L9RXS4_ASPWE/230-311    AC A0A1L9RXS4.1
#=GS A0A0F8A467_9HYPO/17-109     AC A0A0F8A467.1
#=GS A7E2K4_DANRE/17-113         AC A7E2K4.1
#=GS F6U1F3_XENTR/17-113         AC F6U1F3.1
#=GS I1BZD4_RHIO9/17-107         AC I1BZD4.1
#=GS A0A1A6HTU6_NEOLE/22-110     AC A0A1A6HTU6.1
#=GS A0A2I3GZ98_NOMLE/20-105     AC A0A2I3GZ98.1
#=GS A0A175YAJ3_DAUCA/234-319    AC A0A175YAJ3.1
#=GS B4FUB4_MAIZE/21-108         AC B4FUB4.1
#=GS A0A078IBN0_BRANA/17-113     AC A0A078IBN0.1
#=GS G0R4G7_ICHMG/17-110         AC G0R4G7.1
#=GS A0A0M9VNY7_9BASI/17-110     AC A0A0M9VNY7.1
#=GS A0A0A1UC61_ENTIV/23-107     AC A0A0A1UC61.1
#=GS A0A2H3XHQ9_PHODC/17-111     AC A0A2H3XHQ9.1
#=GS A0A177B0E9_9METZ/194-272    AC A0A177B0E9.1
#=GS A7S837_NEMVE/22-109         AC A7S837.1
#=GS F9WD61_TRYCI/35-126         AC F9WD61.1
#=GS A9CS87_ENTBH/16-100         AC A9CS87.1
#=GS A0A133UZZ9_9EURY/16-100     AC A0A133UZZ9.1
#=GS F6YZ91_MONDO/22-113         AC F6YZ91.2
#=GS B9HPG0_POPTR/18-115         AC B9HPG0.1
#=GS S9UVN0_9TRYP/220-306        AC S9UVN0.1
#=GS A0A0L7KQG6_9NEOP/1-78       AC A0A0L7KQG6.1
#=GS A0A074T3F7_HAMHA/93-179     AC A0A074T3F7.1
#=GS A0A0V1I0S4_9BILA/37-134     AC A0A0V1I0S4.1
#=GS A0A0M9FPN2_9TRYP/20-107     AC A0A0M9FPN2.1
#=GS G1KQZ8_ANOCA/17-113         AC G1KQZ8.1
#=GS D8QPV7_SELML/234-320        AC D8QPV7.1
#=GS A0A0C4DRL8_MAGP6/17-109     AC A0A0C4DRL8.1
#=GS T0R8E2_9STRA/17-107         AC T0R8E2.1
#=GS A0A0D2XM57_FUSO4/21-108     AC A0A0D2XM57.1
#=GS A0A251TMQ5_HELAN/21-110     AC A0A251TMQ5.1
#=GS A0A136JEJ6_9PEZI/229-310    AC A0A136JEJ6.1
#=GS A0A2I0PP35_9EURY/9-101      AC A0A2I0PP35.1
#=GS A0A1J4K7Y3_9EUKA/17-104     AC A0A1J4K7Y3.1
#=GS H2Z4W6_CIOSA/21-105         AC H2Z4W6.1
#=GS A0A091S823_NESNO/213-270    AC A0A091S823.1
#=GS A0A1L9N3Q1_ASPTU/17-109     AC A0A1L9N3Q1.1
#=GS A0A165Z7X5_9HOMO/17-100     AC A0A165Z7X5.1
#=GS A0A1U8L1S6_GOSHI/23-110     AC A0A1U8L1S6.1
#=GS F7EIM0_ORNAN/17-109         AC F7EIM0.1
#=GS A0A2G3CBP6_CAPCH/234-317    AC A0A2G3CBP6.1
#=GS A0A1U7WFP4_NICSY/21-111     AC A0A1U7WFP4.1
#=GS A0A1B1DYX0_9APIC/19-110     AC A0A1B1DYX0.1
#=GS A0A0A1MIV8_9FUNG/20-106     AC A0A0A1MIV8.1
#=GS A0A2H1EDV3_9ARCH/16-99      AC A0A2H1EDV3.1
#=GS A0A1U7Q529_MESAU/17-114     AC A0A1U7Q529.1
#=GS G1QDJ9_MYOLU/22-113         AC G1QDJ9.1
#=GS M9MH80_PSEA3/131-176        AC M9MH80.1
#=GS M7TB45_BOTF1/44-137         AC M7TB45.1
#=GS A8WS55_CAEBR/231-311        AC A8WS55.1
#=GS A0A2I4GFV6_9ROSI/21-112     AC A0A2I4GFV6.1
#=GS A0A136J169_9PEZI/21-108     AC A0A136J169.1
#=GS A0A0B0MC61_GOSAR/22-113     AC A0A0B0MC61.1
#=GS A0A0F7PE23_9EURY/16-111     AC A0A0F7PE23.1
#=GS C7YYI8_NECH7/17-109         AC C7YYI8.1
#=GS A0A0A0L5M7_CUCSA/21-112     AC A0A0A0L5M7.1
#=GS B3MAK8_DROAN/231-316        AC B3MAK8.1
#=GS M9SGT3_METAX/230-333        AC M9SGT3.1
#=GS A3LSH5_PICST/17-108         AC A3LSH5.1
#=GS A0A2I4GLT3_9ROSI/94-180     AC A0A2I4GLT3.1
#=GS C9S6M2_VERA1/21-108         AC C9S6M2.1
#=GS I3MKZ5_ICTTR/17-114         AC I3MKZ5.1
#=GS A0A2B7XE13_9EURO/229-310    AC A0A2B7XE13.1
#=GS A0A1A8YUU9_9APIC/32-118     AC A0A1A8YUU9.1
#=GS A0A016VEM1_9BILA/17-92      AC A0A016VEM1.1
#=GS B0X3D8_CULQU/17-109         AC B0X3D8.1
#=GS A0A0N0BIW7_9HYME/231-318    AC A0A0N0BIW7.1
#=GS H0XPU5_OTOGA/22-113         AC H0XPU5.1
#=GS L5KEP9_PTEAL/2-76           AC L5KEP9.1
#=GS M7SX42_EUTLA/229-311        AC M7SX42.1
#=GS A0A1J7K5E3_9PEZI/17-111     AC A0A1J7K5E3.1
#=GS M0THF3_MUSAM/234-319        AC M0THF3.1
#=GS A0A2G5VJ03_9PELO/231-311    AC A0A2G5VJ03.1
#=GS H9G833_ANOCA/231-314        AC H9G833.1
#=GS A0A166NIK9_9PEZI/17-110     AC A0A166NIK9.1
#=GS A0A1S2XV01_CICAR/21-92      AC A0A1S2XV01.1
#=GS A0A165D769_9BASI/229-313    AC A0A165D769.1
#=GS A0A067JWR3_JATCU/21-113     AC A0A067JWR3.1
#=GS A0A093GJR2_DRYPU/17-64      AC A0A093GJR2.1
#=GS G4T6X4_SERID/229-310        AC G4T6X4.1
#=GS A0A0C9TAC9_PLICR/229-311    AC A0A0C9TAC9.1
#=GS A0A167ZU72_9PEZI/229-310    AC A0A167ZU72.1
#=GS M0RXH3_MUSAM/24-115         AC M0RXH3.1
#=GS A0A177DEP8_ALTAL/21-104     AC A0A177DEP8.1
#=GS A0A0D3GXZ9_9ORYZ/17-108     AC A0A0D3GXZ9.1
#=GS A0A251TVF1_HELAN/50-140     AC A0A251TVF1.1
#=GS A0A287B0N0_PIG/19-67        AC A0A287B0N0.1
#=GS D2VM36_NAEGR/249-328        AC D2VM36.1
#=GS A0A2H1A5Q8_CANAR/229-310    AC A0A2H1A5Q8.1
#=GS A0A067PL09_9HOMO/21-110     AC A0A067PL09.1
#=GS E7KHQ0_YEASA/16-105         AC E7KHQ0.1
#=GS A0A0B0PBV6_GOSAR/150-236    AC A0A0B0PBV6.1
#=GS A0A232F4M2_9HYME/17-112     AC A0A232F4M2.1
#=GS A0A1I6HL15_9EURY/16-112     AC A0A1I6HL15.1
#=GS F1A4T6_DICPU/24-110         AC F1A4T6.1
#=GS A0A0W8E197_PHYNI/29-111     AC A0A0W8E197.1
#=GS A0A0E0R3U6_ORYRU/610-695    AC A0A0E0R3U6.1
#=GS M7XAZ8_RHOT1/17-109         AC M7XAZ8.1
#=GS A0A0N4YB01_NIPBR/17-111     AC A0A0N4YB01.1
#=GS W6MVL8_9ASCO/19-103         AC W6MVL8.1
#=GS G0RFG1_HYPJQ/229-314        AC G0RFG1.1
#=GS W6LGU4_9TRYP/238-323        AC W6LGU4.1
#=GS A0A0A2L8B2_PENIT/229-311    AC A0A0A2L8B2.1
#=GS A0A0C9MH63_9FUNG/20-104     AC A0A0C9MH63.1
#=GS A0A2I3MUK5_PAPAN/26-113     AC A0A2I3MUK5.1
#=GS A0A117LFZ1_9EURY/16-101     AC A0A117LFZ1.1
#=GS A0A251NA79_PRUPE/17-112     AC A0A251NA79.1
#=GS A0A0L0SEJ3_ALLMA/22-108     AC A0A0L0SEJ3.1
#=GS A0A1E3NL17_9ASCO/17-107     AC A0A1E3NL17.1
#=GS A0A2E8ECS0_9ARCH/16-98      AC A0A2E8ECS0.1
#=GS I3R883_HALMT/16-110         AC I3R883.1
#=GS A0A0V1J743_TRIPS/24-121     AC A0A0V1J743.1
#=GS B3L5A9_PLAKH/231-313        AC B3L5A9.1
#=GS U6KZ60_EIMTE/9-105          AC U6KZ60.1
#=GS RLA0_NEUCR/229-312          AC Q96TJ5.1
#=GS A0A2A4KAR6_HELVI/22-110     AC A0A2A4KAR6.1
#=GS K3YKC6_SETIT/17-111         AC K3YKC6.1
#=GS B9I217_POPTR/21-112         AC B9I217.1
#=GS A0A226NRX3_COLVI/22-113     AC A0A226NRX3.1
#=GS RLA21_ARATH/17-114          AC P51407.2
#=GS A0A1S2YFQ0_CICAR/7-120      AC A0A1S2YFQ0.1
#=GS A0A151GU46_9HYPO/21-108     AC A0A151GU46.1
#=GS A0A0A1NEJ3_9FUNG/20-106     AC A0A0A1NEJ3.1
#=GS A0A1R2CNC2_9CILI/32-117     AC A0A1R2CNC2.1
#=GS G3IIQ6_CRIGR/17-102         AC G3IIQ6.1
#=GS A0A0D3E0J5_BRAOL/17-113     AC A0A0D3E0J5.1
#=GS A0A1A9VHZ4_GLOAU/19-76      AC A0A1A9VHZ4.1
#=GS A0A1U8LST2_GOSHI/22-113     AC A0A1U8LST2.1
#=GS A0A0D9Y5M9_9ORYZ/58-118     AC A0A0D9Y5M9.1
#=GS A0A1L8GJK1_XENLA/17-68      AC A0A1L8GJK1.1
#=GS A0A1R3KLB6_9ROSI/17-113     AC A0A1R3KLB6.1
#=GS A0A0K9Q9F4_SPIOL/127-213    AC A0A0K9Q9F4.1
#=GS G0RUV7_HYPJQ/21-108         AC G0RUV7.1
#=GS M0AUD2_NATA1/16-113         AC M0AUD2.1
#=GS A0A0D2QQU5_GOSRA/22-104     AC A0A0D2QQU5.1
#=GS G8BKG6_CANPC/20-110         AC G8BKG6.1
#=GS V2XWK9_MONRO/26-115         AC V2XWK9.1
#=GS A0A2C5XYB1_9HYPO/229-313    AC A0A2C5XYB1.1
#=GS A0A1Y1VL06_9FUNG/23-107     AC A0A1Y1VL06.1
#=GS A0A2I3SM72_PANTR/18-88      AC A0A2I3SM72.1
#=GS W9R644_9ROSA/234-319        AC W9R644.1
#=GS F7HRN7_MACMU/231-317        AC F7HRN7.1
#=GS A0A1B8AJX3_FUSPO/17-108     AC A0A1B8AJX3.1
#=GS R0G646_9BRAS/233-320        AC R0G646.1
#=GS A0A1Y2HM56_9FUNG/192-273    AC A0A1Y2HM56.1
#=GS A0A1A9W1Y9_9MUSC/17-113     AC A0A1A9W1Y9.1
#=GS A1CRF6_ASPCL/229-312        AC A1CRF6.1
#=GS A0A135RYH6_9PEZI/17-110     AC A0A135RYH6.1
#=GS A0A2H3GYK8_FUSOX/21-67      AC A0A2H3GYK8.1
#=GS A0A151BM89_9ARCH/16-103     AC A0A151BM89.1
#=GS M4AM80_XIPMA/22-112         AC M4AM80.1
#=GS A0A093ZE07_9PEZI/229-311    AC A0A093ZE07.1
#=GS J8Q6X0_SACAR/20-105         AC J8Q6X0.1
#=GS G3I1S0_CRIGR/1-82           AC G3I1S0.1
#=GS A0A0D2EPD2_9EURO/17-113     AC A0A0D2EPD2.1
#=GS A0A1E5V3V4_9POAL/1-73       AC A0A1E5V3V4.1
#=GS G1X570_ARTOA/21-108         AC G1X570.1
#=GS A0A162FD81_9EURY/16-100     AC A0A162FD81.1
#=GS C5YFT4_SORBI/17-111         AC C5YFT4.1
#=GS A0A168SER6_ABSGL/182-263    AC A0A168SER6.1
#=GS B4NEP4_DROWI/17-115         AC B4NEP4.1
#=GS F1RTU6_PIG/22-107           AC F1RTU6.1
#=GS A0A2G5USZ0_9PELO/17-109     AC A0A2G5USZ0.1
#=GS H1VCD7_COLHI/22-105         AC H1VCD7.1
#=GS A0A1R1XTU9_9FUNG/228-315    AC A0A1R1XTU9.1
#=GS U3J062_ANAPL/15-112         AC U3J062.1
#=GS D6WMT4_TRICA/231-315        AC D6WMT4.1
#=GS A0A067CTV2_SAPPC/231-314    AC A0A067CTV2.1
#=GS A0A061GVH2_THECC/17-112     AC A0A061GVH2.1
#=GS S9W6Q9_SCHCR/21-106         AC S9W6Q9.1
#=GS A0A1X7UML1_AMPQE/74-166     AC A0A1X7UML1.1
#=GS S8AS47_PENO1/17-108         AC S8AS47.1
#=GS A0A0D1ZPR8_9EURO/229-314    AC A0A0D1ZPR8.1
#=GS A0A182SCP3_9DIPT/1-85       AC A0A182SCP3.1
#=GS V4CM71_LOTGI/231-313        AC V4CM71.1
#=GS A0A093XD20_9PEZI/17-109     AC A0A093XD20.1
#=GS K3WS98_PYTUL/26-110         AC K3WS98.1
#=GS A3BJK9_ORYSJ/17-106         AC A3BJK9.1
#=GS A0A1E5RNN1_9ASCO/20-106     AC A0A1E5RNN1.1
#=GS A0A256XX37_9CREN/16-103     AC A0A256XX37.1
#=GS A0A1S7UJ91_ROSNE/21-109     AC A0A1S7UJ91.1
#=GS A0A2G2ZTX4_CAPAN/194-277    AC A0A2G2ZTX4.1
#=GS A0A287G7Z3_HORVV/2-91       AC A0A287G7Z3.1
#=GS A0A0L0SFT9_ALLMA/21-105     AC A0A0L0SFT9.1
#=GS A0A2A2KFL4_9BILA/231-316    AC A0A2A2KFL4.1
#=GS G3WPT4_SARHA/22-113         AC G3WPT4.1
#=GS G2R499_THITE/229-312        AC G2R499.1
#=GS A0A016VFG8_9BILA/1-57       AC A0A016VFG8.1
#=GS C1GQK6_PARBA/229-312        AC C1GQK6.1
#=GS A0A072VI67_MEDTR/1-78       AC A0A072VI67.1
#=GS A0A074WVD8_9PEZI/229-302    AC A0A074WVD8.1
#=GS A0A0L8G8N4_OCTBM/14-92      AC A0A0L8G8N4.1
#=GS F1RNZ2_PIG/17-114           AC F1RNZ2.1
#=GS B6JZT8_SCHJY/16-108         AC B6JZT8.1
#=GS A0A2H3IAJ2_9EURO/17-111     AC A0A2H3IAJ2.1
#=GS A0A200Q7M0_9MAGN/234-323    AC A0A200Q7M0.1
#=GS A0A031LR95_9CREN/16-102     AC A0A031LR95.1
#=GS K2N1X8_TRYCR/238-323        AC K2N1X8.1
#=GS A0A0E0IXY7_ORYNI/559-643    AC A0A0E0IXY7.1
#=GS A0A162AMY4_DAUCA/17-114     AC A0A162AMY4.1
#=GS Q16IP6_AEDAE/21-91          AC Q16IP6.1
#=GS A0A0A0KKF6_CUCSA/17-114     AC A0A0A0KKF6.1
#=GS A0A0E0DS57_9ORYZ/17-112     AC A0A0E0DS57.1
#=GS G5BA60_HETGA/22-77          AC G5BA60.1
#=GS S7RPJ3_GLOTA/17-112         AC S7RPJ3.1
#=GS F9F1Y7_FUSOF/229-312        AC F9F1Y7.1
#=GS A0A2G3DEK6_CAPCH/21-111     AC A0A2G3DEK6.1
#=GS A0A1Q3C2Q1_CEPFO/167-252    AC A0A1Q3C2Q1.1
#=GS A0A0N4VKR7_ENTVE/24-120     AC A0A0N4VKR7.1
#=GS A0A091D800_FUKDA/71-168     AC A0A091D800.1
#=GS A0A286UFF8_9HOMO/21-108     AC A0A286UFF8.1
#=GS A0A016UDG4_9BILA/231-314    AC A0A016UDG4.1
#=GS A0A0V1I011_9BILA/22-112     AC A0A0V1I011.1
#=GS R0KX96_SETT2/21-110         AC R0KX96.1
#=GS A0A218X2C0_PUNGR/17-114     AC A0A218X2C0.1
#=GS Q17FT7_AEDAE/3-63           AC Q17FT7.1
#=GS A0A1W4UXV7_DROFC/17-112     AC A0A1W4UXV7.1
#=GS A0A1Y1JHB0_PLAGO/19-110     AC A0A1Y1JHB0.1
#=GS E4UY93_ARTGP/17-112         AC E4UY93.1
#=GS A0A132AAI5_SARSC/231-316    AC A0A132AAI5.1
#=GS A0A168JRC4_MUCCL/17-105     AC A0A168JRC4.1
#=GS C5MGJ9_CANTT/20-106         AC C5MGJ9.1
#=GS E3S4C1_PYRTT/229-314        AC E3S4C1.1
#=GS A0A1U7UUA4_TARSY/12-102     AC A0A1U7UUA4.1
#=GS A0A095EFQ3_CRYGR/229-311    AC A0A095EFQ3.1
#=GS M8A407_TRIUA/17-112         AC M8A407.1
#=GS X0J2J4_FUSOX/229-312        AC X0J2J4.1
#=GS A0A1Y2H4D0_9FUNG/17-110     AC A0A1Y2H4D0.1
#=GS E5S6M4_TRISP/231-320        AC E5S6M4.1
#=GS A0A0E3SC59_9EURY/16-103     AC A0A0E3SC59.1
#=GS C6HAJ2_AJECH/229-310        AC C6HAJ2.1
#=GS A0A1Q3DII9_CEPFO/234-319    AC A0A1Q3DII9.1
#=GS I1JYI8_SOYBN/21-109         AC I1JYI8.1
#=GS A0A1E3P4C6_WICAO/15-105     AC A0A1E3P4C6.1
#=GS B6QNT0_TALMQ/229-312        AC B6QNT0.1
#=GS K7IWC5_NASVI/22-111         AC K7IWC5.1
#=GS J4KR91_BEAB2/229-312        AC J4KR91.1
#=GS A0A0D2B277_9EURO/21-111     AC A0A0D2B277.1
#=GS L5JNQ5_PTEAL/22-113         AC L5JNQ5.1
#=GS A0A1A8VVS4_9APIC/231-313    AC A0A1A8VVS4.1
#=GS A0A2I2YLU0_GORGO/189-273    AC A0A2I2YLU0.1
#=GS A0A218WBQ6_PUNGR/234-319    AC A0A218WBQ6.1
#=GS G3JKF4_CORMM/229-310        AC G3JKF4.1
#=GS A0A0D9YT45_9ORYZ/17-112     AC A0A0D9YT45.1
#=GS A0A261BP23_9PELO/17-107     AC A0A261BP23.1
#=GS W7I4U6_9PEZI/21-67          AC W7I4U6.1
#=GS A0A2A3T951_9ARCH/16-97      AC A0A2A3T951.1
#=GS H9GZL8_HORSE/17-58          AC H9GZL8.1
#=GS A0A2G3A027_CAPAN/21-94      AC A0A2G3A027.1
#=GS A0A0A1NZF2_9FUNG/228-309    AC A0A0A1NZF2.1
#=GS A9PE32_POPTR/21-123         AC A9PE32.1
#=GS A0A1L8GJE9_XENLA/1-50       AC A0A1L8GJE9.1
#=GS A0A125RAU4_9EURY/16-101     AC A0A125RAU4.1
#=GS A0A1Z5TT99_HORWE/259-339    AC A0A1Z5TT99.1
#=GS A0A2H3YIN3_PHODC/234-319    AC A0A2H3YIN3.1
#=GS W4ZG19_STRPU/23-108         AC W4ZG19.1
#=GS A0A0K9PJH4_ZOSMR/17-109     AC A0A0K9PJH4.1
#=GS A0A2G9HKX3_9LAMI/18-119     AC A0A2G9HKX3.1
#=GS A0A0W8BUF5_PHYNI/105-193    AC A0A0W8BUF5.1
#=GS R7S1P7_PUNST/229-312        AC R7S1P7.1
#=GS M1DCK1_SOLTU/22-110         AC M1DCK1.1
#=GS V5EQD2_KALBG/230-312        AC V5EQD2.1
#=GS A0A125PHF4_9BASI/35-118     AC A0A125PHF4.1
#=GS A0A0N4TVG5_BRUPA/10-110     AC A0A0N4TVG5.1
#=GS A0A176WHU5_MARPO/50-122     AC A0A176WHU5.1
#=GS G8B8T9_CANPC/229-311        AC G8B8T9.1
#=GS G0QRE6_ICHMG/21-108         AC G0QRE6.1
#=GS I1CHH6_RHIO9/20-105         AC I1CHH6.1
#=GS A0A1Q5UIZ8_9EURO/229-312    AC A0A1Q5UIZ8.1
#=GS A0A1S3Y0Y1_TOBAC/17-111     AC A0A1S3Y0Y1.1
#=GS A0A078B325_STYLE/32-117     AC A0A078B325.1
#=GS A0A1A6G4K8_NEOLE/22-66      AC A0A1A6G4K8.1
#=GS C4M4I3_ENTHI/16-105         AC C4M4I3.1
#=GS C5ME44_CANTT/20-106         AC C5ME44.1
#=GS A0A176VYG5_MARPO/17-112     AC A0A176VYG5.1
#=GS A0A1Z9U8T9_9EURY/231-336    AC A0A1Z9U8T9.1
#=GS C5YVH3_SORBI/234-317        AC C5YVH3.1
#=GS A0A061G2B7_THECC/337-423    AC A0A061G2B7.1
#=GS A0A1X0P470_9TRYP/238-323    AC A0A1X0P470.1
#=GS A0A0D3HHW0_9ORYZ/658-743    AC A0A0D3HHW0.1
#=GS F0U5V7_AJEC8/21-109         AC F0U5V7.1
#=GS D3E154_METRM/230-334        AC D3E154.1
#=GS I1I0I0_BRADI/21-109         AC I1I0I0.1
#=GS A0A2A9PHS9_9HYPO/22-109     AC A0A2A9PHS9.1
#=GS H8ZB36_NEMS1/20-98          AC H8ZB36.1
#=GS A0A1B8FS19_9PEZI/21-108     AC A0A1B8FS19.1
#=GS A0A1E3NT89_9ASCO/22-107     AC A0A1E3NT89.1
#=GS M0LF70_9EURY/16-112         AC M0LF70.1
#=GS R0IWB7_SETT2/229-313        AC R0IWB7.1
#=GS V7AS03_PHAVU/24-111         AC V7AS03.1
#=GS J9JRN4_ACYPI/23-110         AC J9JRN4.1
#=GS A0A0J7JZM0_LASNI/22-112     AC A0A0J7JZM0.1
#=GS B4JDP3_DROGR/22-111         AC B4JDP3.1
#=GS Q5B0D4_EMENI/17-108         AC Q5B0D4.1
#=GS A0A1U8NYI9_GOSHI/17-113     AC A0A1U8NYI9.1
#=GS C5E3Q9_LACTC/20-106         AC C5E3Q9.1
#=GS A0A182DZI3_ONCOC/1-46       AC A0A182DZI3.1
#=GS D8RTH0_SELML/234-317        AC D8RTH0.1
#=GS A2DSX3_TRIVA/20-103         AC A2DSX3.1
#=GS A0A1J5JJW4_9EURY/16-104     AC A0A1J5JJW4.1
#=GS R4WA47_9EURY/16-114         AC R4WA47.1
#=GS A0A1E4TGS9_9ASCO/16-108     AC A0A1E4TGS9.1
#=GS A0A0D2RBU4_GOSRA/17-112     AC A0A0D2RBU4.1
#=GS A0A0D3GKH0_9ORYZ/61-118     AC A0A0D3GKH0.1
#=GS N4U857_FUSC1/21-108         AC N4U857.1
#=GS A0A0A2VZW8_BEABA/229-311    AC A0A0A2VZW8.1
#=GS A0A0D2QDP7_GOSRA/21-111     AC A0A0D2QDP7.1
#=GS T1GDU0_MEGSC/22-110         AC T1GDU0.1
#=GS A0A1Y2DSW1_9PEZI/17-112     AC A0A1Y2DSW1.1
#=GS G0QAR6_NANSJ/1-84           AC G0QAR6.1
#=GS A0A1J1H5I5_PLARL/231-315    AC A0A1J1H5I5.1
#=GS A0A0N0P2F2_LEPSE/209-296    AC A0A0N0P2F2.1
#=GS U1HW83_ENDPU/229-313        AC U1HW83.1
#=GS G3P155_GASAC/231-289        AC G3P155.1
#=GS G0V665_NAUCC/20-106         AC G0V665.1
#=GS B8BAG5_ORYSI/131-215        AC B8BAG5.1
#=GS A0A0A1NHV7_9FUNG/228-309    AC A0A0A1NHV7.1
#=GS A0A194WT18_9HELO/17-112     AC A0A194WT18.1
#=GS A0A286ZZY4_PIG/1-79         AC A0A286ZZY4.1
#=GS A0A091IMG1_EGRGA/17-114     AC A0A091IMG1.1
#=GS A0A0G2I2T0_9EURO/21-110     AC A0A0G2I2T0.1
#=GS A0A151BGR6_9ARCH/22-111     AC A0A151BGR6.1
#=GS B6T361_MAIZE/21-108         AC B6T361.1
#=GS A0A0N5BA60_STREA/17-108     AC A0A0N5BA60.1
#=GS K2RHF1_MACPH/229-314        AC K2RHF1.1
#=GS G7E8R9_MIXOS/66-160         AC G7E8R9.1
#=GS C1HAX7_PARBA/21-110         AC C1HAX7.1
#=GS A0A0D9UYR2_9ORYZ/13-119     AC A0A0D9UYR2.1
#=GS A0A0B0PKP6_GOSAR/234-320    AC A0A0B0PKP6.1
#=GS C4Y3A1_CLAL4/17-109         AC C4Y3A1.1
#=GS J4WBR8_BEAB2/21-107         AC J4WBR8.1
#=GS S8BAH7_DACHA/229-312        AC S8BAH7.1
#=GS A0A0W8BZE9_PHYNI/231-311    AC A0A0W8BZE9.1
#=GS A0A0W4ZEM8_PNEJ7/17-106     AC A0A0W4ZEM8.1
#=GS A0A0E0AHQ1_9ORYZ/17-86      AC A0A0E0AHQ1.1
#=GS A0A1D8PQS0_CANAL/229-311    AC A0A1D8PQS0.1
#=GS A0A1E4RZW0_CYBJA/48-138     AC A0A1E4RZW0.1
#=GS E4XMZ9_OIKDI/17-107         AC E4XMZ9.1
#=GS A0A2G3BKE4_CAPCH/19-100     AC A0A2G3BKE4.1
#=GS A0A179FQN2_METCM/17-110     AC A0A179FQN2.1
#=GS A0A1B0GQL5_PHLPP/58-109     AC A0A1B0GQL5.1
#=GS A0A024WER9_PLAFA/19-111     AC A0A024WER9.1
#=GS A0A0E0MC60_ORYPU/213-287    AC A0A0E0MC60.1
#=GS S8DY94_FOMPI/229-314        AC S8DY94.1
#=GS A0A2G3BXJ2_CAPCH/17-113     AC A0A2G3BXJ2.1
#=GS A0A0J8RTS2_COCIT/21-110     AC A0A0J8RTS2.1
#=GS A0A147JUD6_9EURY/16-99      AC A0A147JUD6.1
#=GS H9J1M5_BOMMO/22-111         AC H9J1M5.1
#=GS M2SSE6_COCSN/21-111         AC M2SSE6.1
#=GS A0A0L1HNT0_9PLEO/17-110     AC A0A0L1HNT0.1
#=GS A0A0F4XFH1_HANUV/16-106     AC A0A0F4XFH1.1
#=GS M1BB70_SOLTU/21-110         AC M1BB70.1
#=GS A0A165GVM3_9APHY/56-145     AC A0A165GVM3.1
#=GS A0A226EJ17_FOLCA/526-620    AC A0A226EJ17.1
#=GS A0A0G2FEG5_9PEZI/21-108     AC A0A0G2FEG5.1
#=GS A0DCV4_PARTE/34-121         AC A0DCV4.1
#=GS E5SD97_TRISP/54-144         AC E5SD97.1
#=GS L0PHG7_PNEJ8/192-270        AC L0PHG7.1
#=GS Q2RAW0_ORYSJ/234-319        AC Q2RAW0.1
#=GS F6I2S7_VITVI/21-112         AC F6I2S7.1
#=GS A0A0B4IG27_9HYPO/21-108     AC A0A0B4IG27.1
#=GS A0A1B0ANP5_9MUSC/231-310    AC A0A1B0ANP5.1
#=GS S8DIA1_9LAMI/1-52           AC S8DIA1.1
#=GS A0A1V4JRE0_PATFA/231-316    AC A0A1V4JRE0.1
#=GS A0A1J4J3L2_9EUKA/1-75       AC A0A1J4J3L2.1
#=GS G8ZXR8_TORDC/20-105         AC G8ZXR8.1
#=GS A0A067NM16_PLEOS/229-310    AC A0A067NM16.1
#=GS A0A059F175_9MICR/9-94       AC A0A059F175.1
#=GS A0A1M2V2Y2_TRAPU/17-110     AC A0A1M2V2Y2.1
#=GS A0A024GL08_9STRA/420-510    AC A0A024GL08.1
#=GS A0A177UG12_9BASI/17-111     AC A0A177UG12.1
#=GS G8F495_MACFA/1-89           AC G8F495.1
#=GS B6K7X3_SCHJY/229-310        AC B6K7X3.1
#=GS A0A094CIH1_9PEZI/54-141     AC A0A094CIH1.1
#=GS A0A0R3X8C1_HYDTA/22-85      AC A0A0R3X8C1.1
#=GS E2A1L0_CAMFO/22-112         AC E2A1L0.1
#=GS A0A0D9SB36_CHLSB/22-113     AC A0A0D9SB36.1
#=GS M0S0G8_MUSAM/22-114         AC M0S0G8.1
#=GS A0A1A9YSG0_GLOFF/22-109     AC A0A1A9YSG0.1
#=GS A2DI06_TRIVA/17-103         AC A2DI06.1
#=GS B8C818_THAPS/27-114         AC B8C818.1
#=GS D8LXI8_BLAHO/1-64           AC D8LXI8.1
#=GS G0W7P6_NAUDC/17-110         AC G0W7P6.1
#=GS A0A1Y2B2M4_9TREE/17-113     AC A0A1Y2B2M4.1
#=GS A0A166DJ68_DAUCA/17-112     AC A0A166DJ68.1
#=GS H2UUC0_TAKRU/231-313        AC H2UUC0.1
#=GS U7Q1K0_SPOS1/21-109         AC U7Q1K0.1
#=GS A0A2G5VL84_9PELO/17-107     AC A0A2G5VL84.1
#=GS S7NBP8_MYOBR/23-113         AC S7NBP8.1
#=GS S7ZG64_PENO1/21-108         AC S7ZG64.1
#=GS A0A1G4ANV7_9PEZI/21-108     AC A0A1G4ANV7.1
#=GS A0A1G8V0B5_9EURY/16-111     AC A0A1G8V0B5.1
#=GS A0A098VQZ2_9MICR/228-307    AC A0A098VQZ2.1
#=GS E0VFW6_PEDHC/231-320        AC E0VFW6.1
#=GS A0A0P1AWW6_9STRA/379-467    AC A0A0P1AWW6.1
#=GS A0A1J7GQG6_LUPAN/17-113     AC A0A1J7GQG6.1
#=GS A0A1U7EYL6_NATPD/16-115     AC A0A1U7EYL6.1
#=GS A0A0A0KM27_CUCSA/234-319    AC A0A0A0KM27.1
#=GS E6ZPA3_SPORE/17-110         AC E6ZPA3.1
#=GS G5BH66_HETGA/159-244        AC G5BH66.1
#=GS A0A256Y5H8_9ARCH/16-107     AC A0A256Y5H8.1
#=GS A5E756_LODEL/229-313        AC A5E756.1
#=GS A0A176VN31_MARPO/21-109     AC A0A176VN31.1
#=GS G1SC28_NOMLE/17-114         AC G1SC28.1
#=GS A1BQ85_STRRB/231-312        AC A1BQ85.1
#=GS A0A1S9DM63_ASPOZ/229-312    AC A0A1S9DM63.1
#=GS A0A135LYP5_PENPA/17-108     AC A0A135LYP5.1
#=GS I7CZH9_NATSJ/16-114         AC I7CZH9.1
#=GS E7KFW3_YEASA/229-311        AC E7KFW3.1
#=GS A0A074Z284_9PEZI/21-107     AC A0A074Z284.1
#=GS A0A091JE59_EGRGA/205-291    AC A0A091JE59.1
#=GS A0A0E0G7N6_ORYNI/535-630    AC A0A0E0G7N6.1
#=GS A0A182U5N4_9DIPT/231-313    AC A0A182U5N4.2
#=GS A0A1Y1ZSD9_9FUNG/28-119     AC A0A1Y1ZSD9.1
#=GS I2FMZ5_USTH4/17-110         AC I2FMZ5.1
#=GS K0IF01_NITGG/16-103         AC K0IF01.1
#=GS A0A1B7NS26_9EURO/21-110     AC A0A1B7NS26.1
#=GS A0A1S8VQ04_9FUNG/231-316    AC A0A1S8VQ04.1
#=GS G0N3U9_CAEBE/22-110         AC G0N3U9.1
#=GS U1Q0N4_9EURY/1-91           AC U1Q0N4.1
#=GS I1C561_RHIO9/17-107         AC I1C561.1
#=GS A0A1V6RLF6_9EURO/229-310    AC A0A1V6RLF6.1
#=GS A0A166VKM2_9HYPO/229-312    AC A0A166VKM2.1
#=GS W2TJN6_NECAM/227-317        AC W2TJN6.1
#=GS A0A0D9WTS8_9ORYZ/51-119     AC A0A0D9WTS8.1
#=GS C5FTI4_ARTOC/229-311        AC C5FTI4.1
#=GS F9VP34_SULTO/16-104         AC F9VP34.1
#=GS A0A059IXM0_9EURO/17-112     AC A0A059IXM0.1
#=GS F7B587_CIOIN/43-107         AC F7B587.2
#=GS H2Q2V8_PANTR/17-114         AC H2Q2V8.1
#=GS A0A183RP87_9TREM/231-317    AC A0A183RP87.1
#=GS A0A1G4JLZ5_9SACH/19-105     AC A0A1G4JLZ5.1
#=GS A0A0D3HR31_9ORYZ/795-880    AC A0A0D3HR31.1
#=GS A0A1D2X437_9EURY/16-98      AC A0A1D2X437.1
#=GS A0A090LCS1_STRRB/22-110     AC A0A090LCS1.1
#=GS A0A094BPA1_9PEZI/66-153     AC A0A094BPA1.1
#=GS U6NPL0_HAECO/40-134         AC U6NPL0.1
#=GS M1WH55_CLAP2/21-108         AC M1WH55.1
#=GS A0A1L1RTS8_CHICK/17-87      AC A0A1L1RTS8.1
#=GS U6MLN7_9EIME/32-121         AC U6MLN7.1
#=GS A0A091PTH3_LEPDC/17-58      AC A0A091PTH3.1
#=GS A0A1I4SPW6_9EURY/16-100     AC A0A1I4SPW6.1
#=GS M0TT39_MUSAM/39-122         AC M0TT39.1
#=GS W4HAU7_9STRA/16-106         AC W4HAU7.1
#=GS A0A1Z5SV74_HORWE/21-110     AC A0A1Z5SV74.1
#=GS A0A256YNK3_9ARCH/16-96      AC A0A256YNK3.1
#=GS A0A183SB89_SCHSO/25-95      AC A0A183SB89.1
#=GS D8TVT6_VOLCA/17-105         AC D8TVT6.1
#=GS V7BVP3_PHAVU/17-111         AC V7BVP3.1
#=GS A0A182EIH0_ONCOC/1-85       AC A0A182EIH0.1
#=GS A0A0A7LDB7_9EURY/231-336    AC A0A0A7LDB7.1
#=GS A0A067TBL1_GALM3/17-130     AC A0A067TBL1.1
#=GS I2K068_DEKBR/17-108         AC I2K068.1
#=GS U6KE79_9EIME/32-123         AC U6KE79.1
#=GS A0A0R3PUL8_ANGCS/170-261    AC A0A0R3PUL8.1
#=GS A0A0J0XYL4_9TREE/229-312    AC A0A0J0XYL4.1
#=GS A0A1F5LKH8_9EURO/17-108     AC A0A1F5LKH8.1
#=GS I3KBJ9_ORENI/17-113         AC I3KBJ9.1
#=GS S2JH09_MUCC1/17-106         AC S2JH09.1
#=GS A0A1U8P2M3_GOSHI/22-113     AC A0A1U8P2M3.1
#=GS A0A1V6SCH3_9EURO/229-312    AC A0A1V6SCH3.1
#=GS A0A1S3VST7_VIGRR/234-319    AC A0A1S3VST7.1
#=GS A0A0L0HTW5_SPIPN/17-110     AC A0A0L0HTW5.1
#=GS A0A183GEM7_HELBK/43-115     AC A0A183GEM7.1
#=GS G2Q8N2_MYCTT/21-110         AC G2Q8N2.1
#=GS A0A1Z5JYP7_FISSO/33-120     AC A0A1Z5JYP7.1
#=GS A0A2I4GQ36_9ROSI/133-219    AC A0A2I4GQ36.1
#=GS A0A2A4IY56_HELVI/17-111     AC A0A2A4IY56.1
#=GS F7FX28_MACMU/22-113         AC F7FX28.1
#=GS A0A0D2MCW1_9AGAR/27-116     AC A0A0D2MCW1.1
#=GS X0D2L5_FUSOX/21-108         AC X0D2L5.1
#=GS A0A1B9GN79_9TREE/17-112     AC A0A1B9GN79.1
#=GS A0A2G2W8Q0_CAPBA/21-111     AC A0A2G2W8Q0.1
#=GS B4LTL2_DROVI/22-111         AC B4LTL2.1
#=GS A0A1Z5R3Y1_SORBI/25-119     AC A0A1Z5R3Y1.1
#=GS A0A084VRD1_ANOSI/17-112     AC A0A084VRD1.1
#=GS A0A183BGJ4_9TREM/17-114     AC A0A183BGJ4.1
#=GS G3ILE6_CRIGR/22-107         AC G3ILE6.1
#=GS A0A1C1XN00_9PEZI/229-303    AC A0A1C1XN00.1
#=GS A0A0M3QVW7_DROBS/231-318    AC A0A0M3QVW7.1
#=GS A2BJV6_HYPBU/34-125         AC A2BJV6.1
#=GS A0A0D8XQZ1_DICVI/3-87       AC A0A0D8XQZ1.1
#=GS A0A1Q9N0D1_9ARCH/7-93       AC A0A1Q9N0D1.1
#=GS A0A1E3NPS2_9ASCO/229-311    AC A0A1E3NPS2.1
#=GS RL12_ARCFU/16-105           AC O28780.1
#=GS A0A0G4EUV7_VITBC/32-126     AC A0A0G4EUV7.1
#=GS A0A286ZZ68_PIG/23-87        AC A0A286ZZ68.1
#=GS A0A182RNQ1_ANOFN/17-111     AC A0A182RNQ1.1
#=GS R0EU65_9BRAS/22-112         AC R0EU65.1
#=GS A8XGJ1_CAEBR/17-107         AC A8XGJ1.1
#=GS M1VBF0_CYAM1/17-116         AC M1VBF0.1
#=GS A0A0L0VRN3_9BASI/19-106     AC A0A0L0VRN3.1
#=GS E4Y051_OIKDI/232-310        AC E4Y051.1
#=GS U6LJP1_9EIME/49-140         AC U6LJP1.1
#=GS A0A0H5CK00_CYBJA/229-311    AC A0A0H5CK00.1
#=GS K4B4F0_SOLLC/5-73           AC K4B4F0.1
#=GS A0A2I4F7S8_9ROSI/17-95      AC A0A2I4F7S8.1
#=GS A0A087H441_ARAAL/234-317    AC A0A087H441.1
#=GS A0A0F8B892_CERFI/229-311    AC A0A0F8B892.1
#=GS A0A094DC69_9PEZI/66-153     AC A0A094DC69.1
#=GS W2LIJ2_PHYPR/17-107         AC W2LIJ2.1
#=GS K0KQI6_WICCF/20-107         AC K0KQI6.1
#=GS E4X7T3_OIKDI/17-108         AC E4X7T3.1
#=GS A0A0A0KGP6_CUCSA/17-114     AC A0A0A0KGP6.1
#=GS L8FQZ3_PSED2/17-108         AC L8FQZ3.1
#=GS W4IUC6_PLAFP/231-315        AC W4IUC6.1
#=GS A0A132AE91_SARSC/63-106     AC A0A132AE91.1
#=GS L5MAJ1_MYODS/22-83          AC L5MAJ1.1
#=GS M1AS83_SOLTU/17-111         AC M1AS83.1
#=GS I0YL12_COCSC/40-118         AC I0YL12.1
#=GS A0A1I7UJ03_9PELO/22-110     AC A0A1I7UJ03.1
#=GS A0A1Q3ATX3_CEPFO/17-116     AC A0A1Q3ATX3.1
#=GS A0A0C3NRG8_PHLGI/21-109     AC A0A0C3NRG8.1
#=GS B6U9H1_MAIZE/88-171         AC B6U9H1.1
#=GS K3WA32_PYTUL/17-106         AC K3WA32.1
#=GS A0A0A1TIA0_9HYPO/17-109     AC A0A0A1TIA0.1
#=GS A0A1X1BI63_9APIC/231-310    AC A0A1X1BI63.1
#=GS A0A0D9NSQ2_METAN/17-109     AC A0A0D9NSQ2.1
#=GS K3Y023_SETIT/59-119         AC K3Y023.1
#=GS A0A0E0ADY9_9ORYZ/57-118     AC A0A0E0ADY9.1
#=GS W1P0E4_AMBTC/21-112         AC W1P0E4.1
#=GS S8D2Z2_9LAMI/19-120         AC S8D2Z2.1
#=GS A0A2C6A941_9HYPO/229-312    AC A0A2C6A941.1
#=GS B4ICW8_DROSE/22-111         AC B4ICW8.1
#=GS R7YQN4_CONA1/250-335        AC R7YQN4.1
#=GS A8MQK8_ARATH/22-95          AC A8MQK8.1
#=GS K7IQV7_NASVI/231-315        AC K7IQV7.1
#=GS A0A1S4BZQ0_TOBAC/234-321    AC A0A1S4BZQ0.1
#=GS A0A0M3I031_ASCLU/231-318    AC A0A0M3I031.1
#=GS A0A1Y2GEW6_9FUNG/17-108     AC A0A1Y2GEW6.1
#=GS K0KRG8_WICCF/229-311        AC K0KRG8.1
#=GS A0A1U7SB06_ALLSI/17-114     AC A0A1U7SB06.1
#=GS D8LYJ5_BLAHO/230-312        AC D8LYJ5.1
#=GS N6WJT7_9EURY/16-107         AC N6WJT7.1
#=GS A0A1V6NSY4_9EURO/17-107     AC A0A1V6NSY4.1
#=GS K4CC52_SOLLC/34-118         AC K4CC52.1
#=GS A0A164RK41_9HOMO/21-112     AC A0A164RK41.1
#=GS A0A1Y1ZB16_9FUNG/17-108     AC A0A1Y1ZB16.1
#=GS G9P7V9_HYPAI/229-312        AC G9P7V9.1
#=GS A0A1J9R3B3_9PEZI/56-143     AC A0A1J9R3B3.1
#=GS A0A2G2X7U2_CAPBA/21-109     AC A0A2G2X7U2.1
#=GS A0A2G3BY02_CAPCH/17-114     AC A0A2G3BY02.1
#=GS A0A1Q9CEK3_SYMMI/542-625    AC A0A1Q9CEK3.1
#=GS F0ZYT9_DICPU/317-405        AC F0ZYT9.1
#=GS A0A0F4X930_HANUV/16-104     AC A0A0F4X930.1
#=GS A0A091NRI7_APAVI/17-114     AC A0A091NRI7.1
#=GS A0A167JMG3_PHYB8/20-105     AC A0A167JMG3.1
#=GS RL12_HALSA/16-113           AC P05768.1
#=GS A0A2H3ZCW3_PHODC/21-111     AC A0A2H3ZCW3.1
#=GS A0A166E125_9HOMO/229-313    AC A0A166E125.1
#=GS A0A0K3C9A2_RHOTO/229-298    AC A0A0K3C9A2.1
#=GS A0A0W0FZB5_9AGAR/17-112     AC A0A0W0FZB5.1
#=GS A0A225X3C5_9STRA/29-111     AC A0A225X3C5.1
#=GS F7HF08_CALJA/21-100         AC F7HF08.1
#=GS A2FPV1_TRIVA/17-104         AC A2FPV1.1
#=GS A0A151R1T8_CAJCA/23-119     AC A0A151R1T8.1
#=GS A0A1Z5SS47_HORWE/83-172     AC A0A1Z5SS47.1
#=GS A0A1S3C6N6_CUCME/234-319    AC A0A1S3C6N6.1
#=GS H8ZE01_NEMS1/54-137         AC H8ZE01.1
#=GS B0XBM1_CULQU/64-135         AC B0XBM1.1
#=GS H0V6G7_CAVPO/17-114         AC H0V6G7.1
#=GS A0A1S3IUH7_LINUN/17-112     AC A0A1S3IUH7.1
#=GS A0A1E3Q8R5_LIPST/19-105     AC A0A1E3Q8R5.1
#=GS D9Q016_ACIS3/21-112         AC D9Q016.1
#=GS A0A0D2IPJ3_9EURO/21-113     AC A0A0D2IPJ3.1
#=GS A0A063ZSC1_9EURY/16-114     AC A0A063ZSC1.1
#=GS A0A163KTI0_DIDRA/17-111     AC A0A163KTI0.1
#=GS H0V2W3_CAVPO/22-113         AC H0V2W3.1
#=GS A0A2H3EYY2_9HELO/229-312    AC A0A2H3EYY2.1
#=GS A0A1B8B9G7_FUSPO/21-108     AC A0A1B8B9G7.1
#=GS D1Z0C5_METPS/12-102         AC D1Z0C5.1
#=GS K4AUI0_SOLLC/1-50           AC K4AUI0.1
#=GS A0A0C3FIH5_9HOMO/229-312    AC A0A0C3FIH5.1
#=GS A0A058ZEL2_9EUKA/20-105     AC A0A058ZEL2.1
#=GS Q4RIG8_TETNG/17-114         AC Q4RIG8.1
#=GS A0A286UJ81_9HOMO/17-109     AC A0A286UJ81.1
#=GS H2YYU3_CIOSA/171-248        AC H2YYU3.1
#=GS A0A0N4V6B8_ENTVE/249-333    AC A0A0N4V6B8.1
#=GS A0A078H2W0_BRANA/17-113     AC A0A078H2W0.1
#=GS D7L9V8_ARALL/233-320        AC D7L9V8.1
#=GS A9SXV6_PHYPA/21-109         AC A9SXV6.1
#=GS K9FKX6_PEND2/21-106         AC K9FKX6.1
#=GS A0A1R3HI83_9ROSI/17-114     AC A0A1R3HI83.1
#=GS A0A251RU43_HELAN/233-317    AC A0A251RU43.1
#=GS G3R5E5_GORGO/17-114         AC G3R5E5.1
#=GS K0KHG3_WICCF/19-105         AC K0KHG3.1
#=GS G7XPB2_ASPKW/229-311        AC G7XPB2.1
#=GS A9P9N6_POPTR/21-109         AC A9P9N6.1
#=GS A0A067EC78_CITSI/20-107     AC A0A067EC78.1
#=GS W2S4K1_9EURO/229-315        AC W2S4K1.1
#=GS A0A0E3L5S7_9EURY/16-104     AC A0A0E3L5S7.1
#=GS A0A183LU12_9TREM/231-310    AC A0A183LU12.1
#=GS A0A1V6SLD5_9EURO/229-311    AC A0A1V6SLD5.1
#=GS F0UE72_AJEC8/17-110         AC F0UE72.1
#=GS A0A225AE68_9EURO/21-109     AC A0A225AE68.1
#=GS S9V7D6_9TRYP/21-107         AC S9V7D6.1
#=GS A0A2I3H6T9_NOMLE/195-264    AC A0A2I3H6T9.1
#=GS Q4E3A4_TRYCC/238-323        AC Q4E3A4.1
#=GS A0A0N4WCN0_HAEPC/231-313    AC A0A0N4WCN0.1
#=GS A0A072P935_9EURO/21-112     AC A0A072P935.1
#=GS I1I2F8_BRADI/237-321        AC I1I2F8.1
#=GS A0A024WQ46_PLAFA/231-315    AC A0A024WQ46.1
#=GS A0A0E0KG80_ORYPU/159-239    AC A0A0E0KG80.1
#=GS M0S9B9_MUSAM/203-287        AC M0S9B9.1
#=GS A0A200PZI0_9MAGN/2-94       AC A0A200PZI0.1
#=GS B4QI10_DROSI/17-112         AC B4QI10.1
#=GS A0A1R2B4C1_9CILI/17-111     AC A0A1R2B4C1.1
#=GS A0A093RM18_PYGAD/210-293    AC A0A093RM18.1
#=GS A0A0D2PJU5_GOSRA/22-113     AC A0A0D2PJU5.1
#=GS A0A0M0BMC9_9ARCH/16-101     AC A0A0M0BMC9.1
#=GS A0A0P5Z754_9CRUS/231-317    AC A0A0P5Z754.1
#=GS H3CUW7_TETNG/22-110         AC H3CUW7.1
#=GS A0A2B4S384_STYPI/17-114     AC A0A2B4S384.1
#=GS A0A0L0H618_SPIPN/25-112     AC A0A0L0H618.1
#=GS A1D3U2_NEOFI/21-109         AC A1D3U2.1
#=GS A0A1U7T6G5_TARSY/64-124     AC A0A1U7T6G5.1
#=GS N1PML4_DOTSN/229-314        AC N1PML4.1
#=GS M1C6Y7_SOLTU/21-111         AC M1C6Y7.1
#=GS F7HV79_CALJA/22-113         AC F7HV79.1
#=GS A0A098VSC5_9MICR/22-111     AC A0A098VSC5.1
#=GS A0A1X2IS40_9FUNG/20-105     AC A0A1X2IS40.1
#=GS A9RV72_PHYPA/17-113         AC A9RV72.1
#=GS A0A059C2A0_EUCGR/96-184     AC A0A059C2A0.1
#=GS A0A0L6U6V8_9BASI/253-335    AC A0A0L6U6V8.1
#=GS A0A1V8USC0_9PEZI/21-111     AC A0A1V8USC0.1
#=GS A0A1J4V229_9ARCH/16-96      AC A0A1J4V229.1
#=GS A0A0B2RPH2_GLYSO/234-320    AC A0A0B2RPH2.1
#=GS F6D3L6_METPW/16-100         AC F6D3L6.1
#=GS A0A2I4HWL0_9ROSI/34-120     AC A0A2I4HWL0.1
#=GS RLA1_MAIZE/21-108           AC P52855.1
#=GS A0A1U7W5D9_NICSY/34-120     AC A0A1U7W5D9.1
#=GS A0A2G9HZH6_9LAMI/21-112     AC A0A2G9HZH6.1
#=GS A0A0F4XAY2_HANUV/20-105     AC A0A0F4XAY2.1
#=GS A0A1B9IGU8_9TREE/39-127     AC A0A1B9IGU8.1
#=GS V4L5J2_EUTSA/17-111         AC V4L5J2.1
#=GS B5DH20_SALSA/22-110         AC B5DH20.1
#=GS G1TXW0_RABIT/17-88          AC G1TXW0.1
#=GS A0A0C2YHB7_HEBCY/229-310    AC A0A0C2YHB7.1
#=GS A0A1R2C0Q4_9CILI/32-116     AC A0A1R2C0Q4.1
#=GS A0A0D2QPN4_GOSRA/17-113     AC A0A0D2QPN4.1
#=GS M9SEY1_METAX/9-95           AC M9SEY1.1
#=GS A0A1U7WXR3_NICSY/17-110     AC A0A1U7WXR3.1
#=GS A0A0W4ZX23_PNEMU/17-105     AC A0A0W4ZX23.1
#=GS A0A182IEB6_ANOAR/23-112     AC A0A182IEB6.1
#=GS A0A0L7KHB6_PLAFX/32-117     AC A0A0L7KHB6.1
#=GS F7FZP0_MONDO/22-115         AC F7FZP0.1
#=GS A0A150UR69_9PEZI/229-315    AC A0A150UR69.1
#=GS G5ATB4_HETGA/6-101          AC G5ATB4.1
#=GS A0A200Q6A6_9MAGN/17-115     AC A0A200Q6A6.1
#=GS A0A094G164_9PEZI/69-156     AC A0A094G164.1
#=GS A0A1V6V7G4_9EURO/21-107     AC A0A1V6V7G4.1
#=GS A0A0L0HT86_SPIPN/23-109     AC A0A0L0HT86.1
#=GS A0A1X1BPC4_9APIC/19-110     AC A0A1X1BPC4.1
#=GS A0A0C2D1V7_9BILA/521-609    AC A0A0C2D1V7.1
#=GS A0A1D6PWJ9_MAIZE/11-94      AC A0A1D6PWJ9.1
#=GS A0A2G2XWM0_CAPAN/21-94      AC A0A2G2XWM0.1
#=GS B9IDH5_POPTR/21-109         AC B9IDH5.2
#=GS A0A2H3DDC1_ARMGA/590-678    AC A0A2H3DDC1.1
#=GS A0A1E4S983_CYBJA/19-104     AC A0A1E4S983.1
#=GS A0A1B1DZ51_9APIC/231-314    AC A0A1B1DZ51.1
#=GS A0A1U7W541_NICSY/22-113     AC A0A1U7W541.1
#=GS S9XUS4_CAMFR/126-205        AC S9XUS4.1
#=GS A0A024V6Q5_PLAFA/32-117     AC A0A024V6Q5.1
#=GS E2RJA8_CANLF/17-103         AC E2RJA8.1
#=GS A0A0U3E822_9CREN/16-105     AC A0A0U3E822.1
#=GS A0A0L0D452_THETB/21-104     AC A0A0L0D452.1
#=GS A0A0D7A1T2_9AGAR/21-110     AC A0A0D7A1T2.1
#=GS A0A1S3Y124_TOBAC/17-112     AC A0A1S3Y124.1
#=GS A0A1A9UP79_GLOAU/231-310    AC A0A1A9UP79.2
#=GS B4IXN3_DROGR/231-317        AC B4IXN3.1
#=GS A0A1C7NMK8_9FUNG/228-308    AC A0A1C7NMK8.1
#=GS A0A0L6VF94_9BASI/17-112     AC A0A0L6VF94.1
#=GS A0A0E0Q688_ORYRU/17-107     AC A0A0E0Q688.1
#=GS Q6FTP0_CANGA/229-310        AC Q6FTP0.1
#=GS D8LVH9_BLAHO/7-98           AC D8LVH9.1
#=GS D7LSI9_ARALL/22-110         AC D7LSI9.1
#=GS M4YMN1_THEXX/230-333        AC M4YMN1.1
#=GS J4H2Y0_9APHY/35-123         AC J4H2Y0.1
#=GS W5MLX5_LEPOC/22-111         AC W5MLX5.1
#=GS Q4QFE2_LEIMA/20-107         AC Q4QFE2.1
#=GS J3MPV4_ORYBR/21-109         AC J3MPV4.1
#=GS F9WF02_TRYCI/70-158         AC F9WF02.1
#=GS G1TP77_RABIT/207-282        AC G1TP77.1
#=GS A0A087GV40_ARAAL/17-112     AC A0A087GV40.1
#=GS A0A0F7ZQ65_9HYPO/229-312    AC A0A0F7ZQ65.1
#=GS B8NB77_ASPFN/17-108         AC B8NB77.1
#=GS C1EEH7_MICCC/17-106         AC C1EEH7.1
#=GS R9AGY5_WALI9/20-104         AC R9AGY5.1
#=GS B5XCI0_SALSA/17-113         AC B5XCI0.1
#=GS A0A0C3B442_9HOMO/21-114     AC A0A0C3B442.1
#=GS S9V7H5_9TRYP/238-326        AC S9V7H5.1
#=GS A0A1D5P016_CHICK/17-61      AC A0A1D5P016.1
#=GS B0DZY2_LACBS/21-110         AC B0DZY2.1
#=GS A0A0W1SMB8_9EURY/16-108     AC A0A0W1SMB8.1
#=GS A0A0N4UCC8_DRAME/231-316    AC A0A0N4UCC8.1
#=GS I1QGW9_ORYGL/66-161         AC I1QGW9.1
#=GS A0A0L0DD06_THETB/234-318    AC A0A0L0DD06.1
#=GS A0A195FVY1_9HYME/22-109     AC A0A195FVY1.1
#=GS A0A1J4MDV8_9CRYT/19-112     AC A0A1J4MDV8.1
#=GS G4YJT9_PHYSP/231-311        AC G4YJT9.1
#=GS A0A1Z5SYM6_HORWE/17-111     AC A0A1Z5SYM6.1
#=GS A0A0D3B910_BRAOL/22-112     AC A0A0D3B910.1
#=GS A0A1D5QZ72_MACMU/231-315    AC A0A1D5QZ72.1
#=GS A0A2A9MCC8_9APIC/19-111     AC A0A2A9MCC8.1
#=GS A0A2K5HZR4_COLAP/230-310    AC A0A2K5HZR4.1
#=GS U4UHM3_DENPD/231-317        AC U4UHM3.1
#=GS A0A1B7MTV8_9HOMO/229-312    AC A0A1B7MTV8.1
#=GS R0KAF4_SETT2/17-112         AC R0KAF4.1
#=GS A0A2A9M4E3_9APIC/32-117     AC A0A2A9M4E3.1
#=GS R9ADY9_WALI9/229-309        AC R9ADY9.1
#=GS A0A2A5QVH7_9EURY/16-115     AC A0A2A5QVH7.1
#=GS C6HL32_AJECH/17-110         AC C6HL32.1
#=GS A0A0P8A3C1_9EURY/16-103     AC A0A0P8A3C1.1
#=GS B0XA03_CULQU/2-78           AC B0XA03.1
#=GS A0A022QCQ2_ERYGU/7-121      AC A0A022QCQ2.1
#=GS A0A1E3IMS7_9TREE/24-111     AC A0A1E3IMS7.1
#=GS Q4UGN6_THEAN/231-308        AC Q4UGN6.1
#=GS A0A0W0G2B2_9AGAR/84-173     AC A0A0W0G2B2.1
#=GS A0A024VK18_PLAFA/231-315    AC A0A024VK18.1
#=GS W7LZJ0_GIBM7/21-108         AC W7LZJ0.1
#=GS C4JIF9_UNCRE/17-110         AC C4JIF9.1
#=GS Q18G92_HALWD/16-113         AC Q18G92.1
#=GS A0A0W7VFH5_9HYPO/17-109     AC A0A0W7VFH5.1
#=GS A0A151TYE0_CAJCA/21-111     AC A0A151TYE0.1
#=GS A0A1B9GXS2_9TREE/229-313    AC A0A1B9GXS2.1
#=GS RLA5_SCHPO/21-108           AC Q9UU78.1
#=GS A0A1D2R131_9EURY/16-98      AC A0A1D2R131.1
#=GS M7BGH9_CHEMY/41-136         AC M7BGH9.1
#=GS A0A287B1B8_PIG/22-91        AC A0A287B1B8.1
#=GS A0A2I3SN62_PANTR/22-106     AC A0A2I3SN62.1
#=GS W5QBE7_SHEEP/22-113         AC W5QBE7.1
#=GS A0A0E0AQ57_9ORYZ/21-109     AC A0A0E0AQ57.1
#=GS A0A0K0FW12_9BILA/231-313    AC A0A0K0FW12.1
#=GS A0A0K0IYX6_BRUMA/231-319    AC A0A0K0IYX6.1
#=GS A0A0M9FSD6_9TRYP/18-111     AC A0A0M9FSD6.1
#=GS G3QMD7_GORGO/22-106         AC G3QMD7.2
#=GS A0A147JRN3_9EURY/16-98      AC A0A147JRN3.1
#=GS A0A197KAR2_9FUNG/17-108     AC A0A197KAR2.1
#=GS A0A1D1VVY6_RAMVA/17-115     AC A0A1D1VVY6.1
#=GS A0A177AWT0_9METZ/236-314    AC A0A177AWT0.1
#=GS Q16X79_AEDAE/19-98          AC Q16X79.1
#=GS H2YYU2_CIOSA/231-308        AC H2YYU2.1
#=GS M1C5E6_SOLTU/234-319        AC M1C5E6.1
#=GS A0A151XCU5_9HYME/17-113     AC A0A151XCU5.1
#=GS A0A0C9LUF4_9FUNG/55-134     AC A0A0C9LUF4.1
#=GS F7EEP2_MACMU/17-114         AC F7EEP2.1
#=GS G3B7H6_CANTC/20-106         AC G3B7H6.1
#=GS Q1HRP7_AEDAE/23-111         AC Q1HRP7.1
#=GS A0A0L1KUE0_9EUGL/20-101     AC A0A0L1KUE0.1
#=GS K5WCW6_PHACS/61-152         AC K5WCW6.1
#=GS A0A2I2U2T0_FELCA/17-92      AC A0A2I2U2T0.1
#=GS A0A287XBP0_HORVV/107-201    AC A0A287XBP0.1
#=GS X0JUQ2_FUSOX/17-109         AC X0JUQ2.1
#=GS N1JE38_BLUG1/230-313        AC N1JE38.1
#=GS E2BUN1_HARSA/17-105         AC E2BUN1.1
#=GS A0A0A1P3G4_9FUNG/20-106     AC A0A0A1P3G4.1
#=GS Q28IH1_XENTR/17-114         AC Q28IH1.1
#=GS H0XX20_OTOGA/17-114         AC H0XX20.1
#=GS A0A1V8SJT8_9PEZI/229-312    AC A0A1V8SJT8.1
#=GS A0A168J6P8_CORDF/17-109     AC A0A168J6P8.1
#=GS D8J2Z0_HALJB/16-112         AC D8J2Z0.1
#=GS W9IYL8_FUSOX/229-312        AC W9IYL8.1
#=GS A0A2H3FWM1_9HELO/19-113     AC A0A2H3FWM1.1
#=GS E7Q2E9_YEASB/17-109         AC E7Q2E9.1
#=GS T5AEQ2_OPHSC/17-93          AC T5AEQ2.1
#=GS A2ZB54_ORYSI/234-319        AC A2ZB54.1
#=GS A0A0D9QT08_PLAFR/232-316    AC A0A0D9QT08.1
#=GS A0A1X2IHL1_9FUNG/20-105     AC A0A1X2IHL1.1
#=GS A0A1D2VMG0_9ASCO/19-107     AC A0A1D2VMG0.1
#=GS A0A072UZJ1_MEDTR/15-124     AC A0A072UZJ1.1
#=GS A0A151VTF9_HYPMA/34-126     AC A0A151VTF9.1
#=GS A0A0R3RQL2_9BILA/1-77       AC A0A0R3RQL2.1
#=GS A0A0E0E9N3_9ORYZ/17-108     AC A0A0E0E9N3.1
#=GS A0A0F9WII3_9MICR/16-105     AC A0A0F9WII3.1
#=GS G2PZU8_MYCTT/229-310        AC G2PZU8.1
#=GS A0A1F7ZLE4_9EURO/17-108     AC A0A1F7ZLE4.1
#=GS J9IL70_9SPIT/139-223        AC J9IL70.1
#=GS A0A183DJF5_9BILA/22-64      AC A0A183DJF5.1
#=GS A0A2B7WUI2_9EURO/85-173     AC A0A2B7WUI2.1
#=GS B4G1B3_MAIZE/61-119         AC B4G1B3.1
#=GS T0Q9U0_9STRA/231-313        AC T0Q9U0.1
#=GS Q2GYG9_CHAGB/21-109         AC Q2GYG9.1
#=GS A0A0R3R6H6_9BILA/21-116     AC A0A0R3R6H6.1
#=GS A0A0N5CX80_THECL/48-138     AC A0A0N5CX80.1
#=GS K0BCS3_9ARCH/16-98          AC K0BCS3.1
#=GS R0HVP3_9BRAS/17-113         AC R0HVP3.1
#=GS A0A0C9U4Y9_PAXIN/229-311    AC A0A0C9U4Y9.1
#=GS F1RJQ9_PIG/21-112           AC F1RJQ9.2
#=GS L0HCF4_METFS/9-101          AC L0HCF4.1
#=GS A0A0D3GP76_9ORYZ/10-102     AC A0A0D3GP76.1
#=GS RLA0_BOVIN/231-317          AC Q95140.3
#=GS A0A182PCX7_9DIPT/23-112     AC A0A182PCX7.1
#=GS A0A078HK83_BRANA/35-120     AC A0A078HK83.1
#=GS W7JMJ7_PLAFA/32-117         AC W7JMJ7.1
#=GS V6U2T0_GIAIN/21-105         AC V6U2T0.1
#=GS RLA2_DROME/17-112           AC P05389.1
#=GS N4VJZ7_COLOR/229-310        AC N4VJZ7.1
#=GS A0A0D1ZPN2_9EURO/21-111     AC A0A0D1ZPN2.1
#=GS A0A1R1X1C3_9FUNG/17-108     AC A0A1R1X1C3.1
#=GS A0A0C9MJ73_9FUNG/17-105     AC A0A0C9MJ73.1
#=GS A0A1V8T1S8_9PEZI/21-111     AC A0A1V8T1S8.1
#=GS M1AUE9_SOLTU/17-110         AC M1AUE9.1
#=GS M0WXK1_HORVV/235-320        AC M0WXK1.1
#=GS A0A015LLK6_9GLOM/231-313    AC A0A015LLK6.1
#=GS A0A2H2IDR4_CAEJA/17-110     AC A0A2H2IDR4.1
#=GS B6AE73_CRYMR/19-108         AC B6AE73.1
#=GS A0A1N6X6Q2_9EURY/16-108     AC A0A1N6X6Q2.1
#=GS A0A091WMN6_NIPNI/17-114     AC A0A091WMN6.1
#=GS A0A1B9GLE1_9TREE/75-164     AC A0A1B9GLE1.1
#=GS A0A177DM66_ALTAL/18-66      AC A0A177DM66.1
#=GS A0A2I4HB20_9ROSI/17-114     AC A0A2I4HB20.1
#=GS N1RLX3_FUSC4/21-108         AC N1RLX3.1
#=GS A0A074YN14_9PEZI/229-312    AC A0A074YN14.1
#=GS S9WDQ7_CAMFR/158-235        AC S9WDQ7.1
#=GS F7W3Y8_SORMK/21-108         AC F7W3Y8.1
#=GS D8M2N0_BLAHO/9-100          AC D8M2N0.1
#=GS A0A177BU15_9PLEO/17-110     AC A0A177BU15.1
#=GS H3E9W4_PRIPA/38-107         AC H3E9W4.1
#=GS A0A1E5RAT4_9ASCO/20-106     AC A0A1E5RAT4.1
#=GS A0A1I8CYK4_9BILA/410-489    AC A0A1I8CYK4.1
#=GS A0A177D8H0_ALTAL/17-112     AC A0A177D8H0.1
#=GS F6ZEU1_MACMU/45-102         AC F6ZEU1.2
#=GS W7I7H3_9PEZI/229-313        AC W7I7H3.1
#=GS C5DG63_LACTC/17-106         AC C5DG63.1
#=GS W9CSE3_9HELO/21-109         AC W9CSE3.1
#=GS R0KPT7_NOSB1/25-106         AC R0KPT7.1
#=GS RLA0_DICDI/227-304          AC P22685.2
#=GS A0A0L6WGI7_9AGAR/17-104     AC A0A0L6WGI7.1
#=GS A0A1E3ICQ3_9TREE/229-310    AC A0A1E3ICQ3.1
#=GS A0A165HN39_9PEZI/17-109     AC A0A165HN39.1
#=GS A0A177WPZ1_BATDE/55-142     AC A0A177WPZ1.1
#=GS A0A0F7TE12_9EURO/229-312    AC A0A0F7TE12.1
#=GS A0A094FXI8_9PEZI/66-153     AC A0A094FXI8.1
#=GS A0A1I0MP63_9EURY/16-112     AC A0A1I0MP63.1
#=GS A0A1X7UQX3_AMPQE/18-116     AC A0A1X7UQX3.1
#=GS A0A1G4JRZ0_9SACH/17-110     AC A0A1G4JRZ0.1
#=GS V9ERE7_PHYPR/29-111         AC V9ERE7.1
#=GS A0A0J8QUZ6_COCIT/17-110     AC A0A0J8QUZ6.1
#=GS A0A1M2YH05_9ARCH/9-99       AC A0A1M2YH05.1
#=GS W6ZFI1_COCMI/229-313        AC W6ZFI1.1
#=GS V7CQS4_PHAVU/25-118         AC V7CQS4.1
#=GS A0A1D5PK69_CHICK/190-268    AC A0A1D5PK69.1
#=GS A0A2C5X2N9_9PEZI/21-107     AC A0A2C5X2N9.1
#=GS A6QZ96_AJECN/6-79           AC A6QZ96.1
#=GS U1NDN5_9EURY/16-113         AC U1NDN5.1
#=GS RLA0_RAT/231-316            AC P19945.2
#=GS A0A132AJ25_SARSC/21-116     AC A0A132AJ25.1
#=GS M7T6W1_EUTLA/17-110         AC M7T6W1.1
#=GS Q29DM5_DROPS/231-316        AC Q29DM5.1
#=GS G7PNP0_MACFA/3-78           AC G7PNP0.1
#=GS A0A0L0HP25_SPIPN/231-310    AC A0A0L0HP25.1
#=GS A0A2H2Z7M8_9HYPO/17-108     AC A0A2H2Z7M8.1
#=GS A0A1E5R5U1_9ASCO/229-312    AC A0A1E5R5U1.1
#=GS A0A200R4P0_9MAGN/234-321    AC A0A200R4P0.1
#=GS A0A167ZBA7_9PEZI/21-108     AC A0A167ZBA7.1
#=GS C9SI72_VERA1/229-312        AC C9SI72.1
#=GS A0A2H3X745_PHODC/17-114     AC A0A2H3X745.1
#=GS A0A197JYN2_9FUNG/20-104     AC A0A197JYN2.1
#=GS A0A2K5KPV0_CERAT/147-233    AC A0A2K5KPV0.1
#=GS A0A0D3DZC1_BRAOL/22-113     AC A0A0D3DZC1.1
#=GS L8X335_THACA/2-62           AC L8X335.1
#=GS G1NJV2_MELGA/22-113         AC G1NJV2.2
#=GS D8PXJ4_SCHCM/21-109         AC D8PXJ4.1
#=GS D8TME7_VOLCA/21-107         AC D8TME7.1
#=GS A0A1S3UMK4_VIGRR/31-118     AC A0A1S3UMK4.1
#=GS A0A1A6HPF2_NEOLE/21-66      AC A0A1A6HPF2.1
#=GS W5HPC1_WHEAT/234-318        AC W5HPC1.1
#=GS A0A1U8LXT3_GOSHI/17-112     AC A0A1U8LXT3.1
#=GS A0A1I2RBU1_9EURY/16-110     AC A0A1I2RBU1.1
#=GS A0A0V0SLJ9_9BILA/22-119     AC A0A0V0SLJ9.1
#=GS F2PGW0_TRIEC/17-112         AC F2PGW0.1
#=GS F7CQ43_HORSE/19-108         AC F7CQ43.1
#=GS D8LZP4_BLAHO/9-100          AC D8LZP4.1
#=GS A0A1I8IMU8_9PLAT/231-314    AC A0A1I8IMU8.1
#=GS A0A0K6G3C3_9HOMO/21-110     AC A0A0K6G3C3.1
#=GS Q4D4B8_TRYCC/26-114         AC Q4D4B8.1
#=GS A0A1L9UGJ4_9EURO/21-106     AC A0A1L9UGJ4.1
#=GS W4YJB0_STRPU/25-110         AC W4YJB0.1
#=GS A0A0S7E926_9EURO/229-313    AC A0A0S7E926.1
#=GS A1DGU0_NEOFI/17-110         AC A1DGU0.1
#=GS A0A0L9UT00_PHAAN/268-353    AC A0A0L9UT00.1
#=GS G8ZZG6_TORDC/19-105         AC G8ZZG6.1
#=GS A0A058Z761_9EUKA/16-106     AC A0A058Z761.1
#=GS M4DVB2_BRARP/3-58           AC M4DVB2.1
#=GS A0A0C3S3D4_PHLGI/17-111     AC A0A0C3S3D4.1
#=GS W9XX76_9EURO/229-313        AC W9XX76.1
#=GS M0ZJ60_SOLTU/22-110         AC M0ZJ60.1
#=GS T1FMU8_HELRO/23-115         AC T1FMU8.1
#=GS G1MD53_AILME/174-254        AC G1MD53.1
#=GS A0A0D2TZQ0_GOSRA/17-111     AC A0A0D2TZQ0.1
#=GS A0A139AUK3_GONPR/17-116     AC A0A139AUK3.1
#=GS F4R503_MELLP/12-105         AC F4R503.1
#=GS G3I5T8_CRIGR/21-79          AC G3I5T8.1
#=GS M0RH88_MUSAM/17-115         AC M0RH88.1
#=GS A0A2I4EM61_9ROSI/17-114     AC A0A2I4EM61.1
#=GS R0GM52_9BRAS/17-112         AC R0GM52.1
#=GS M5E8L9_MALS4/21-111         AC M5E8L9.1
#=GS A0A0V0U7G0_9BILA/22-119     AC A0A0V0U7G0.1
#=GS B4HT63_DROSE/17-112         AC B4HT63.1
#=GS A0A0F8VV15_9EURO/17-108     AC A0A0F8VV15.1
#=GS L5KVT7_PTEAL/231-316        AC L5KVT7.1
#=GS A0A1R3JSG7_9ROSI/21-109     AC A0A1R3JSG7.1
#=GS W7THJ8_9STRA/36-130         AC W7THJ8.1
#=GS L0P9H0_PNEJ8/20-104         AC L0P9H0.1
#=GS A0A162ZL98_DIDRA/21-111     AC A0A162ZL98.1
#=GS A0A1V8SV28_9PEZI/21-111     AC A0A1V8SV28.1
#=GS A0A0D2C4U9_9EURO/21-111     AC A0A0D2C4U9.1
#=GS RL10_THEGJ/232-339          AC C5A428.1
#=GS W6Y8M7_COCCA/17-112         AC W6Y8M7.1
#=GS A0A0E0RDD2_ORYRU/233-318    AC A0A0E0RDD2.1
#=GS G0V5M2_NAUCC/229-312        AC G0V5M2.1
#=GS A8N9R6_COPC7/55-149         AC A8N9R6.2
#=GS A0A1S3U9A6_VIGRR/234-319    AC A0A1S3U9A6.1
#=GS A0A197JGX4_9FUNG/228-307    AC A0A197JGX4.1
#=GS A0A0C3P3Y2_PISTI/21-99      AC A0A0C3P3Y2.1
#=GS A0A177T4Z2_9BASI/59-152     AC A0A177T4Z2.1
#=GS A0A1Y1ZMF8_9PLEO/18-111     AC A0A1Y1ZMF8.1
#=GS L5K402_PTEAL/22-113         AC L5K402.1
#=GS A0A1X2IV67_9FUNG/20-105     AC A0A1X2IV67.1
#=GS U6P7C2_HAECO/17-68          AC U6P7C2.1
#=GS A0A0D7ADL2_9AGAR/17-108     AC A0A0D7ADL2.1
#=GS A0A165CXZ6_EXIGL/681-774    AC A0A165CXZ6.1
#=GS A0A086T6U9_ACRC1/21-108     AC A0A086T6U9.1
#=GS A0A218WRP2_PUNGR/21-109     AC A0A218WRP2.1
#=GS V4ME23_EUTSA/130-195        AC V4ME23.1
#=GS A0A1B8DV33_9PEZI/229-311    AC A0A1B8DV33.1
#=GS A0A1E3IPK3_9TREE/17-110     AC A0A1E3IPK3.1
#=GS A0A162MTL1_CORDF/21-107     AC A0A162MTL1.1
#=GS A0A1G4JFZ6_9SACH/20-105     AC A0A1G4JFZ6.1
#=GS A0A0D9X5V0_9ORYZ/17-91      AC A0A0D9X5V0.1
#=GS A0A2C5Y3Y0_9HYPO/17-110     AC A0A2C5Y3Y0.1
#=GS A0A0L9UWG8_PHAAN/234-319    AC A0A0L9UWG8.1
#=GS A0A0E0ASW2_9ORYZ/81-179     AC A0A0E0ASW2.1
#=GS A0A2G9N178_9ARCH/16-100     AC A0A2G9N178.1
#=GS A0A094F184_9PEZI/17-109     AC A0A094F184.1
#=GS A0A200PU80_9MAGN/490-584    AC A0A200PU80.1
#=GS D8M0D4_BLAHO/24-108         AC D8M0D4.1
#=GS A0A1E4T7A2_9ASCO/19-105     AC A0A1E4T7A2.1
#=GS A0A091EZZ7_CORBR/17-114     AC A0A091EZZ7.1
#=GS A0A0L9UMI0_PHAAN/17-112     AC A0A0L9UMI0.1
#=GS A0A0B1PB52_UNCNE/21-110     AC A0A0B1PB52.1
#=GS A0A163HEG0_DIDRA/37-129     AC A0A163HEG0.1
#=GS A0A0N4WCR4_HAEPC/17-95      AC A0A0N4WCR4.1
#=GS A0A016VL35_9BILA/22-113     AC A0A016VL35.1
#=GS A0A1U8PL37_GOSHI/17-113     AC A0A1U8PL37.1
#=GS A0A023B201_GRENI/235-315    AC A0A023B201.1
#=GS A0A1J1ACQ7_9EURY/16-110     AC A0A1J1ACQ7.1
#=GS A0A061FME5_THECC/235-320    AC A0A061FME5.1
#=GS M0TKN6_MUSAM/17-114         AC M0TKN6.1
#=GS C4M649_ENTHI/16-105         AC C4M649.1
#=GS A0A084QFU7_STAC4/17-109     AC A0A084QFU7.1
#=GS A0A182Y4B9_ANOST/17-112     AC A0A182Y4B9.1
#=GS A0A0L0W289_9BASI/229-309    AC A0A0L0W289.1
#=GS A0A2G9G7N5_9LAMI/60-156     AC A0A2G9G7N5.1
#=GS E7QCJ1_YEASZ/20-105         AC E7QCJ1.1
#=GS A0A0E0JG01_ORYPU/61-118     AC A0A0E0JG01.1
#=GS A0A256YF87_9EURY/16-106     AC A0A256YF87.1
#=GS K6UK77_9APIC/231-311        AC K6UK77.1
#=GS A0A088AFV5_APIME/17-113     AC A0A088AFV5.1
#=GS Q57ZQ1_TRYB2/19-106         AC Q57ZQ1.1
#=GS A0A084RM15_STACH/21-109     AC A0A084RM15.1
#=GS A0A183C7I2_GLOPA/17-110     AC A0A183C7I2.1
#=GS B5DGW9_SALSA/17-111         AC B5DGW9.1
#=GS G0VJP0_NAUCC/16-106         AC G0VJP0.1
#=GS A0A1J7I2R1_LUPAN/144-237    AC A0A1J7I2R1.1
#=GS G1TGB1_RABIT/25-107         AC G1TGB1.1
#=GS A0A1Y1YDK7_9FUNG/229-309    AC A0A1Y1YDK7.1
#=GS A0A183JVK6_9TREM/141-227    AC A0A183JVK6.1
#=GS A0A1J4KJI3_9EUKA/17-104     AC A0A1J4KJI3.1
#=GS M4YIX9_THEXX/21-107         AC M4YIX9.1
#=GS A0A1S3AUG9_CUCME/21-112     AC A0A1S3AUG9.1
#=GS B5DS37_DROPS/17-113         AC B5DS37.1
#=GS A0A166JY05_9HOMO/23-111     AC A0A166JY05.1
#=GS A0A1V6NIU9_9EURO/229-311    AC A0A1V6NIU9.1
#=GS W4H7I1_9STRA/231-313        AC W4H7I1.1
#=GS K4CBQ7_SOLLC/17-111         AC K4CBQ7.1
#=GS A0A1B8D439_9PEZI/17-109     AC A0A1B8D439.1
#=GS V4ZTD8_9ARCH/16-116         AC V4ZTD8.1
#=GS A0A0M3JRP9_ANISI/240-325    AC A0A0M3JRP9.1
#=GS A0A1J7IL70_LUPAN/60-148     AC A0A1J7IL70.1
#=GS M4EZ12_BRARP/233-320        AC M4EZ12.1
#=GS V4SDK1_9ROSI/38-120         AC V4SDK1.1
#=GS A0A1A6H7H1_NEOLE/23-112     AC A0A1A6H7H1.1
#=GS K3YLC1_SETIT/34-121         AC K3YLC1.1
#=GS A0A2K5N276_CERAT/191-278    AC A0A2K5N276.1
#=GS U5HHH9_USTV1/17-110         AC U5HHH9.1
#=GS A0A067BQ39_SAPPC/17-107     AC A0A067BQ39.1
#=GS A0A286U9I6_9HOMO/192-275    AC A0A286U9I6.1
#=GS M4ELT2_BRARP/233-320        AC M4ELT2.1
#=GS A0A182F666_ANOAL/23-113     AC A0A182F666.1
#=GS A0A165J9K2_9PEZI/229-310    AC A0A165J9K2.1
#=GS E7LS56_YEASV/20-105         AC E7LS56.1
#=GS B6A9I4_CRYMR/32-116         AC B6A9I4.1
#=GS A0A0A1NCF2_9FUNG/20-106     AC A0A0A1NCF2.1
#=GS A0A1A6HV91_NEOLE/108-184    AC A0A1A6HV91.1
#=GS RLA02_ARATH/233-317         AC Q42112.2
#=GS A0A2A2KUW1_9BILA/22-110     AC A0A2A2KUW1.1
#=GS A0A2A2LN30_9BILA/17-113     AC A0A2A2LN30.1
#=GS S8AHA7_DACHA/17-111         AC S8AHA7.1
#=GS A0A0G4MVT6_9PEZI/21-108     AC A0A0G4MVT6.1
#=GS A0A0C3QLC4_9HOMO/229-310    AC A0A0C3QLC4.1
#=GS J3PCZ0_GAGT3/17-109         AC J3PCZ0.1
#=GS I3RAX8_HALMT/16-96          AC I3RAX8.1
#=GS A0A1Z5KF03_FISSO/18-110     AC A0A1Z5KF03.1
#=GS A0A068RL98_9FUNG/33-119     AC A0A068RL98.1
#=GS A0A1E4SJR3_9ASCO/20-104     AC A0A1E4SJR3.1
#=GS A0A0D3DZT9_BRAOL/22-112     AC A0A0D3DZT9.1
#=GS A0A022Q0G0_ERYGU/125-212    AC A0A022Q0G0.1
#=GS A0A1F5E243_9ARCH/16-100     AC A0A1F5E243.1
#=GS T5ANZ8_OPHSC/21-107         AC T5ANZ8.1
#=GS A0A166V5S3_9HYPO/21-109     AC A0A166V5S3.1
#=GS A0A261AVL4_9PELO/22-110     AC A0A261AVL4.1
#=GS Q5KNI7_CRYNJ/20-108         AC Q5KNI7.1
#=GS A0A1U7UHE4_TARSY/120-210    AC A0A1U7UHE4.1
#=GS A0A060SLG7_PYCCI/17-117     AC A0A060SLG7.1
#=GS A0A166VKV9_9PEZI/21-109     AC A0A166VKV9.1
#=GS A0A1S4C2M6_TOBAC/22-114     AC A0A1S4C2M6.1
#=GS A0A1L9SHQ9_9EURO/17-109     AC A0A1L9SHQ9.1
#=GS A0A1B8EKG9_9PEZI/17-109     AC A0A1B8EKG9.1
#=GS H2VBI8_TAKRU/17-112         AC H2VBI8.1
#=GS A0A2K5NV19_CERAT/17-114     AC A0A2K5NV19.1
#=GS G3HSN7_CRIGR/22-101         AC G3HSN7.1
#=GS F6WUA2_MACMU/169-255        AC F6WUA2.1
#=GS A0A0C2XBA0_AMAMU/21-111     AC A0A0C2XBA0.1
#=GS F6HC03_VITVI/234-319        AC F6HC03.1
#=GS A0A200Q2L6_9MAGN/344-434    AC A0A200Q2L6.1
#=GS A0A182U6L8_9DIPT/23-112     AC A0A182U6L8.2
#=GS R7S9H0_TREMS/229-314        AC R7S9H0.1
#=GS RLA0_DANRE/234-318          AC Q9PV90.1
#=GS G9N846_HYPVG/17-110         AC G9N846.1
#=GS A0A0R3S9M9_HYMDI/17-118     AC A0A0R3S9M9.1
#=GS A0A163J7D7_ABSGL/160-241    AC A0A163J7D7.1
#=GS A4WJ03_PYRAR/16-109         AC A4WJ03.1
#=GS A0A067PQ73_9HOMO/229-313    AC A0A067PQ73.1
#=GS A0A1J4W699_9ARCH/16-98      AC A0A1J4W699.1
#=GS A0A2I3HBT0_NOMLE/22-113     AC A0A2I3HBT0.1
#=GS A0A177CP33_9PLEO/229-314    AC A0A177CP33.1
#=GS U6P946_HAECO/17-111         AC U6P946.1
#=GS A0A0D0AT00_9HOMO/21-110     AC A0A0D0AT00.1
#=GS A0A094NDZ2_9AVES/17-58      AC A0A094NDZ2.1
#=GS RLA0_CAEEL/231-311          AC Q93572.3
#=GS H2AVX1_KAZAF/17-108         AC H2AVX1.1
#=GS M0SKK8_MUSAM/17-113         AC M0SKK8.1
#=GS A0A2E9CFI7_9ARCH/16-105     AC A0A2E9CFI7.1
#=GS G7DUM8_MIXOS/1-63           AC G7DUM8.1
#=GS A0A0K0J056_BRUMA/18-113     AC A0A0K0J056.1
#=GS A0A135LX23_PENPA/229-311    AC A0A135LX23.1
#=GS A0A2G3CAN9_CAPCH/42-127     AC A0A2G3CAN9.1
#=GS H2P7Y2_PONAB/22-113         AC H2P7Y2.1
#=GS V5EYL1_KALBG/17-110         AC V5EYL1.1
#=GS T1PAL0_MUSDO/17-112         AC T1PAL0.1
#=GS A0A1W4VAZ1_DROFC/231-316    AC A0A1W4VAZ1.1
#=GS A0A1E5WK14_9POAL/51-136     AC A0A1E5WK14.1
#=GS A7AQJ6_BABBO/231-311        AC A7AQJ6.1
#=GS Q6GQC6_XENLA/17-114         AC Q6GQC6.1
#=GS A0A1V8UPT0_9PEZI/229-312    AC A0A1V8UPT0.1
#=GS I1HIY0_BRADI/17-112         AC I1HIY0.1
#=GS A0A010Q8L5_9PEZI/17-110     AC A0A010Q8L5.1
#=GS M4EW65_BRARP/17-113         AC M4EW65.1
#=GS A0A1Q9N670_9ARCH/16-104     AC A0A1Q9N670.1
#=GS A0A284R4C0_9AGAR/17-111     AC A0A284R4C0.1
#=GS A0A1Q5T154_9EURO/21-107     AC A0A1Q5T154.1
#=GS A0A183MT24_9TREM/21-113     AC A0A183MT24.1
#=GS A0A1D6LEZ7_MAIZE/11-94      AC A0A1D6LEZ7.1
#=GS A0A1E3PMC4_9ASCO/21-94      AC A0A1E3PMC4.1
#=GS A0A1S3A366_ERIEU/169-254    AC A0A1S3A366.1
#=GS M5BZB3_THACB/21-109         AC M5BZB3.1
#=GS A0A150GT33_GONPE/239-319    AC A0A150GT33.1
#=GS A0A1Y2EXI6_9FUNG/21-104     AC A0A1Y2EXI6.1
#=GS A0A0D0E5B5_9HOMO/17-112     AC A0A0D0E5B5.1
#=GS A0A1W5DCV0_9LECA/21-111     AC A0A1W5DCV0.1
#=GS I1HYI5_BRADI/17-112         AC I1HYI5.1
#=GS W7FEP0_PLAF8/19-111         AC W7FEP0.1
#=GS RLA01_ARATH/234-316         AC O04204.1
#=GS A0A061F117_THECC/17-112     AC A0A061F117.1
#=GS H2NCC4_PONAB/17-114         AC H2NCC4.1
#=GS A0A2K5HIV6_COLAP/18-88      AC A0A2K5HIV6.1
#=GS A0A1S4E0L6_CUCME/21-93      AC A0A1S4E0L6.1
#=GS A0A0E0NFU0_ORYRU/17-112     AC A0A0E0NFU0.1
#=GS A0A200Q499_9MAGN/21-108     AC A0A200Q499.1
#=GS A0A1L9PNC1_ASPVE/21-108     AC A0A1L9PNC1.1
#=GS F9XNW3_ZYMTI/21-109         AC F9XNW3.1
#=GS A0A1U7VHH1_NICSY/21-111     AC A0A1U7VHH1.1
#=GS A0A016SL67_9BILA/17-111     AC A0A016SL67.1
#=GS A0A2A3TAF3_9ARCH/16-98      AC A0A2A3TAF3.1
#=GS A0A1A9YM74_GLOFF/17-112     AC A0A1A9YM74.1
#=GS T1JHI0_STRMM/22-115         AC T1JHI0.1
#=GS K1VNF7_TRIAC/229-311        AC K1VNF7.1
#=GS A0A077YWM4_TRITR/231-314    AC A0A077YWM4.1
#=GS D5E968_METMS/16-102         AC D5E968.1
#=GS A0A0T6AXZ8_9SCAR/22-113     AC A0A0T6AXZ8.1
#=GS A0A165MGL6_9APHY/17-111     AC A0A165MGL6.1
#=GS A0A2G2XDL1_CAPBA/234-319    AC A0A2G2XDL1.1
#=GS A0A0C9WLA7_9AGAR/21-107     AC A0A0C9WLA7.1
#=GS A0A1Y3ARV0_EURMA/17-117     AC A0A1Y3ARV0.1
#=GS A9T572_PHYPA/24-119         AC A9T572.1
#=GS A3BR69_ORYSJ/17-113         AC A3BR69.1
#=GS A0A1Y1UJG7_9TREE/229-314    AC A0A1Y1UJG7.1
#=GS A0A1U8BL53_MESAU/19-87      AC A0A1U8BL53.1
#=GS Q2FQ36_METHJ/16-102         AC Q2FQ36.1
#=GS A0A1B9FZ44_9TREE/229-312    AC A0A1B9FZ44.1
#=GS A0A022Q722_ERYGU/128-201    AC A0A022Q722.1
#=GS F0YML5_AURAN/231-314        AC F0YML5.1
#=GS G8YDF1_PICSO/61-144         AC G8YDF1.1
#=GS Q0CUQ8_ASPTN/229-311        AC Q0CUQ8.1
#=GS A0A072VJD3_MEDTR/21-109     AC A0A072VJD3.1
#=GS A0A0E0Q800_ORYRU/17-106     AC A0A0E0Q800.1
#=GS V4MFC6_EUTSA/17-114         AC V4MFC6.1
#=GS U6LVG6_9EIME/1-68           AC U6LVG6.1
#=GS A0A1U8LXY9_GOSHI/17-111     AC A0A1U8LXY9.1
#=GS B9HVZ3_POPTR/17-109         AC B9HVZ3.1
#=GS A0A178BD65_9PLEO/17-110     AC A0A178BD65.1
#=GS A0A1A9XK46_GLOFF/231-310    AC A0A1A9XK46.1
#=GS A0A1S4D3Y1_TOBAC/21-111     AC A0A1S4D3Y1.1
#=GS S6ESE6_ZYGB2/17-108         AC S6ESE6.1
#=GS A0A1W0W320_SORBI/34-132     AC A0A1W0W320.1
#=GS A0A1Q9ECN2_SYMMI/36-128     AC A0A1Q9ECN2.1
#=GS G3Y658_ASPNA/17-109         AC G3Y658.1
#=GS A0A0N4YHX7_NIPBR/26-121     AC A0A0N4YHX7.1
#=GS F4NW78_BATDJ/231-316        AC F4NW78.1
#=GS Q4N3J3_THEPA/32-116         AC Q4N3J3.1
#=GS A0A2G2XQ88_CAPBA/1-86       AC A0A2G2XQ88.1
#=GS I1C523_RHIO9/17-107         AC I1C523.1
#=GS A2X5K7_ORYSI/17-112         AC A2X5K7.1
#=GS J9E863_WUCBA/17-112         AC J9E863.1
#=GS A0A0D2FCJ8_9EURO/17-113     AC A0A0D2FCJ8.1
#=GS A0A0C3GNV0_9PEZI/17-113     AC A0A0C3GNV0.1
#=GS U1MYU6_9EURY/16-112         AC U1MYU6.1
#=GS D8QQ15_SELML/17-112         AC D8QQ15.1
#=GS F6QZD2_MACMU/17-114         AC F6QZD2.1
#=GS A0A0D2S6N8_GOSRA/234-320    AC A0A0D2S6N8.1
#=GS A1RYJ9_THEPD/16-106         AC A1RYJ9.1
#=GS A0A2K5M046_CERAT/231-317    AC A0A2K5M046.1
#=GS A0A093XSX9_9PEZI/17-109     AC A0A093XSX9.1
#=GS H0YDD8_HUMAN/10-91          AC H0YDD8.1
#=GS K8EQA9_9CHLO/36-121         AC K8EQA9.1
#=GS A0A0P0WMY2_ORYSJ/43-138     AC A0A0P0WMY2.1
#=GS A0A016VKC4_9BILA/107-165    AC A0A016VKC4.1
#=GS K7FUA9_PELSI/17-114         AC K7FUA9.1
#=GS G3HSW6_CRIGR/72-152         AC G3HSW6.1
#=GS A0A0D2QNS5_GOSRA/22-101     AC A0A0D2QNS5.1
#=GS A0A196S7Q6_BLAHN/149-233    AC A0A196S7Q6.1
#=GS Q5B9P6_EMENI/229-311        AC Q5B9P6.1
#=GS A0A0G2HNV7_9PEZI/229-312    AC A0A0G2HNV7.1
#=GS RLA1_PIG/22-113             AC A1XQU7.1
#=GS A0A1R2CMQ2_9CILI/17-111     AC A0A1R2CMQ2.1
#=GS U6E9V8_9EURY/16-101         AC U6E9V8.1
#=GS C5KZG5_PERM5/32-119         AC C5KZG5.1
#=GS A0A0D3GW13_9ORYZ/234-318    AC A0A0D3GW13.1
#=GS A0A0J8R1Q4_COCIT/229-311    AC A0A0J8R1Q4.1
#=GS K9FP11_PEND2/229-311        AC K9FP11.1
#=GS A1CQX8_ASPCL/21-107         AC A1CQX8.1
#=GS A0A067KLI6_JATCU/21-111     AC A0A067KLI6.1
#=GS V8P782_OPHHA/30-117         AC V8P782.1
#=GS A0A166CN91_9EURY/16-99      AC A0A166CN91.1
#=GS A0A1Y2F9D5_9ASCO/229-310    AC A0A1Y2F9D5.1
#=GS A0A0B2Q8X5_GLYSO/14-90      AC A0A0B2Q8X5.1
#=GS E9HA44_DAPPU/17-114         AC E9HA44.1
#=GS RLA0_ICTPU/231-292          AC Q90YX1.1
#=GS E9ET07_METRA/21-108         AC E9ET07.1
#=GS G0WA99_NAUDC/229-311        AC G0WA99.1
#=GS A0A183IHS0_9BILA/204-294    AC A0A183IHS0.1
#=GS H2N9R0_PONAB/13-98          AC H2N9R0.1
#=GS F6GYV5_VITVI/14-97          AC F6GYV5.1
#=GS A0A182HU89_ANOAR/17-111     AC A0A182HU89.1
#=GS A0A2B7YCD4_9EURO/229-313    AC A0A2B7YCD4.1
#=GS A2DXP9_TRIVA/17-105         AC A2DXP9.1
#=GS A0A1R2ANU2_9CILI/17-111     AC A0A1R2ANU2.1
#=GS A0A2C9JGE0_BIOGL/17-115     AC A0A2C9JGE0.1
#=GS K1Y1J6_MARBU/17-111         AC K1Y1J6.1
#=GS V4SKD3_9ROSI/17-111         AC V4SKD3.1
#=GS E9E4Z7_METAQ/21-108         AC E9E4Z7.1
#=GS A0A1S7UI78_ROSNE/17-110     AC A0A1S7UI78.1
#=GS A0A2G9HUM2_9LAMI/27-120     AC A0A2G9HUM2.1
#=GS A0A0P9DT22_9ARCH/16-105     AC A0A0P9DT22.1
#=GS RL12_METTH/16-100           AC P05394.2
#=GS A0A0L8FF90_OCTBM/22-114     AC A0A0L8FF90.1
#=GS G4VFI4_SCHMA/17-113         AC G4VFI4.1
#=GS Q0CPE0_ASPTN/17-109         AC Q0CPE0.1
#=GS A0A024W6I0_PLAFA/32-117     AC A0A024W6I0.1
#=GS V7CZG7_PHAVU/234-316        AC V7CZG7.1
#=GS A0A2G3AUJ0_CAPCH/21-111     AC A0A2G3AUJ0.1
#=GS A0A2G9FZC7_9LAMI/21-112     AC A0A2G9FZC7.1
#=GS A0A1F5D1B6_9ARCH/16-100     AC A0A1F5D1B6.1
#=GS D3STY1_NATMM/16-112         AC D3STY1.1
#=GS G3UAL3_LOXAF/21-110         AC G3UAL3.1
#=GS A0A151F0A5_9EURY/16-106     AC A0A151F0A5.1
#=GS A0A166UGE7_9HOMO/229-311    AC A0A166UGE7.1
#=GS M4F610_BRARP/22-110         AC M4F610.1
#=GS A9TMJ4_PHYPA/25-118         AC A9TMJ4.1
#=GS A0A1S4C503_TOBAC/17-111     AC A0A1S4C503.1
#=GS A0A078HJF4_BRANA/22-113     AC A0A078HJF4.1
#=GS S9UX97_9TRYP/16-105         AC S9UX97.1
#=GS A0A0E0MJB8_ORYPU/614-697    AC A0A0E0MJB8.1
#=GS A8CAF8_PHLPP/22-112         AC A8CAF8.1
#=GS A0A1A0H9M1_9ASCO/20-104     AC A0A1A0H9M1.1
#=GS A0A1E5R2V3_9ASCO/16-105     AC A0A1E5R2V3.1
#=GS M4B8B5_HYAAE/231-312        AC M4B8B5.1
#=GS D0NS77_PHYIT/27-114         AC D0NS77.1
#=GS A0A1E3B9V7_9EURO/17-107     AC A0A1E3B9V7.1
#=GS A0A182MRY6_9DIPT/23-112     AC A0A182MRY6.1
#=GS A7SQ36_NEMVE/231-312        AC A7SQ36.1
#=GS A0A2K1LB52_PHYPA/54-141     AC A0A2K1LB52.1
#=GS M0V315_HORVV/17-112         AC M0V315.1
#=GS W9DX87_METTI/16-101         AC W9DX87.1
#=GS A0A1S3TNW5_VIGRR/17-112     AC A0A1S3TNW5.1
#=GS A0A1L7WN06_9HELO/17-111     AC A0A1L7WN06.1
#=GS G9PCD3_HYPAI/21-107         AC G9PCD3.1
#=GS W9CY22_9HELO/229-312        AC W9CY22.1
#=GS W9WVT8_9EURO/221-305        AC W9WVT8.1
#=GS B6DDU4_ANODA/17-112         AC B6DDU4.1
#=GS A0A0W8CIM8_PHYNI/17-107     AC A0A0W8CIM8.1
#=GS A0A218P7C8_9EURY/232-339    AC A0A218P7C8.1
#=GS A0A1E4RTA6_9ASCO/20-103     AC A0A1E4RTA6.1
#=GS W7J9R5_PLAFA/231-315        AC W7J9R5.1
#=GS A0A058ZB71_9EUKA/231-311    AC A0A058ZB71.1
#=GS A0A091WYW6_OPIHO/17-114     AC A0A091WYW6.1
#=GS C7NWT7_HALMD/16-115         AC C7NWT7.1
#=GS A0A286XGV1_CAVPO/20-96      AC A0A286XGV1.1
#=GS A0DAN7_PARTE/34-121         AC A0DAN7.1
#=GS R1D1Z4_EMIHU/25-114         AC R1D1Z4.1
#=GS A0A088AHE1_APIME/22-110     AC A0A088AHE1.1
#=GS A0A168LAW7_ABSGL/102-160    AC A0A168LAW7.1
#=GS A0A1X2IJJ0_9FUNG/20-105     AC A0A1X2IJJ0.1
#=GS G0SEG9_CHATD/21-110         AC G0SEG9.1
#=GS A0A1U8LF15_GOSHI/17-84      AC A0A1U8LF15.1
#=GS A0A0G4PLX6_PENCA/21-106     AC A0A0G4PLX6.1
#=GS A0A0K8LN86_9EURO/229-312    AC A0A0K8LN86.1
#=GS R0FRV7_9BRAS/17-111         AC R0FRV7.1
#=GS A0A1S4C8V9_TOBAC/22-111     AC A0A1S4C8V9.1
#=GS E2AYQ2_CAMFO/829-925        AC E2AYQ2.1
#=GS A0A1H0Z415_9EURY/16-109     AC A0A1H0Z415.1
#=GS A0A1A6A1V3_9TREE/229-312    AC A0A1A6A1V3.1
#=GS G0VG13_NAUCC/19-105         AC G0VG13.1
#=GS A0A095A3I3_SCHHA/255-341    AC A0A095A3I3.1
#=GS E2R9Y9_CANLF/17-114         AC E2R9Y9.1
#=GS F4Q2X4_CAVFA/24-112         AC F4Q2X4.1
#=GS W4Y7J7_STRPU/170-251        AC W4Y7J7.1
#=GS A0A2I3G707_NOMLE/22-72      AC A0A2I3G707.1
#=GS A0A1B1DZ73_9APIC/32-118     AC A0A1B1DZ73.1
#=GS A0A0C7MUR7_9SACH/20-106     AC A0A0C7MUR7.1
#=GS A0A232FK66_9HYME/22-111     AC A0A232FK66.1
#=GS W5M0N0_LEPOC/231-315        AC W5M0N0.1
#=GS A0A2H3A3X3_9HYPO/21-108     AC A0A2H3A3X3.1
#=GS A0A1A0H9S1_9ASCO/17-109     AC A0A1A0H9S1.1
#=GS E5R4R3_LEPMJ/21-110         AC E5R4R3.1
#=GS A0A2G3ANC5_CAPAN/91-162     AC A0A2G3ANC5.1
#=GS W7TV03_9STRA/27-112         AC W7TV03.1
#=GS A0A0D3HR32_9ORYZ/795-880    AC A0A0D3HR32.1
#=GS G2QTI9_THITE/21-110         AC G2QTI9.1
#=GS E9D178_COCPS/21-110         AC E9D178.1
#=GS B6DDT3_ANODA/23-114         AC B6DDT3.1
#=GS A0A168CFM8_9HYPO/17-110     AC A0A168CFM8.1
#=GS F6TQ42_MACMU/18-88          AC F6TQ42.1
#=GS F0XS22_GROCL/229-311        AC F0XS22.1
#=GS A0A1Y1WV99_9FUNG/20-105     AC A0A1Y1WV99.1
#=GS E0CVC0_VITVI/21-110         AC E0CVC0.1
#=GS I3MH39_ICTTR/231-316        AC I3MH39.1
#=GS A0A0F8DMJ7_CERFI/21-107     AC A0A0F8DMJ7.1
#=GS A0A1R3RS31_ASPC5/229-311    AC A0A1R3RS31.1
#=GS D4AJZ8_ARTBC/229-307        AC D4AJZ8.1
#=GS A0A178Z6L0_9EURO/221-305    AC A0A178Z6L0.1
#=GS RLA0_HUMAN/231-316          AC P05388.1
#=GS G9A019_TORDC/16-105         AC G9A019.1
#=GS A0A0J7LAD7_LASNI/17-113     AC A0A0J7LAD7.1
#=GS A0A0E0IXV5_ORYNI/327-412    AC A0A0E0IXV5.1
#=GS A0A183BB09_9TREM/21-116     AC A0A183BB09.1
#=GS A0A146FDL2_9EURO/17-108     AC A0A146FDL2.1
#=GS A0A2K5LZX8_CERAT/18-88      AC A0A2K5LZX8.1
#=GS W7U6S0_9STRA/333-416        AC W7U6S0.1
#=GS A0A1D6CSF5_WHEAT/16-108     AC A0A1D6CSF5.1
#=GS A0A078GIA9_BRANA/234-318    AC A0A078GIA9.1
#=GS A0A1J4UV09_9ARCH/16-98      AC A0A1J4UV09.1
#=GS A0A023B2U7_GRENI/17-106     AC A0A023B2U7.1
#=GS Q6C2R2_YARLI/17-107         AC Q6C2R2.1
#=GS J8TXQ1_SACK1/17-110         AC J8TXQ1.1
#=GS A0A212EXT2_DANPL/22-111     AC A0A212EXT2.1
#=GS N1Q5J3_PSEFD/17-112         AC N1Q5J3.1
#=GS M3Z4Z1_MUSPF/17-108         AC M3Z4Z1.1
#=GS G2X1X0_VERDV/229-311        AC G2X1X0.1
#=GS A0A022R574_ERYGU/17-111     AC A0A022R574.1
#=GS A0A194RK76_PAPMA/231-315    AC A0A194RK76.1
#=GS Q45RT5_BIOGL/22-113         AC Q45RT5.1
#=GS A0A066WRE5_9BASI/17-111     AC A0A066WRE5.1
#=GS J9IG69_9SPIT/256-331        AC J9IG69.1
#=GS A0A0K3CKG0_RHOTO/17-109     AC A0A0K3CKG0.1
#=GS W4G6T9_9STRA/50-136         AC W4G6T9.1
#=GS G7PIT8_MACFA/231-294        AC G7PIT8.1
#=GS A0A1L9PNT8_ASPVE/229-311    AC A0A1L9PNT8.1
#=GS A0A1A6HMR5_NEOLE/22-113     AC A0A1A6HMR5.1
#=GS A0A1S3DY89_CICAR/92-179     AC A0A1S3DY89.1
#=GS N1RTW5_FUSC4/17-109         AC N1RTW5.1
#=GS A0A2I3LW88_PAPAN/18-88      AC A0A2I3LW88.1
#=GS J7RV13_KAZNA/19-105         AC J7RV13.1
#=GS B9SGY2_RICCO/17-101         AC B9SGY2.1
#=GS A0A1R1PSB6_ZANCU/17-108     AC A0A1R1PSB6.1
#=GS A0A168R8Y6_ABSGL/17-108     AC A0A168R8Y6.1
#=GS A0A0N0VFM7_9TRYP/238-325    AC A0A0N0VFM7.1
#=GS A0A1U8CQN0_MESAU/17-113     AC A0A1U8CQN0.1
#=GS A0A1S3YY25_TOBAC/17-113     AC A0A1S3YY25.1
#=GS Q0US67_PHANO/108-198        AC Q0US67.2
#=GS A0A1B7TBP1_9ASCO/20-104     AC A0A1B7TBP1.1
#=GS B6H209_PENRW/21-106         AC B6H209.1
#=GS A0A1H1EVW1_9EURY/16-113     AC A0A1H1EVW1.1
#=GS A0A0B1SD63_OESDE/17-68      AC A0A0B1SD63.1
#=GS A0A066WL39_9BASI/229-312    AC A0A066WL39.1
#=GS E9H1X6_DAPPU/231-319        AC E9H1X6.1
#=GS A0A183CRI3_GLOPA/36-123     AC A0A183CRI3.1
#=GS C5LYE6_PERM5/234-317        AC C5LYE6.1
#=GS G1TLI9_RABIT/17-88          AC G1TLI9.1
#=GS A0D341_PARTE/34-121         AC A0D341.1
#=GS A0A0D8XSZ0_DICVI/231-313    AC A0A0D8XSZ0.1
#=GS S6E2X4_ZYGB2/229-311        AC S6E2X4.1
#=GS A0A196SAQ9_BLAHN/30-113     AC A0A196SAQ9.1
#=GS A0A2H3ERX6_9HELO/21-109     AC A0A2H3ERX6.1
#=GS S9VTU9_SCHCR/17-108         AC S9VTU9.1
#=GS C4QV50_KOMPG/229-311        AC C4QV50.1
#=GS E7KAH4_YEASA/20-105         AC E7KAH4.1
#=GS A0A1J4UTC9_9ARCH/16-97      AC A0A1J4UTC9.1
#=GS A0A2I2YBK1_GORGO/169-254    AC A0A2I2YBK1.1
#=GS A0A199W7M9_ANACO/22-114     AC A0A199W7M9.1
#=GS A0A251UDA8_HELAN/65-161     AC A0A251UDA8.1
#=GS A0A0R3U6A1_9CEST/22-121     AC A0A0R3U6A1.1
#=GS A0A1G4M7Y2_LACFM/19-104     AC A0A1G4M7Y2.1
#=GS A0A0E0CYT0_9ORYZ/171-218    AC A0A0E0CYT0.1
#=GS D3BRR6_POLPP/17-108         AC D3BRR6.1
#=GS Q4CVQ4_TRYCC/16-106         AC Q4CVQ4.1
#=GS A0A1Y3B0U3_EURMA/231-314    AC A0A1Y3B0U3.1
#=GS A0A1Y1VPF2_9FUNG/21-106     AC A0A1Y1VPF2.1
#=GS A0A133U3M1_9EURY/16-100     AC A0A133U3M1.1
#=GS A0A078JC78_BRANA/28-120     AC A0A078JC78.1
#=GS M0MLX5_9EURY/16-114         AC M0MLX5.1
#=GS A0A183FD38_HELBK/1-58       AC A0A183FD38.1
#=GS A0A0D2EXT4_9EURO/21-112     AC A0A0D2EXT4.1
#=GS RL12_HALMA/16-114           AC P15772.1
#=GS A0A182TC11_9DIPT/192-275    AC A0A182TC11.1
#=GS E3Q6B4_COLGM/229-312        AC E3Q6B4.1
#=GS A0A1R2BE00_9CILI/2-88       AC A0A1R2BE00.1
#=GS Q46EV0_METBF/16-105         AC Q46EV0.1
#=GS A0A2I3MNA4_PAPAN/17-114     AC A0A2I3MNA4.1
#=GS A0A0M4EIW7_DROBS/17-113     AC A0A0M4EIW7.1
#=GS A0A151EH37_9EURY/16-105     AC A0A151EH37.1
#=GS K5VTU5_PHACS/17-114         AC K5VTU5.1
#=GS A0A177W7W3_BATDE/52-144     AC A0A177W7W3.1
#=GS L5LFB4_MYODS/446-521        AC L5LFB4.1
#=GS A0A2K1L9W1_PHYPA/17-112     AC A0A2K1L9W1.1
#=GS T1FN66_HELRO/17-113         AC T1FN66.1
#=GS A0A093H1E3_GAVST/17-77      AC A0A093H1E3.1
#=GS A0A0M3HNC0_ASCLU/26-117     AC A0A0M3HNC0.1
#=GS A0A250X644_9CHLO/21-106     AC A0A250X644.1
#=GS RLA0_DROME/231-316          AC P19889.1
#=GS A0A1U8A4W2_NELNU/5-118      AC A0A1U8A4W2.1
#=GS M2R003_CERS8/21-109         AC M2R003.1
#=GS A0A1Y2A9Z4_9FUNG/24-113     AC A0A1Y2A9Z4.1
#=GS A0A2I4B8R5_9TELE/17-115     AC A0A2I4B8R5.1
#=GS A0A0D3GVS3_9ORYZ/21-109     AC A0A0D3GVS3.1
#=GS A0A078GKJ9_BRANA/24-120     AC A0A078GKJ9.1
#=GS A0A2K5KEW3_COLAP/20-106     AC A0A2K5KEW3.1
#=GS D3E155_METRM/16-102         AC D3E155.1
#=GS A0A165YUL9_DAUCA/17-108     AC A0A165YUL9.1
#=GS A0A1Y1S3N7_9MICR/16-96      AC A0A1Y1S3N7.1
#=GS A0A1E5RTX9_HANUV/16-106     AC A0A1E5RTX9.1
#=GS A0A0E0HF90_ORYNI/17-112     AC A0A0E0HF90.1
#=GS A0A1Y3N451_PIRSE/237-328    AC A0A1Y3N451.1
#=GS G7PKL5_MACFA/231-317        AC G7PKL5.1
#=GS J4HWK7_9APHY/17-112         AC J4HWK7.1
#=GS G0HNM5_THES4/16-104         AC G0HNM5.1
#=GS A0A1Y1UMV1_9TREE/17-115     AC A0A1Y1UMV1.1
#=GS G4MYX0_MAGO7/17-108         AC G4MYX0.1
#=GS S3CXU0_OPHP1/21-107         AC S3CXU0.1
#=GS M2U5Z5_COCH5/17-112         AC M2U5Z5.1
#=GS B7PQC5_IXOSC/22-72          AC B7PQC5.1
#=GS A0A0C9MW68_9FUNG/20-104     AC A0A0C9MW68.1
#=GS D0MSA9_PHYIT/17-107         AC D0MSA9.1
#=GS G7NUG3_MACFA/156-239        AC G7NUG3.1
#=GS A0A182W7K1_9DIPT/23-112     AC A0A182W7K1.1
#=GS A0A0B7MWH9_9FUNG/228-307    AC A0A0B7MWH9.1
#=GS C5L0N1_PERM5/19-109         AC C5L0N1.1
#=GS RLA2_RAT/17-114             AC P02401.2
#=GS A0A2K5HDI7_COLAP/21-109     AC A0A2K5HDI7.1
#=GS A0A1S3A373_ERIEU/231-316    AC A0A1S3A373.1
#=GS E3QDB1_COLGM/17-109         AC E3QDB1.1
#=GS Q5UAU1_BOMMO/231-315        AC Q5UAU1.1
#=GS K1QN55_CRAGI/22-99          AC K1QN55.1
#=GS A0A166B8M7_9HOMO/21-112     AC A0A166B8M7.1
#=GS A0A1S3TTT5_VIGRR/17-112     AC A0A1S3TTT5.1
#=GS M1V544_CYAM1/24-116         AC M1V544.1
#=GS D8UHH8_VOLCA/239-320        AC D8UHH8.1
#=GS A0A074YD77_9PEZI/17-108     AC A0A074YD77.1
#=GS A0A229X0V7_9EURO/229-312    AC A0A229X0V7.1
#=GS F7XKV6_METZD/16-102         AC F7XKV6.1
#=GS A0A251RX55_HELAN/8-95       AC A0A251RX55.1
#=GS A0A1W4WRT8_AGRPL/17-112     AC A0A1W4WRT8.1
#=GS A0A1J6IDY2_NICAT/17-113     AC A0A1J6IDY2.1
#=GS C4N193_STOCA/22-110         AC C4N193.1
#=GS L1IA35_GUITH/24-115         AC L1IA35.1
#=GS A0A1I7T8S0_9PELO/231-312    AC A0A1I7T8S0.1
#=GS A2Q8G3_ASPNC/229-311        AC A2Q8G3.1
#=GS A0A182PAA1_9DIPT/17-111     AC A0A182PAA1.1
#=GS A0A1B7T9D6_9ASCO/229-313    AC A0A1B7T9D6.1
#=GS A0A165N3E6_9HOMO/229-311    AC A0A165N3E6.1
#=GS A0E0I4_PARTE/17-109         AC A0E0I4.1
#=GS A0A0X8V2P8_9EURY/230-331    AC A0A0X8V2P8.1
#=GS Q4CSS8_TRYCC/18-111         AC Q4CSS8.1
#=GS J7S3K6_KAZNA/16-106         AC J7S3K6.1
#=GS A0A0M9F5K0_FUSLA/228-310    AC A0A0M9F5K0.1
#=GS G1T8P4_RABIT/22-113         AC G1T8P4.1
#=GS A0A0D8Y5N2_DICVI/23-117     AC A0A0D8Y5N2.1
#=GS A0A0D2P417_GOSRA/22-102     AC A0A0D2P417.1
#=GS I7MJ34_TETTS/26-108         AC I7MJ34.1
#=GS A0A0P1AZQ4_9STRA/29-111     AC A0A0P1AZQ4.1
#=GS A0A017SR48_9EURO/21-106     AC A0A017SR48.1
#=GS A0A0L8FR32_OCTBM/17-111     AC A0A0L8FR32.1
#=GS A0A1R2C178_9CILI/17-111     AC A0A1R2C178.1
#=GS A0A0E0LQX6_ORYPU/234-318    AC A0A0E0LQX6.1
#=GS J3M7N9_ORYBR/17-112         AC J3M7N9.1
#=GS E7KL14_YEASL/20-105         AC E7KL14.1
#=GS S2JHE3_MUCC1/17-105         AC S2JHE3.1
#=GS A0A168L262_ABSGL/17-108     AC A0A168L262.1
#=GS L5K8L8_PTEAL/27-97          AC L5K8L8.1
#=GS V6LLG8_9EUKA/17-110         AC V6LLG8.1
#=GS A0A1S8W929_9FUNG/17-111     AC A0A1S8W929.1
#=GS S9XIT4_CAMFR/77-152         AC S9XIT4.1
#=GS A0A2G5U6T4_9PELO/17-110     AC A0A2G5U6T4.1
#=GS A0A1C1CUP7_9EURO/21-112     AC A0A1C1CUP7.1
#=GS A0A0N5CW45_THECL/17-115     AC A0A0N5CW45.1
#=GS I1GZG2_BRADI/17-91          AC I1GZG2.1
#=GS K7J952_NASVI/17-112         AC K7J952.1
#=GS A0A1I7VQ04_LOALO/231-319    AC A0A1I7VQ04.1
#=GS A0A1S3DWF6_CICAR/21-108     AC A0A1S3DWF6.1
#=GS B4G8A2_DROPE/22-111         AC B4G8A2.1
#=GS RLA0_PIG/231-317            AC Q29214.2
#=GS M3Z525_MUSPF/6-90           AC M3Z525.1
#=GS A0A1D5R8T6_MACMU/182-247    AC A0A1D5R8T6.1
#=GS A0A1A6FTK6_NEOLE/138-221    AC A0A1A6FTK6.1
#=GS B9SLK4_RICCO/234-319        AC B9SLK4.1
#=GS V4LS34_EUTSA/33-120         AC V4LS34.1
#=GS W5AP46_WHEAT/17-112         AC W5AP46.1
#=GS A0A1U8HXU8_GOSHI/21-111     AC A0A1U8HXU8.1
#=GS G1PDJ8_MYOLU/19-105         AC G1PDJ8.1
#=GS A0A1J4ULR7_9ARCH/16-99      AC A0A1J4ULR7.1
#=GS A0A1U8L7D0_GOSHI/22-113     AC A0A1U8L7D0.1
#=GS A0A0L9U8A2_PHAAN/17-112     AC A0A0L9U8A2.1
#=GS B8MH37_TALSN/229-312        AC B8MH37.1
#=GS A0A137QH46_9AGAR/17-109     AC A0A137QH46.1
#=GS G8ZM14_TORDC/17-109         AC G8ZM14.1
#=GS A0A0D9WUU4_9ORYZ/21-109     AC A0A0D9WUU4.1
#=GS S3DT21_GLAL2/229-313        AC S3DT21.1
#=GS A0A1E4STP8_9ASCO/229-309    AC A0A1E4STP8.1
#=GS A0A0B4I491_9HYPO/229-312    AC A0A0B4I491.1
#=GS A0A1U8NNX7_GOSHI/234-319    AC A0A1U8NNX7.1
#=GS C5LFG0_PERM5/17-109         AC C5LFG0.1
#=GS A0A1Y2G4L1_9BASI/17-105     AC A0A1Y2G4L1.1
#=GS I1CPV0_RHIO9/20-106         AC I1CPV0.1
#=GS A0A1Y1VI18_9FUNG/228-311    AC A0A1Y1VI18.1
#=GS Q7RKJ6_PLAYO/19-110         AC Q7RKJ6.1
#=GS A0A1Y1YCH5_9FUNG/228-309    AC A0A1Y1YCH5.1
#=GS M5E8M3_MALS4/229-312        AC M5E8M3.1
#=GS A2RB85_ASPNC/21-107         AC A2RB85.1
#=GS A0A0B2X5A0_9HYPO/17-109     AC A0A0B2X5A0.1
#=GS B8BTG2_THAPS/17-97          AC B8BTG2.1
#=GS D3ZN03_RAT/17-114           AC D3ZN03.1
#=GS A0A087H854_ARAAL/233-320    AC A0A087H854.1
#=GS A0A0F8VQE6_9ARCH/16-91      AC A0A0F8VQE6.1
#=GS D8M4Q3_BLAHO/230-313        AC D8M4Q3.1
#=GS A0A2I3GJP1_NOMLE/169-254    AC A0A2I3GJP1.1
#=GS A0A0E0AQG8_9ORYZ/234-318    AC A0A0E0AQG8.1
#=GS A0A085M1L2_9BILA/231-313    AC A0A085M1L2.1
#=GS G2WRQ1_VERDV/21-108         AC G2WRQ1.1
#=GS A0A1S4ATY9_TOBAC/39-131     AC A0A1S4ATY9.1
#=GS R7YLL1_CONA1/21-111         AC R7YLL1.1
#=GS A0A2K5LZX4_CERAT/22-113     AC A0A2K5LZX4.1
#=GS J3MQ37_ORYBR/234-318        AC J3MQ37.1
#=GS F8VZS0_HUMAN/182-246        AC F8VZS0.1
#=GS G0WB67_NAUDC/20-106         AC G0WB67.1
#=GS U6J9R0_ECHGR/231-322        AC U6J9R0.1
#=GS A0A067KGQ0_JATCU/36-122     AC A0A067KGQ0.1
#=GS A0A287AY54_PIG/192-278      AC A0A287AY54.1
#=GS A0A0J6YDR7_COCIT/229-311    AC A0A0J6YDR7.1
#=GS A0A151GIM6_9HYPO/17-109     AC A0A151GIM6.1
#=GS M4C9Q0_BRARP/22-112         AC M4C9Q0.1
#=GS A0A0W7TI38_9EURY/16-102     AC A0A0W7TI38.1
#=GS A0A0A1TDB9_9HYPO/229-312    AC A0A0A1TDB9.1
#=GS A0A0D3GVS5_9ORYZ/51-139     AC A0A0D3GVS5.1
#=GS A0A2I0P8V1_9EURY/16-103     AC A0A2I0P8V1.1
#=GS A0A0M8P1D7_9EURO/52-141     AC A0A0M8P1D7.1
#=GS A0A231M4K6_9EURO/229-312    AC A0A231M4K6.1
#=GS A0A150J1L6_9EURY/16-103     AC A0A150J1L6.1
#=GS A0A1A6GXJ3_NEOLE/17-114     AC A0A1A6GXJ3.1
#=GS A0A0L9UDB2_PHAAN/2-78       AC A0A0L9UDB2.1
#=GS A0A1E7EY82_9STRA/17-105     AC A0A1E7EY82.1
#=GS A0A1G4J5T4_9SACH/17-106     AC A0A1G4J5T4.1
#=GS S7MIM4_MYOBR/1-72           AC S7MIM4.1
#=GS W0TFI4_KLUMD/229-310        AC W0TFI4.1
#=GS S3DGQ7_GLAL2/17-111         AC S3DGQ7.1
#=GS A0A0V0X2D3_9BILA/22-112     AC A0A0V0X2D3.1
#=GS A0A1Z5JNJ9_FISSO/33-120     AC A0A1Z5JNJ9.1
#=GS H0ZHQ4_TAEGU/17-114         AC H0ZHQ4.1
#=GS C0NC89_AJECG/45-127         AC C0NC89.1
#=GS I1RRT8_GIBZE/228-310        AC I1RRT8.1
#=GS A0A2G2XB62_CAPBA/22-113     AC A0A2G2XB62.1
#=GS A0A1L9VRS8_ASPGL/229-310    AC A0A1L9VRS8.1
#=GS A0A022RX13_ERYGU/234-321    AC A0A022RX13.1
#=GS A0A1Y2EP34_9FUNG/21-105     AC A0A1Y2EP34.1
#=GS E3KYL1_PUCGT/19-107         AC E3KYL1.2
#=GS A0A0D2TK93_GOSRA/229-314    AC A0A0D2TK93.1
#=GS I3KTM3_ORENI/231-314        AC I3KTM3.1
#=GS L1IMI6_GUITH/17-76          AC L1IMI6.1
#=GS Q4QF62_LEIMA/18-110         AC Q4QF62.1
#=GS A0A075LRC6_9EURY/16-103     AC A0A075LRC6.1
#=GS W0I0V8_9EURY/16-103         AC W0I0V8.1
#=GS W6KY85_9TRYP/19-107         AC W6KY85.1
#=GS A0A1E3QIN5_9ASCO/17-108     AC A0A1E3QIN5.1
#=GS A0A0B7NFA6_9FUNG/17-106     AC A0A0B7NFA6.1
#=GS M9MEI2_PSEA3/43-131         AC M9MEI2.1
#=GS Q8TZJ7_PYRFU/16-106         AC Q8TZJ7.1
#=GS A0A251NP95_PRUPE/17-112     AC A0A251NP95.1
#=GS D7TVT2_VITVI/21-110         AC D7TVT2.1
#=GS A0A158NU13_ATTCE/22-111     AC A0A158NU13.1
#=GS G0VDR1_NAUCC/20-106         AC G0VDR1.1
#=GS G3JUX2_CORMM/202-287        AC G3JUX2.1
#=GS A0A2A2K8E2_9BILA/231-316    AC A0A2A2K8E2.1
#=GS A0A165HN10_9BASI/17-114     AC A0A165HN10.1
#=GS A0A1E4SRI2_9ASCO/229-309    AC A0A1E4SRI2.1
#=GS M0CGF3_9EURY/16-115         AC M0CGF3.1
#=GS B3MUH8_DROAN/22-113         AC B3MUH8.1
#=GS A0A1Y2F9K1_9FUNG/23-106     AC A0A1Y2F9K1.1
#=GS A0A0D2LBT3_9CHLO/17-106     AC A0A0D2LBT3.1
#=GS A0A183W1W5_TRIRE/22-112     AC A0A183W1W5.1
#=GS A0A251QPL9_PRUPE/21-108     AC A0A251QPL9.1
#=GS G2YDG1_BOTF4/30-118         AC G2YDG1.1
#=GS A0A2A2KT37_9BILA/69-164     AC A0A2A2KT37.1
#=GS V4ME21_EUTSA/16-98          AC V4ME21.1
#=GS A4YH90_METS5/16-101         AC A4YH90.1
#=GS A0A168ND44_ABSGL/20-105     AC A0A168ND44.1
#=GS A0A196SGJ7_BLAHN/30-113     AC A0A196SGJ7.1
#=GS A0A0B7N7Q1_9FUNG/20-105     AC A0A0B7N7Q1.1
#=GS A0A1E3QKR2_9ASCO/17-107     AC A0A1E3QKR2.1
#=GS Q4Q6R5_LEIMA/35-124         AC Q4Q6R5.1
#=GS A0A183I1K9_9BILA/231-319    AC A0A183I1K9.1
#=GS A0A1Q2YGH0_9ASCO/22-107     AC A0A1Q2YGH0.1
#=GS G4RKP0_THETK/16-109         AC G4RKP0.1
#=GS E1F4E2_GIAIA/233-312        AC E1F4E2.1
#=GS A7LIT3_9ROSI/56-118         AC A7LIT3.1
#=GS A0A0B7N3F0_9FUNG/20-105     AC A0A0B7N3F0.1
#=GS D2RQS4_HALTV/16-115         AC D2RQS4.1
#=GS D8M3G8_BLAHO/9-101          AC D8M3G8.1
#=GS A7TF23_VANPO/19-104         AC A7TF23.1
#=GS A0A1D6FPB9_MAIZE/17-98      AC A0A1D6FPB9.1
#=GS A0A1M2VJQ0_TRAPU/56-144     AC A0A1M2VJQ0.1
#=GS A0A1S3EJV7_CICAR/21-111     AC A0A1S3EJV7.1
#=GS A0A1B9I004_9TREE/17-111     AC A0A1B9I004.1
#=GS D7LMJ6_ARALL/17-110         AC D7LMJ6.1
#=GS F8W1K8_HUMAN/21-106         AC F8W1K8.1
#=GS G4VJS1_SCHMA/21-115         AC G4VJS1.1
#=GS M0T501_MUSAM/1-93           AC M0T501.1
#=GS A0A251S239_HELAN/59-148     AC A0A251S239.1
#=GS A0A2D6K5E4_9ARCH/16-102     AC A0A2D6K5E4.1
#=GS G2XLD3_ORYGL/234-319        AC G2XLD3.1
#=GS A0A0D3C702_BRAOL/22-112     AC A0A0D3C702.1
#=GS A0A183PT73_9TREM/21-114     AC A0A183PT73.1
#=GS A0A0S4JVF4_BODSA/19-105     AC A0A0S4JVF4.1
#=GS K0TB64_THAOC/106-196        AC K0TB64.1
#=GS N4V258_COLOR/21-108         AC N4V258.1
#=GS A0A2K5M064_CERAT/169-255    AC A0A2K5M064.1
#=GS F6RRL3_CIOIN/17-108         AC F6RRL3.2
#=GS A0A176VIV8_MARPO/17-113     AC A0A176VIV8.1
#=GS A0A202DF82_9ARCH/16-101     AC A0A202DF82.1
#=GS A0A1V9X251_9ACAR/231-314    AC A0A1V9X251.1
#=GS T1H6I7_MEGSC/17-109         AC T1H6I7.1
#=GS A0A0D3B5Y7_BRAOL/234-318    AC A0A0D3B5Y7.1
#=GS A9SDK8_PHYPA/21-108         AC A9SDK8.1
#=GS F6YP53_CALJA/169-255        AC F6YP53.1
#=GS A0A0C9XD34_9AGAR/229-310    AC A0A0C9XD34.1
#=GS M3CXL0_SPHMS/21-112         AC M3CXL0.1
#=GS A0A225AEK5_9EURO/229-312    AC A0A225AEK5.1
#=GS M4DVB0_BRARP/35-119         AC M4DVB0.1
#=GS A0A2I3TRK3_PANTR/169-254    AC A0A2I3TRK3.1
#=GS A0A2I3HX83_NOMLE/179-264    AC A0A2I3HX83.1
#=GS A2ZHU8_ORYSI/234-319        AC A2ZHU8.1
#=GS A0A1D5SE57_WHEAT/17-111     AC A0A1D5SE57.1
#=GS A0A1U7UBY3_TARSY/848-937    AC A0A1U7UBY3.1
#=GS C5DNX7_ZYGRC/229-309        AC C5DNX7.1
#=GS A0A2I3GMH8_NOMLE/213-292    AC A0A2I3GMH8.1
#=GS A0A1V8UFY8_9PEZI/21-111     AC A0A1V8UFY8.1
#=GS W6NFD0_HAECO/175-259        AC W6NFD0.1
#=GS A0A2K5IK72_COLAP/11-108     AC A0A2K5IK72.1
#=GS A0A199VEQ5_ANACO/22-74      AC A0A199VEQ5.1
#=GS A0A218X3W3_PUNGR/21-109     AC A0A218X3W3.1
#=GS M9PG76_DROME/231-316        AC M9PG76.1
#=GS E3LMT1_CAERE/17-107         AC E3LMT1.1
#=GS G3HF33_CRIGR/22-68          AC G3HF33.1
#=GS A0A179UGP8_BLAGS/21-109     AC A0A179UGP8.1
#=GS G4T708_SERID/21-112         AC G4T708.1
#=GS A0A0V0SDL3_9BILA/251-339    AC A0A0V0SDL3.1
#=GS G2WZ41_VERDV/17-109         AC G2WZ41.1
#=GS A0A1E4TUG5_PACTA/19-106     AC A0A1E4TUG5.1
#=GS A0A2K5M039_CERAT/231-338    AC A0A2K5M039.1
#=GS A0A1I7VGW5_LOALO/4-66       AC A0A1I7VGW5.1
#=GS A0BIU4_PARTE/17-109         AC A0BIU4.1
#=GS H2P6X3_PONAB/22-99          AC H2P6X3.1
#=GS A0A166B084_DAUCA/1-68       AC A0A166B084.1
#=GS A0A078FPZ5_BRANA/71-161     AC A0A078FPZ5.1
#=GS A0A0V1MXY9_9BILA/24-121     AC A0A0V1MXY9.1
#=GS A0A178AE94_9PLEO/21-111     AC A0A178AE94.1
#=GS S2JQH4_MUCC1/17-105         AC S2JQH4.1
#=GS A0A0K9QR70_SPIOL/35-119     AC A0A0K9QR70.1
#=GS RLA2_DICDI/15-105           AC P22683.3
#=GS B9SLB2_RICCO/36-90          AC B9SLB2.1
#=GS W4IQB3_PLAFP/19-111         AC W4IQB3.1
#=GS RL12_SULAC/16-104           AC P08055.2
#=GS A0A1V6S394_9EURO/21-107     AC A0A1V6S394.1
#=GS K1WN96_MARBU/21-109         AC K1WN96.1
#=GS F7GDL0_MACMU/166-252        AC F7GDL0.2
#=GS A0A225UN76_9STRA/27-113     AC A0A225UN76.1
#=GS R1GV22_BOTPV/229-312        AC R1GV22.1
#=GS A0A0C2F5E6_9BILA/22-113     AC A0A0C2F5E6.1
#=GS A0A078A2R0_STYLE/270-348    AC A0A078A2R0.1
#=GS A0A0A2JUI9_PENEN/21-107     AC A0A0A2JUI9.1
#=GS W6MJM1_9ASCO/11-117         AC W6MJM1.1
#=GS Q758U4_ASHGO/16-104         AC Q758U4.1
#=GS A0A1Q9NW60_9ARCH/16-102     AC A0A1Q9NW60.1
#=GS A0A2I3HIJ1_NOMLE/17-109     AC A0A2I3HIJ1.1
#=GS A0A183I9B7_9BILA/32-73      AC A0A183I9B7.1
#=GS E9CTT5_COCPS/17-110         AC E9CTT5.1
#=GS A0A0V0U5A5_9BILA/72-160     AC A0A0V0U5A5.1
#=GS J9E7T3_WUCBA/17-117         AC J9E7T3.1
#=GS F0VGP2_NEOCL/32-117         AC F0VGP2.1
#=GS S7P9Y9_MYOBR/22-112         AC S7P9Y9.1
#=GS F4NTD8_BATDJ/17-109         AC F4NTD8.1
#=GS B0XFG3_CULQU/41-110         AC B0XFG3.1
#=GS A0A2G8KLC4_STIJA/22-111     AC A0A2G8KLC4.1
#=GS A0A167S5B3_9BASI/17-114     AC A0A167S5B3.1
#=GS A0A177EI21_9MICR/16-99      AC A0A177EI21.1
#=GS Q9SM26_MAIZE/17-111         AC Q9SM26.1
#=GS A0A2G2VAU2_CAPBA/75-169     AC A0A2G2VAU2.1
#=GS J5RZR0_SACK1/16-105         AC J5RZR0.1
#=GS B5DH21_SALSA/22-110         AC B5DH21.1
#=GS A0A182HZC3_ANOAR/231-313    AC A0A182HZC3.2
#=GS A0A177WJ21_BATDE/231-316    AC A0A177WJ21.1
#=GS G3RT68_GORGO/21-102         AC G3RT68.2
#=GS L2FNT8_COLGN/20-109         AC L2FNT8.1
#=GS V6LLL6_9EUKA/20-106         AC V6LLL6.1
#=GS A0A0N4U3K0_DRAME/17-105     AC A0A0N4U3K0.1
#=GS W2LX02_PHYPR/27-114         AC W2LX02.1
#=GS I7J9I3_BABMR/265-347        AC I7J9I3.1
#=GS RLA2B_MAIZE/17-112          AC O24415.1
#=GS A0A2I3TWP8_PANTR/177-260    AC A0A2I3TWP8.1
#=GS A0A094A5D9_9PEZI/57-134     AC A0A094A5D9.1
#=GS A5DZX0_LODEL/17-110         AC A5DZX0.1
#=GS A8QDQ2_MALGO/229-313        AC A8QDQ2.1
#=GS A0A2K2BKJ3_POPTR/21-98      AC A0A2K2BKJ3.1
#=GS G8Y3N2_PICSO/229-308        AC G8Y3N2.1
#=GS G8BWL0_TETPH/16-105         AC G8BWL0.1
#=GS A0A2H3ANR8_9AGAR/17-111     AC A0A2H3ANR8.1
#=GS L5K483_PTEAL/22-113         AC L5K483.1
#=GS A0A163J650_ABSGL/91-175     AC A0A163J650.1
#=GS A0A024TCK8_9STRA/17-107     AC A0A024TCK8.1
#=GS C4JVS3_UNCRE/229-310        AC C4JVS3.1
#=GS A0A2B7ZIL2_9EURO/229-310    AC A0A2B7ZIL2.1
#=GS J3KCL7_COCIM/21-110         AC J3KCL7.2
#=GS A0A0M9FPH6_9TRYP/20-107     AC A0A0M9FPH6.1
#=GS A8PUC9_MALGO/6-93           AC A8PUC9.1
#=GS H3G993_PHYRM/231-311        AC H3G993.1
#=GS J8PI57_SACAR/16-104         AC J8PI57.1
#=GS A0A1G4MAP9_LACFM/20-105     AC A0A1G4MAP9.1
#=GS A0A0L6VCC0_9BASI/77-165     AC A0A0L6VCC0.1
#=GS I2FQ08_USTH4/230-312        AC I2FQ08.1
#=GS A0A256Z1G6_9ARCH/16-65      AC A0A256Z1G6.1
#=GS A0A1Y1IG08_KLENI/22-127     AC A0A1Y1IG08.1
#=GS A0A074VMF3_9PEZI/17-108     AC A0A074VMF3.1
#=GS G1RT29_NOMLE/18-88          AC G1RT29.1
#=GS C4LVQ0_ENTHI/16-106         AC C4LVQ0.1
#=GS A0A1Q7LYW2_9CREN/16-99      AC A0A1Q7LYW2.1
#=GS A0A182JQL6_9DIPT/23-112     AC A0A182JQL6.1
#=GS G3I3H2_CRIGR/17-114         AC G3I3H2.1
#=GS F1RN65_PIG/22-113           AC F1RN65.2
#=GS S3DI74_GLAL2/21-110         AC S3DI74.1
#=GS T1G9K8_HELRO/17-114         AC T1G9K8.1
#=GS A0A1J6IHM9_NICAT/22-111     AC A0A1J6IHM9.1
#=GS A0A151S1K9_CAJCA/234-321    AC A0A151S1K9.1
#=GS A0A0R3T4L3_HYMNN/17-118     AC A0A0R3T4L3.1
#=GS A0A0A1TZN0_ENTIV/16-106     AC A0A0A1TZN0.1
#=GS A0A061GX53_THECC/234-320    AC A0A061GX53.1
#=GS A0A1G9U303_9EURY/16-118     AC A0A1G9U303.1
#=GS A0A1Z2TL07_9EURY/16-104     AC A0A1Z2TL07.1
#=GS A0A0Q3U1W1_AMAAE/231-317    AC A0A0Q3U1W1.1
#=GS A0A074X9U1_AURPU/229-312    AC A0A074X9U1.1
#=GS A0A151P8E5_ALLMI/22-112     AC A0A151P8E5.1
#=GS A0A0E0MTI5_ORYRU/60-118     AC A0A0E0MTI5.1
#=GS D5G5W0_TUBMM/17-93          AC D5G5W0.1
#=GS W9I5T3_FUSOX/21-108         AC W9I5T3.1
#=GS A0A1Y1X8Z8_9FUNG/17-108     AC A0A1Y1X8Z8.1
#=GS I1C644_RHIO9/20-106         AC I1C644.1
#=GS A0A067F4P6_CITSI/17-109     AC A0A067F4P6.1
#=GS A0A1J4L0H8_9EUKA/17-104     AC A0A1J4L0H8.1
#=GS Q6CL57_KLULA/19-103         AC Q6CL57.1
#=GS A5K4W2_PLAVS/232-314        AC A5K4W2.1
#=GS A0A1J9Q4L9_9EURO/64-119     AC A0A1J9Q4L9.1
#=GS A7IAK2_METB6/9-102          AC A7IAK2.1
#=GS I4DID9_PAPXU/17-111         AC I4DID9.1
#=GS L0ICQ0_HALRX/16-111         AC L0ICQ0.1
#=GS E6R882_CRYGW/17-110         AC E6R882.1
#=GS C4JJY9_UNCRE/77-144         AC C4JJY9.1
#=GS A0A0D9RMD1_CHLSB/22-113     AC A0A0D9RMD1.1
#=GS M2ZKM0_PSEFD/229-314        AC M2ZKM0.1
#=GS A0A2D3VJV8_9PEZI/21-110     AC A0A2D3VJV8.1
#=GS I1C783_RHIO9/228-308        AC I1C783.1
A8BKF1_GIAIC/21-105                    ......................................................................EPTAANLKSICDA......AG.V.K.VD.....SIWFT..L.......F.A.N...Y.......LE............G.K...NV.K.EL.L.TTLGSA--............................................SAAPA.P.VT...A....G..G...A....V.....A..A...A...A...A......A...A....E..T....A.KK..EES-...................-..DDDE........IVG.aGGMF...............................
A0A150J6Q7_9EURY/16-101                ......................................................................EINEANLNSVLKA......AG.V.A.VD.....EARIK..A.......L.V.S...S.......LE............G.V...DI.E.DA.I.SSASMP--............................................-VAQA.P.AA...A....P..A...A....A.....S..D...H...K...A......S...E....S..K....K.EE..KKE-...................-..EAEEs......aLEG.lGALF...............................
A0A084VHA0_ANOSI/744-827               ......................................................................YPTLASVPHSIAN......GF.R.N.LL.....AIAAV..T.......E.V.E...F.......KE............A.E...TV.K.EF.I.KDPSKF--............................................AAVSA.A.AA...P....A..A...A....A.....A..A...P...A...A......K...V....E..E....K.KE..ESE-...................-..SEDD........DMG..FGLF...............................
A0A0D0BXB3_9AGAR/17-113                ......................................................................SPSASDIKRVLSA......VS.I.Q.AD.....DERLD..K.......L.L.S...A.......LK............D.K...DI.N.QL.I.QEGSSKLSl..........................................iPSGGG.P.VP...V....D..A...G....G.....G..G...T...Q...E......K...E....V..D....K.KE..ENEEl................akD..DGDDs......eDEG..FYL-nlf............................
A0A1L0BXU2_9ASCO/20-106                .....................................................................e-LSSDNLLALTQA......AG.A.T.VD.....AVWAD..V.......F.A.K...A.......LE............G.Q...NL.K.EL.L.FSFAASA-............................................PAASA.G.AS...G....A..A...A....G.....G..A...A...A...V......E...A....A..E....E.KE..EEAA...................E..ESDD........DMG..FGLF...............................
A0A150FY74_GONPE/17-109                ......................................................................SPTADDINKILSS......VG.V.E.AD.....AEKVN..K.......L.I.S...E.......LE............G.K...DL.Q.EV.L.SAGRAKLAsvp......................................sggAVAAA.P.AG...G....A..A...P....A.....A..G...G...A...A......P...A....P..K....K.EE..KKE-...................P..SEEE........DMG..FSLF...............................
F0ZXE3_DICPU/227-304                   ......................................................................YPTIASIPHSVMN......AF.K.N.LL.....AISFE..T.......E.I.T...F.......DA............A.D...KF.K.AA.-.--------............................................-ASAA.P.VA...T....A..A...A....P.....A..A...A...A...P......A...A....A..K....K.VV..EEPK...................E..ESDD........DMG..MGLF...............................
G8JWW4_ERECY/92-178                    ......................................................................EVSADNLLALTKA......AG.A.S.VD.....NVWAD..I.......F.S.K...A.......LE............G.K...DV.K.DI.L.SGFHAAGS............................................ASGAS.V.GA...S....T..T...G....A.....A..S...D...E...A......A...A....E..E....A.AE..EAA-...................E..ESDD........DMG..FGLF...............................
A0A1Y2FID2_9ASCO/19-106                ......................................................................EITADKLQTLCKA......AN.V.E.VE.....PIWAS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGGA-S............................................GAAPA.A.AG...G....A..A...A....S.....G..D...A...P...A......A...E....E..K....K.EE..KAEE..................kE..ESDD........DMG..FGLF...............................
M4ENX5_BRARP/28-120                    .....................................................................a-ITADKIATLIKS......AG.V.S.CE.....SYWPM..L.......F.A.K...M.......AE............K.R...NV.T.DL.I.MNVGAGGGgg.......................................apvS-AAA.P.AA...G....G..G..gG....G.....A..A...A...A...P......A...A....E..E....K.KK..EEVA...................E..ESDG........DLG..FGLF...............................
F6Z136_CALJA/18-88                     ...................................................................dde-------------......--.-.-.--.....-----..V.......T.V.T...A.......LA............N.V...NI.G.SL.I.CNVGAGGPa..........................................pAAGAA.P.AG...G....P..A...P....S.....T..A...A...A...P......A...E....E..K....K.VE..AKKEe.................sE..ESDD........DMG..FGLF...............................
A0A1A6GF20_NEOLE/4-100                 .....................................................................k--SAKDIKKILES......VG.I.K.AD.....NDQLN..K.......V.F.S...E.......LN............G.K..sEL.M.DV.I.AQGVGKLAsvpv....................................ggavAVSAD.P.GS...A....A..P...A....A.....G..S...A...P...A......A...E....E..K....K.DE..KKEE..................sE..ESDD........DMG..FGLF...............................
M2MFM3_BAUCO/234-321                   ......................................................................YPTLPSVSHTILN......AY.K.N.LL.....AIAVE..T.......E.Y.E...W.......PA............I.A...QL.K.AG.I.RDPSLLQAa..........................................aPAASE.A.AP...A....A..E...E....A.....K..A...D...A...P......K...E....E..E....K.KE..EE--...................E..EEDE........DMG..FGLF...............................
B3S429_TRIAD/231-313                   ......................................................................YPTTVSVPHSIIN......GF.K.N.VL.....AVAVE..T.......D.I.N...F.......PE............A.E...KA.K.AF.L.ADPSAF--............................................-IVAA.P.VA...A....A..G...E....A.....E..E...A...K...P......A...K....E..E....K.QE..EEE-...................-..ESDD........DMG..FGLF...............................
A0A226NAL5_CALSU/231-316               ......................................................................YPTIASVPHSIIN......GY.K.R.VL.....AVAVE..T.......N.Y.S...F.......PL............A.E...KV.K.AF.L.ADPSAFVV............................................AAPAV.T.ET...A....A..P...A....A.....A..A...A...T...P......A...K....E..A....P.KE..ESE-...................-..ESDE........DMG..FGLF...............................
A0A0W7TI05_9EURY/230-333               .....................................................................y-PAKETMPALIAK......AY.R.-.-S.....AVALS..V.......E.A.A...I.......PT............K.D...TI.G.AL.F.AKADRQMLalasasgf...........................tnddiaarlASAPV.A.AS...A....A..A...E....P.....A..A...P...A...E......Q...K....A..E....E.EK..SEEE...................T..EEEV........SAG.lGALF...............................
RL12_PYRHO/16-107                      ......................................................................EINEENLKAVLQA......AG.V.E.PE.....EARIK..A.......L.V.A...A.......LE............G.V...NI.D.EV.I.EKAAMPV-............................................AVAAA.P.AA...A....P..A...E....A.....G..G...E...E...K......K...E....E..E....K.KE..EEEKee...............evS..EEEA........LAG.lSALF...............................
#=GR RL12_PYRHO/16-107           SS    ......................................................................--SHHHHHHHHHH......TT.-.-.--.....HHHHH..H.......H.H.H...H.......TT............T.-...-H.H.HH.H.HTC-XXX-............................................XXXXX.X.XX...X....X..X...X....X.....X..X...X...X...X......X...X....X..X....H.HH..HHHHHH...............HHH..HHHH........HHH.HHHCH...............................
A0A182V7K1_ANOME/231-313               ......................................................................YPTLASVPHSIAN......GF.R.N.LL.....AIAAV..T.......E.V.E...F.......KE............A.E...TV.K.EF.I.KDPSKF--............................................--AAA.T.AT...T....A..S...A....A.....A..P...A...A...K......A...E....E..K....K.VE..SES-...................E..DEDE........DMG..FGLF...............................
A8Y1E6_CAEBR/22-110                    .....................................................................a-ITAEKISSLLKA......AN.V.E.FE.....PFWPG..L.......F.A.K...A.......LE............G.V...DV.K.NL.I.TSVSSGAGs..........................................gPAPAA.A.AA...A....P..A...A....G.....G..A...A...P...A......A...E....T..K....K.KE..EPK-...................E..ESDD........DMG..FGLF...............................
A0A162R5H3_MUCCL/228-307               ......................................................................YPTLASVPHSVIN......GY.K.N.LL.....AVSVA..S.......D.Y.T...F.......PG............S.E...QI.K.EY.I.ANPDAF--............................................---AV.A.AP...V....A..A...E....T.....S..S...A...P...A......A...E....A..A....A.EE..SE--...................-..EEDD........DMG..FGLF...............................
M2T1B0_COCSN/17-112                    ......................................................................SPSAEDVKSVLNA......VG.I.E.AD.....DERLN..K.......L.I.S...E.......LE............G.K...DI.N.EL.I.ASGSEKLAsvps....................................ggsgGGAAA.A.TG...G....A..A...A....G.....G..A...A...A...A......E...E....A..P....A.AK..EEEK...................E..ESDE........DMG..FGLF...............................
D3S1Z2_FERPA/18-105                    ......................................................................EINEENVKAVLEA......AG.I.E.VN.....EARVK..A.......L.V.T...A.......LE............G.I...NI.D.EA.I.SKAAFV--............................................AAPAA.A.PA...A....P..A...E....E.....A..K...E...E...E......K...K....E..E....K.KE..EEEE..................vK..EEEV........LEG.lGALF...............................
M7XB33_RHOT1/229-312                   ......................................................................YPTLASVTHSLVN......SY.K.N.LL.....AIAVE..T.......E.V.S...F.......PE............A.E...AI.K.DR.L.ANPDAY--............................................AAAAP.V.AA...A....G..G...A....A.....D..T...S...K...A......S...E....E..K....A.PA..EEE-...................-..ESDD........DMG..FGLF...............................
A0A229XGW7_9EURO/17-111                ......................................................................SPSTEDVKAVLSS......VG.I.D.AD.....EERLN..K.......L.I.A...E.......LE............G.K...DL.Q.EL.I.AEGSAKLAsvp.....................................sggaGGAAA.P.AA...G....G..A...A....A.....G..G...A...A...A......A...A....P..A....E.EK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A2G8JRJ1_STIJA/29-123                ......................................................................SPSSDDIKKILGS......VG.I.E.AE.....DDKLN..K.......V.I.S...E.......LK............G.K...NL.E.EL.I.AEGNGKLAsm........................................psG-GAA.P.AA...S....G..G...G....A.....A..A...G...G...A......A...E....E..E....K.KE..EAKKee...............sdS..ESDD........DMG..FGLF...............................
A0A1F5LZA1_9EURO/21-106                ......................................................................EVSADKIQTLIGA......AK.VpE.VE.....PIWAQ..I.......F.A.K...A.......LE............G.K...DI.K.EL.L.TNVGSA--............................................--GPA.A.AA...P....A..A...A....G.....G..A...A...P...A......A...E....E..K....K.EE..KEED..................kE..ESDE........DMG..FGLF...............................
X0CM61_FUSOX/17-109                    ......................................................................SPSAADVKAVLES......VG.I.E.AD.....DERLN..T.......L.I.S...E.......LE............G.K...DI.Q.EL.I.AEGSEKLAsvp......................................sggAGGAA.A.GG...A....A..A...A....G.....G..A...A...E...E......A...K....E..E....E.KE..EEK-...................E..ESDE........DMG..FGLF...............................
I2JUJ7_DEKBR/21-110                    .....................................................................e-LSSENLLKLTHA......AG.L.D.MD.....SVWGN..I.......Y.A.K...A.......LE............G.Q...DL.K.KL.L.INFNIS--............................................SAAAA.P.AA...A....X..A...A....A.....A..G...E...X...D......A...A....E..E....D.EE..KKEEs................eeE..EEDD.......vDMG..MGLF...............................
R0EUX9_9BRAS/22-100                    .....................................................................a-ITADKIATLVKS......AG.V.D.VE.....SYWPM..L.......F.A.K...M.......AE............K.R...NV.T.DL.I.MNVGAGGGgg........................................apVAAAA.P.AA...G....G..G...A....A.....A..A...A...P...A......A...E....E..K....K.KV..----...................-..----........---..----klk............................
S9XIA7_CAMFR/22-113                    .....................................................................t-VTEDKINALIKA......AG.V.N.VE.....PFWPG..L.......F.T.K...A.......LA............N.I...NI.G.SL.L.CNAGAGGPa..........................................pAAGTA.P.AG...G....H..D...P....S.....P..T...A...A...P......A...E....E..K....K.VK..AKKEe.................sE..ENDD........DMG..FALF...............................
A0A0E0I6L3_ORYNI/21-109                .....................................................................p-ITSEKIATLVKA......AN.I.K.VE.....AYWPG..L.......F.A.K...L.......LE............H.R...SV.D.DL.I.LSVGSGGGa..........................................aPVAAA.A.AP...A....A..G...G....G.....A..A...A...A...P......A...A....E..E....K.KE..EAK-...................E..ESDD........DMG..FSLF...............................
A0A068Y975_ECHMU/17-122                .....................................................................r-PQESDIKSILSS......VG.I.E.CE.....QARAK..L.......V.V.D...Q.......LH............G.R...NV.H.DL.I.NAGKEKMStvsfgavp...........................vavatpaggAPTTA.T.AA...A....E..A...P....K.....G..G...D...K...A......P...A....P..A....K.EE..KKEE..................sE..ESDA........DMG..FSLF...............................
E9CCZ9_CAPO3/17-110                    .....................................................................t-PSAADVKAILSS......VG.I.E.AD.....ETKLN..K.......V.I.A...E.......LS............G.K...SL.E.QL.I.AAGSAKLAsv.......................................pagGAAAA.P.AA...S....S..A...A....P.....A..K...E...A...K......K...E....E..P....K.KE..EKKK...................E..ESEE.......gDMG..FGLF...............................
A0A0H2R2S6_9HOMO/232-314               ......................................................................YPTIVSVTHTLVN......AY.K.N.LI.....AVALV..T.......D.F.S...F.......EG............A.E...KI.K.DM.L.ANPDAY--............................................-AAAA.P.AA...V....A..A...A....P.....A..A...E...E...S......K...P....E..E....K.EE..EKE-...................-..ESDE........DMG..FGLF...............................
A0A1J7J678_9PEZI/229-316               ......................................................................YPTLPSVFHSLVN......SY.K.K.VL.....AVAVA..T.......E.Y.S...W.......PA............I.E...EL.K.DR.I.ANPDAY--............................................-AAAA.P.AA...G....G..A...A....D.....S..S...A...P...A......A...A....E..E....A.KD..EDKS..................dE..ESDE........DGG.gFG--dlf............................
A2YT04_ORYSI/17-113                    ......................................................................SPSKDDVRAILGS......VG.A.D.VD.....EAKLD..L.......L.F.E...E.......IA............G.K...DV.P.EL.I.AAGRERLAlaap....................................cggiAAAAA.G.GQ...V....V..A...A....G.....G..A...A...A...A......A...A....E..E....E.AE..EEKE...................E..EEDD........DDG.lFNLF...............................
A0A1E3QSW0_9ASCO/19-103                ......................................................................EITSENLLAITKA......AG.A.S.VD.....SIWAD..V.......F.A.K...S.......LE............G.K...DL.K.QI.L.AGFSAA--............................................GAAPA.A.GA...A....P..A...A....G.....A..S...T...E...A......A...A....E..E....V.AE..EAA-...................E..ESDD........DMG..FGLF...............................
RL12_HALVD/16-112                      ......................................................................EVNEENITAVLEA......AG.V.D.VE.....ESRVK..A.......L.V.A...A.......LE............D.V...DI.E.EA.I.ETAAAA--............................................PAPAA.G.GS...A....G..G...E....V.....E..A...A...D...D......D...D....E..E....D.AE..EEAAdeggd.........ddgddD..EEAD........GEG.lGALF...............................
D7EAE1_METEZ/237-345                   ......................................................................YPTAENITTLISK......GV.S.-.-E.....ARNLG..V.......N.A.T...I.......IE............P.Q...LM.D.TH.L.SKAYSQMLsvaqivydk.........................denavdddlkQTLTS.A.AT...S....K..Q...E....T.....E..S...G...P...T......T...E....E..E....T.KE..SEEE...................E..ESEEe.....sgMAG.lGSLF...............................
V7CH15_PHAVU/234-320                   .....................................................................f-PTLAAAPHMFVN......AY.K.N.VL.....SVAVE..T.......D.Y.S...Y.......PE............A.D...KV.K.EY.L.KDPSKFAV............................................AATVA.P.AA...A....S..G...A....P.....A..A...A...A...A......K...E....E..E....K.KE..EPA-...................E..ESDD........DMG..FSLF...............................
D8LSD6_ECTSI/26-112                    ......................................................................EITSDQLSALITA......TG.N.E.VE.....GYWPT..L.......F.S.G...F.......LA............K.A...GI.E.KL.I.LAASSG--............................................SGGGG.G.GG...G....G..G...D....G....gG..D...A...P...A......A...E....E..E....K.KE..EE--...................E..EEEI........DMG..GGM-dmf............................
I1LTT3_SOYBN/17-110                    ......................................................................SPSADDIKHILGA......VG.A.E.AE.....NELIE..L.......L.L.T...E.......VK............G.K...DF.N.EL.I.ASGSEKMSavs.....................................gggaAVAVA.A.AP...A....G..G...A....A.....A..P...A...A...E......A...K....E..E....K.KV..EEK-...................E..ESDD........DMG..FSLF...............................
A0A194VCY8_9PEZI/21-107                .....................................................................d-ITADKLQTLVKT......AG.V.E.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.TSVGSG--............................................GGAAA.P.AA...G....G..A...A....A.....A..G...G...A...A......E...E....T..K....E.EE..KVEE..................kE..ESDD........DMG..FGLF...............................
A0A078HWW9_BRANA/34-119                ................................lqrkvvqtalsadssggvqssfslvsptsavfqviigg-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.---GSGGGf..........................................aAGGGA.A.AG...G....G..G...G....G.....E..A...A...A...A......T...K....E..E....E.KK..KEES...................E..EEEG........DFG..FDLF...............................
H2Y4S4_CIOSA/17-109                    .....................................................................s-PSGNDIKNILGS......VG.I.D.VD.....DDKLN..M.......V.L.S...Q.......LK............G.K...NL.E.EV.I.AAGNEKLAsvp......................................sggGGAVA.A.SS...G....G..A...A....G.....G..A...E...G...K......K...K....E..E....V.KE..ESE-...................E..ESDD........DMG..FGLF...............................
A0A0A0LV50_CUCSA/234-319               .....................................................................f-PTLAAAPHMLIN......AY.K.N.AL.....AIAVA..T.......E.Y.S...F.......SE............A.D...EI.K.EF.L.KDPSKF--............................................AAAAA.P.AV...A....A..E...S....V.....A..A...A...P...A......A...V....E..E....K.KE..EPE-...................E..ESDE.......gDMI..MGLF...............................
A0A1W5DA60_9LECA/229-313               ......................................................................YPTLPSIVHSLVN......GY.K.R.VL.....AVAVE..T.......D.Y.S...W.......PG............I.E...EL.K.DR.I.ANPDAY--............................................ASAGP.A.AP...A....P..E...E....T.....K..P...D...A...P......E...A....A..K....E.EE..SEK-...................-..EESG........DEG.fGGLF...............................
A0A167PYB1_9BASI/1-55                  ..............................................................mllnvgag-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.--GG---Ap.........................................vaGSGPA.A.AA...G....S..A...A....P.....E..A...A...A...E......E...K....E..E....E.KK..EEEK...................E..ESDD........DMG..FGLF...............................
A0A061DU49_THECC/93-184                .....................................................................s-VTADKIAAIIKA......AN.L.S.VE.....SYWPN..L.......F.A.K...L.......AE............K.R...NL.E.DL.I.ANVGAGGGaa........................................avAVAAP.P.AG...G....G..G...G....G.....A..A...A...P...P......P...A....E..E....K.KK..EEPE...................E..ESDD........DMG..FSLF...............................
I3TDH6_THEC1/23-114                    ......................................................................EINEENVKKVLEA......AG.V.A.VD.....EVRVK..S.......L.V.A...A.......LK............T.I...DI.G.KV.L.EQALAAPV............................................AAAPV.A.QP...V....Q..P...Q....Q.....Q..A...A...E...K......K...E....E..E....K.KE..EEKQ...................EtiSEEQ.......lAEG.lGALF...............................
A0A2A5VVX9_9EURY/16-103                ......................................................................NIDEDAVSAVLTA......AG.V.D.AD.....GGRVK..A.......L.V.A...S.......LG............S.V...DI.G.EA.M.ATAVAAP-............................................VASAA.P.AA...S....G..G...G....G.....A..E...A...A...P......A...E....E..A....A.AE..EEP-...................E..EEDA.......gFEG.lGSLF...............................
A0A077ZUT5_STYLE/32-118                ......................................................................EINGEKLAKVIKA......SG.N.E.VE.....AYWPA..L.......F.A.K...A.......LK............G.Q...DI.E.GL.L.SNLASAPS............................................VGGGA.A.GP...A....A..E...T....T.....A..V...A...A...P......K...K....E..V....V.EE..KKKE...................E..EADV........DMG..-GLF...............................
D7LSI6_ARALL/1-57                      ...................................................................mdy-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.-L.I.MNAGAGGSaa.......................................apvAVSSS.A.SS...S....G..S...A....T.....Q..A...A...P...V......A...E....E..I....K.KE..DEK-...................E..ESDD........DF-..----vsff...........................
A0A197JGX0_9FUNG/20-106                ......................................................................EITSDKLQTLLKA......AN.V.E.VE.....SIWTS..L.......F.A.K...A.......LE............G.K...DV.A.AM.L.SNVGAAGS...........................................aPAAGA.A.AP...A....G..G...A....A.....A..A...E...E...K......A...E....E..K....K.EE..AK--...................E..ESDD........DMG..FGLF...............................
W6KKB3_9TRYP/16-110                    .....................................................................t-PSQSDVEAVLKA......AG.V.A.VD.....SSRIR..S.......L.F.K...E.......LE............G.K...SF.D.EL.C.MEGKSKLGagga....................................aapvS----.G.GA...A....A..A...A....S.....G..A...A...P...A......A...A....V..P....E.AD..NNKAq................pvD..DDED........DMD..FGLF...............................
L0PBR1_PNEJ8/17-106                    .....................................................................c-PTAQDIKKVLES......VG.L.E.AD.....DGRLT..S.......L.F.D...K.......LN............G.H...SI.E.DL.I.AQGKEKLAs..........................................vPSGGA.G.AA...A....P..A...S....A.....A..A...P...V...S......T...E....E..A....P.AK..EEEE...................E..ESDE........DMG..FGLF...............................
Q7PQG7_ANOGA/231-313                   ......................................................................YPTLASVPHSIAN......GF.R.N.LL.....AIAAV..T.......E.V.E...F.......KE............A.E...TV.K.EF.I.KDPSKF--............................................--AAA.T.AT...T....A..S...A....A.....A..P...A...A...K......A...E....E..K....K.VE..SES-...................E..DEDE........DMG..FGLF...............................
A0A2K5KU25_CERAT/22-113                .....................................................................t-VTEDKINALIKA......AG.V.N.VE.....PFWPG..L.......F.A.K...A.......LA............N.V...NN.G.SL.I.CNVGAGGPa..........................................pAAGAA.P.AG...G....P..A...P....S.....T..A...A...A...P......A...E....E..K....K.VE..AKKEe.................sE..EYDD........DMG..FGLF...............................
A0A1Q9DP29_SYMMI/549-634               .....................................................................i-PTEAGLPHAFGN......AF.R.N.VA.....SLIAD..I.......D.F.T...F.......KE............V.E...EV.K.QF.L.EDPEAYA-............................................AANPV.A.AS...G....P..A...A....G.....A..P...A...E...A......K...K....E..E....K.KA..VVE-...................E..EEEE........EMD..FDLF...............................
A0A0E0HF91_ORYNI/33-128                ......................................................................SPSADDIKNILES......VG.V.E.AN.....DERLE..F.......L.L.S...E.......LE............G.K...DI.T.EV.I.AAGREKFAsvp.....................................sgggGGIAV.A.AP...T....A..A...G....G.....G..A...A...P...A......E...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
A0A251SUJ1_HELAN/233-316               ......................................................................YPTIAAAPHMLIN......GY.K.N.LL.....AVAVE..T.......E.Y.S...F.......PL............A.D...KV.K.EY.L.ADPSKF--............................................-AVAA.P.VA...E....A..A...P....A.....A..A...A...A...P......A...E....T..K....K.EE..PKE-...................E..SDDE........DFG..ISLF...............................
A0A0D2XDL8_FUSO4/229-312               .....................................................................f-PTLPSVLHSVVN......SY.K.K.VL.....AVAIS..T.......E.I.T...W.......PE............I.E...EL.K.DR.I.ANPDAY--............................................-ASAA.P.AA...A....A..S...G....G.....A..A...A...P...A......E...A....E..K....K.DE..SEE-...................-..EDED........EEG.fGGLF...............................
A0A2I2UUJ2_FELCA/18-90                 ....................................................................nd---EDKINALIKA......AV.V.N.VE.....PFWLG..L.......F.A.K...A.......LA............N.V...NI.R.SL.T.CSVWAG--............................................--GPA.P.AA...G....A..P...P....A.....G..G...S...G...G......D...K....R..S....R.--..----...................-..----........---..----kngeeggr.......................
G0NY22_CAEBE/231-311                   ......................................................................YPTLASVAHSLAT......GL.Q.N.ML.....GVAAV..T.......D.V.T...F.......KE............A.E...TI.K.AY.I.ADPSKF--............................................---AA.A.AP...A....A..A...A....A.....P..A...A...A...A......P...A....A..K....K.EE..PK--...................E..ESDD........DMG..FGLF...............................
A0A0M9VXK6_9HYPO/21-107                ......................................................................EITAEKIQAVIAA......AG.L.E.VE.....AVWAS..I.......F.A.K...A.......LE............G.K...DV.K.DL.L.VNVGSG--............................................GGAAA.P.AA...G....G..A...A....A.....A..G...G...A...A......E...E....A..K....V.EE..KEEE..................kE..ESDE........DMG..FGLF...............................
W5L8X7_ASTMX/100-184                   ......................................................................YPTLASIPHSVIN......GY.K.R.VL.....AVAVE..T.......D.I.S...F.......PL............A.D...KV.K.AF.L.ADPSAF--............................................AAVAA.P.AA...A....A..E...V....S.....A..A...A...P...A......A...A....A..E....P.AK..EES-...................E..ESDE........DMG..FGLF...............................
A0A1Q9P1A8_9ARCH/16-99                 ......................................................................SITADSLKKIAKA......AG.V.V.AD.....DSQIN..A.......L.V.A...T.......LD............G.V...NI.E.EA.I.ASSPMM-A............................................AVPSA.A.AP...A....A..S...A....D.....S..G...A...A...P......K...K....E..-....P.KE..EKK-...................-..-DDE........DLG.lDSLF...............................
A0A0L7LLV1_9NEOP/7-61                  ...........................................................yllavlggkaa-PAASDVEKILSS......VG.I.E.AD.....GEKLK..K.......V.I.K...E.......LN............G.K...DV.E.EL.I.AAGE----............................................-----.-.--...-....-..-...-....-.....-..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----fc.............................
M3HIT8_CANMX/17-108                    .....................................................................s-PAAADISALLES......VG.V.E.VE.....ESRLQ..L.......L.L.K...E.......LE............G.K...DL.Q.EL.I.AEGNTKFAs.........................................vpSGGAA.A.SS...G....A..A...A....A.....S..G...A...A...A......T...E....E..A....A.EE..EEEA..................kE..ESDD........DMG..FGLF...............................
A0A1Q9P2L1_9ARCH/16-104                ......................................................................EITEEGITKVLKA......AG.V.T.AD.....KSRVK..A.......L.V.A...A.......LG............E.V...DI.N.EA.L.VSAVMA--............................................APAAA.P.AA...A....A..G...A....K.....S..S...A...T...A......E...D....A..V....E.EE..EEEEg.................eE..IEDD........DEG.lGSLF...............................
A9V5U8_MONBE/22-104                    ......................................................................EVTDEKITTLLKT......AG.V.E.FE.....PYWPG..L.......F.A.K...A.......LA............G.K...DI.K.DM.L.SNVGS---............................................-ASAA.P.AA...A....A..A...P....A.....A..A...A...E...E......K...K....E..E....K.KE..ESE-...................-..DEDE........DMD.gFSLF...............................
RLA0_CHICK/231-315                     ......................................................................YPTIASVPHSIVN......GY.K.R.VL.....AVAVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFVA............................................AAPVV.V.ET...A....A..P...A....A.....A..A...A...P...A......K...E....A..P....K.EE..SE--...................-..ESDE........DMG..FGLF...............................
A0A2I3LSE1_PAPAN/20-98                 ............................................................evtvtekina-------------......--.-.-.--.....----L..I.......K.A.A...G.......LA............N.V...NI.G.SL.L.CNVGAGGPa..........................................pAAGSA.P.TG...A....S..A...R....S.....A..A...A...A...P......A...E....E..K....K.VE..AKKEe.................sE..KSDD........DMG..FGLF...............................
W2QB22_PHYPN/231-311                   .....................................................................i-PTLASIPHSIAN......AF.K.D.LV.....AIAVE..C.......EeF.S...F.......EK............A.E...PY.K.AF.L.ADPSAF--............................................---AV.A.AP...A....G..G...A....A.....-..-...-...-...A......T...E....E..K....K.EE..AVE-...................E..EEEV........DMG..GGM-dmf............................
A0A175W089_9PEZI/17-109                ......................................................................SPSAADIKALLES......VG.I.E.AD.....DERLE..K.......L.L.S...E.......LD............G.K...DI.N.EL.I.AEGSTKLAsvp......................................sggGGGAA.A.AG...G....A..A...A....G.....G..G...A...E...A......P...K....E..E....E.KE..EEK-...................E..ESDE........DMG..FGLF...............................
I1QF51_ORYGL/21-109                    .....................................................................p-ITSEKIATLVKA......AN.I.K.VE.....AYWPG..L.......F.A.K...L.......LE............H.R...SV.D.DL.I.LSVGSGGGa..........................................aPVAAA.A.AP...A....A..G...G....G.....A..A...A...A...P......A...A....E..E....K.KE..EAK-...................E..ESDD........DMG..FSLF...............................
B9RNK0_RICCO/21-112                    .....................................................................p-ITAEKIAQLVKA......AN.V.Q.IE.....SYWPS..L.......F.A.K...L.......AE............K.R...NI.E.DL.V.MNVGSGGGgap......................................vavAAPAG.G.AA...A....G..G...A....A.....A..-...A...A...P......P...P....E..E....K.KE..EPQ-...................E..ESDD........DMG..FSLF...............................
A0A166UK57_9PEZI/229-312               .....................................................................f-PTLPSVIHSFFN......SY.K.N.VL.....AIAIE..T.......E.I.S...W.......PE............I.E...QL.K.DR.I.ANPDAY--............................................---AS.A.AP...A....A..A...A....G.....G..A...A...E...A......K...E....E..E....K.EA..EKSD...................E..ESDE........DGG.fGGLF...............................
A0A0F4YT67_TALEM/21-126                ......................................................................EITADKLNTLIKT......AN.VpE.VE.....PIWSQ..I.......F.A.K...A.......LE............G.K...DV.K.EL.L.TNVGSAGA...........................................aAPAAA.A.AP...A....A..G...G....A.....A..P...E...A...A......A...E....E..K....K.EE..KKKEegknlplt...mclfpaitE..ESDE........DMG..FGLF...............................
A0A0Y9UDG7_PLABE/19-110                .....................................................................n-PGKKEIKNVLSA......VN.A.E.VE.....EEVLG..N.......L.L.D...S.......LK............G.K...SY.H.EL.I.SEGLKKLQnv........................................ggGAAAA.A.AA...P....V..A...G....D.....T..G...D...S...K......K...E....E..K....K.EE..KEEE...................E..EEED........DLG..FSLF...............................
A0A0V0R7S0_PSEPJ/29-108                .....................................................................d-ITADRLESILKA......SN.V.A.TS.....AALSK..V.......F.A.R...A.......LE............G.K...DV.K.EF.F.AGGA----............................................-GGDA.P.VQ...A....Q..A...Q....G.....Q..A...P...A...A......A...Q....E..E....A.KP..EEP-...................-..EEDM........DMG..-GLF...............................
A0A1S3MIY2_SALSA/17-115                .....................................................................s-PSSQNIKDILGS......VG.I.E.AD.....DQRLA..K.......V.I.S...E.......LM............G.K...DI.N.EV.L.NAGMSKLAsvpv....................................ggavAVSAA.G.GS...A....A..V...A....P.....G..A...A...P...A......S...E....E..K....K.KE..EEKKe................esE..ESDE........DMG..FGLF...............................
A6R7C5_AJECN/21-109                    ......................................................................EVTADKLQTLLKA......AN.VqD.VE.....PIWST..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNIGSGGG............................................AAAAV.A.SG...A....G..P...V....A.....A..E...T...G...G......A...E....E..K....V.EK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A195FCE2_9HYME/231-317               ......................................................................YPTVASAPHSIVN......GF.K.N.LL.....AVAAV..T.......E.V.E...F.......AE............A.T...TI.K.EY.V.KDPSKFAV............................................AAAAV.V.TP...A....A..A...A....A.....D..A...P...A...A......E...K....K..E....E.KK..EES-...................D..SEDD........DMG..FGLF...............................
A0A1B8G8I0_9PEZI/229-311               .....................................................................f-PTLPSVMHSVVN......SY.K.N.VL.....AVAVS..T.......E.Y.S...W.......TE............I.E...EL.K.ER.I.ANPEKF--............................................--ASA.T.VA...T....T..S...D....A.....P..K...A...A...A......A...E....E..K....K.EE..SEA-...................-..EESG........DEG.fGGLF...............................
F7HAM2_CALJA/21-81                     .....................................................................t-VTEDKIHALIKA......AG.V.N.VE.....PLCPG..L.......F.A.K...T.......LA............S.V...NI.G.SL.I.CNVGACGP............................................ATAAG.A.AP...A....G..-...-....-.....-..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----gppl...........................
A0A183G5C8_HELBK/170-260               .....................................................................a-ITGDKIATLLKA......AN.V.E.FE.....PFWPG..L.......F.A.K...A.......VE............G.V...DV.K.NL.I.TSVASGAGsa........................................gpAAPAA.G.AA...A....P..A...A....A.....A..A...A...P...A......A...E....T..K....K.KE..EVK-...................E..ESDD........DMG..FGLF...............................
E2B864_HARSA/22-110                    .....................................................................a-VTGEKIQTILKA......AN.V.N.VE.....SYWPG..L.......F.A.K...A.......LE............G.I...NV.K.EL.I.TNIGSGVGa.........................................apAGAGA.P.AA...A....A..P...A....S.....T..E...A...A...P......A...K....E..E....K.KK..EEPE...................E..ESDD........DMG..FG--...............................
W9QTA2_9ROSA/17-115                    .....................................................................s-PSAGDLKDILSS......VG.V.E.PD.....EGRIQ..L.......L.L.T...E.......VK............G.K...DI.T.EL.I.ASGREKLAsvpsg..................................ggavaYSAPA.G.GA...G....G..G...A....D.....A..P...A...A...A......A...E....S..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
H0ZQZ1_TAEGU/22-113                    .....................................................................t-VTEDKINALIKA......AG.V.N.VE.....PFWPG..L.......F.A.K...A.......LA............N.I...DI.G.SL.I.CNVGAGGGg..........................................aPAAAA.P.AG...G....A..A...P....A.....G..G...A...A...P......A...E....E..K....K.EE..EKKEe.................sE..ESDD........DMG..FGLF...............................
A0A251S133_HELAN/1-51                  .................................................................mnvga-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.--GGGGGA............................................PAVAA.P.GG...G....G..G...A....A.....A..A...A...A...P......P...P....E..E....K.KE..EIE-...................E..ESDD........ELG..FGLF...............................
A0A1S3JLM9_LINUN/22-112                .....................................................................p-ITAEKISTILKA......AD.Y.S.VE.....PYWPG..L.......F.S.K...A.......LE............G.I...NI.K.DL.I.SNVGSSVGa..........................................aPAAGG.A.AP...A....A..G...D....A.....G..A...G...A...A......K...E....E..A....K.EE..KKEE..................sE..ESDD........DMG..FGLF...............................
W1QEQ6_OGAPD/17-108                    ......................................................................SPSAADITALLES......VG.A.E.IE.....QEKLN..L.......L.L.S...S.......LE............G.K...SV.E.EL.I.AEGATKLAs.........................................ipAGGAA.P.AA...A....G..A...A....A.....S..G...A...A...A......E...E....A..A....A.EE..EEAA..................eE..EEDD........DMG..FGLF...............................
A0A1R3KG69_COCAP/17-113                .....................................................................c-PSADDIKEILGA......VG.A.E.AE.....NDRIQ..L.......L.L.S...E.......VK............G.K...DI.T.EL.I.ASGREKLAsvps....................................ggggVAVAA.A.AP...G....G..G...G....G.....A..A...P...A...A......A...E....S..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
W6QLH1_PENRF/21-106                    ......................................................................EVSADKIQTLITA......AK.VqE.VE.....PIWAS..I.......F.A.R...A.......LE............G.K...DI.K.DL.L.TNVGSA--............................................-GPAA.A.AP...A....G..G...A....A.....A..A...A...P...A......E...A....K..A....E.EK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A1S2XL12_CICAR/234-320               ......................................................................YPTLAAAPHMFVN......AY.K.N.VL.....AVAVA..T.......E.Y.S...F.......PE............A.D...KV.K.EF.L.KDPSKFAV............................................AAVAT.P.AA...D....S..G...A....A.....P..A...A...A...A......K...E....E..E....K.KD..EPA-...................E..ESDD........DMG..FSLF...............................
A9PA46_POPTR/21-108                    ......................................................................SITAEKIATLVKA......AN.V.Q.IE.....SYWPG..L.......F.A.K...L.......AE............K.R...NI.E.DL.I.MNVGSGGG............................................AAVAV.A.AP...A....G..G...A....P.....A..A...D...A...P......A...A....E..E....K.KE..PVKE...................E..SEDE........DMG..FSLF...............................
A6UTF7_META3/16-98                     ......................................................................EITEDAVSAILSA......AG.V.E.VV.....DARVK..A.......L.V.A...A.......LD............G.V...DI.E.EA.I.SKAAAA--............................................--PVA.V.AA...A....P..A...A....E.....E..A...K...E...E......A...K....E..E....K.KE..EE--...................-..NSEA.......aAAG.lGALF...............................
A0A0F8XGE4_9EURO/229-312               ......................................................................YPTLPSVIHSVLN......SY.K.K.VL.....AIAVE..T.......E.Y.S...W.......PE............I.E...EL.K.DR.I.ANPDAY--............................................AS-AA.P.AA...A....A..A...A....G.....G..A...A...E...A......A...P....A..A....A.PE..EPE-...................E..ESDD........DMG..FGLF...............................
A0A0D9MYH1_ASPFA/21-108                ......................................................................EVTADKLQTLLTA......AK.VqE.VE.....PIWTS..I.......F.A.K...A.......LE............G.K...DI.K.DL.L.TNVGSGGA............................................APAGA.A.AA...A....G..G...A....A.....A..P...A...E...A......A...A....E..E....K.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A091UHF5_PHORB/17-114                ......................................................................SPTSKDLKKILDS......VG.I.E.TD.....DERMN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGNGKLAsmpa....................................ggavAVSAG.G.GS...A....A..P...A....A.....A..A...A...P...A......A...A....E..E....K.KE..EKKEe.................sE..ESDD........DMG..FGLF...............................
A0A1A8WY88_PLAMA/19-111                .....................................................................n-PGEKEVKNVLGA......VN.A.G.VE.....DEVLK..N.......F.I.S...S.......LK............G.K...VY.H.EL.I.TDGLKKLQni.......................................gggGGAAA.G.GP...A....A..A...E....A.....G..E...A...K...K......E...E....K..K....E.EK..KEEE...................E..EEED........DLG..FSLF...............................
T1HH04_RHOPR/213-295                   ......................................................................YPTIASVPHSIAN......GF.K.N.LL.....AVAAE..T.......E.V.S...F.......KE............A.D...TI.K.EY.L.KDPSKF--............................................-AVAA.P.VA...A....E..A...P....K.....A..A...E...A...P......K...K....E..E....K.KE..ESE-...................-..ESDD........DIG..FGLF...............................
A0A1U8LLR2_GOSHI/234-320               .....................................................................f-PTLAAAPHMFIN......AY.K.T.AL.....SLAVA..T.......E.Y.T...F.......PQ............A.E...KI.K.EY.L.KDPTKFAV...........................................aVGGDA.A.AP...A....T..S...A....K.....E..E...K...A...E......Q...S....E..P....A.KE..EE--...................E..ESDE........DLV..AGLF...............................
N4UH12_FUSC1/17-109                    ......................................................................SPSAADVKAVLES......VG.I.E.AD.....DERLN..T.......L.I.S...E.......LE............G.K...DI.Q.EL.I.AEGSEKLAsvp......................................sggAGGAA.A.GG...A....A..A...A....G.....G..A...A...E...E......A...K....E..E....E.KE..EEK-...................E..ESDE........DMG..FGLF...............................
M0P877_9EURY/16-109                    ......................................................................EINEDNITGVLEA......AG.V.D.VE.....ESRVK..A.......L.V.A...A.......LE............D.V...DI.E.EA.I.ETAAAAPAa..........................................gAAAGG.A.AA...A....E..E...S....D.....D..G...D...D...E......A...D....E..A....D.AD..DEDD..................eE..EEDD........DGG..EGL-gelf...........................
I3EIJ4_NEMP3/21-99                     .....................................................................t-VTEENIKKVADH......LG.V.T.VD.....SYLAE..L.......F.S.K...-.......LS............A.E...QI.Q.SI.I.ENPTGG--............................................---SV.Q.AA...A....A..T...S....T.....Q..A...V...E...E......K...K....E..E....K.EE..SEE-...................-..ESSG........DMD.lF---g..............................
A1C664_ASPCL/17-110                    ......................................................................SPSAADVKEVLSS......VG.I.D.AD.....EERLN..K.......L.I.A...E.......LE............G.K...DL.Q.EL.I.AEGSTKLAsip......................................sggAGGAA.P.AA...G....G..A...A....A.....G..G...A...A...E......A...A....P..A....E.EK..EEEK...................E..ESDD........DMG..FGLF...............................
W0K3A8_9EURY/16-113                    .....................................................................e-LNEENITGVLEA......AG.V.D.VE.....ESRVK..A.......L.V.A...A.......LE............D.V...DI.E.EA.V.EQAAAA-P............................................AAGAA.P.AG...G....A..A...E....A.....D..E...A...E...A......E...E....A..D....E.EE..PEAEaede...........gdddD..----........---..----eeeeasgeglgdlf.................
A0A151N9F0_ALLMI/43-117                ......................................................................SPTAKNIKKILSS......VG.I.D.AD.....DERVD..K.......V.I.S...E.......LS............G.K...DV.D.DV.I.NSGLSKLTcv........................................paGGAVA.A.AP...A....A..P...A....G.....G..G...A...A...P......A...E....-..-....-.--..----...................-..----........---..----ivde...........................
W6ZGB8_COCMI/17-112                    ......................................................................SPSAEDVKSVLSA......VG.I.E.AD.....DERLN..K.......L.I.S...E.......LE............G.K...DI.N.EL.I.ASGSEKLAsvps....................................ggsgGGAAA.A.AG...G....A..A...A....G.....G..A...A...A...A......E...E....A..P....A.AK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A1L0DN57_9ASCO/229-311               ......................................................................YPTLPSVGHSVVN......HY.K.N.VL.....ALSIA..T.......D.Y.T...F.......EG............S.E...AI.K.DR.L.ANPEAY--............................................-AAAA.P.AA...A....A..A...G....G.....D..S...S...A...A......A...E....D..A....P.AE..EEE-...................-..ESDD........DMG..FGLF...............................
A0A1Q9E0V8_SYMMI/86-178                .....................................................................d-ITPASMSTLIKA......AG.C.N.VE.....GYWPM..I.......M.S.K...M.......VNsv........gvE.V...QL.Q.ER.L.GSGAGGGGgg........................................ggGGAAA.G.AA...A....G..G...A....G.....G..G...E...A...K......A...E....E..K....K.VE..EE--...................-..EEEE........EMD..FDLF...............................
M4EWV0_BRARP/63-153                    ......................................................................SITADKIATLIKS......AG.V.S.CE.....SYWPM..L.......F.A.K...M.......AE............K.R...NV.T.DL.I.MNVGAGGGgg........................................apVSAAA.P.AA...G....G..G...A....A.....A..A...A...P...A......A...E....E..K....K.KE..EVA-...................E..ESDG........DLG..FGLF...............................
A9S6G5_PHYPA/17-113                    ......................................................................SPSAKDIEAILGA......VG.A.E.AD.....ASRVS..L.......L.L.K...E.......LE............G.K...DI.L.EV.I.AAGKEKFAsvpsg..................................ggggvVVASG.G.GS...S....A..A...A....A.....P..A...E...E...K......K...E....E..A....K.KE..EEK-...................E..ESDD........DMG..FSLF...............................
A0A061GR04_THECC/18-120                ..............kqlegelegsaasayelqrklvqcatavdssggvsssfslitpksavfqviigggg-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.-----GGGf.........................................lgGGAAA.P.AG...G....A..A...P....A.....A..E...A...P...A......A...E....E..K....K.KE..EKVE...................E..SDDE........DMG..FSLF...............................
J7S764_KAZNA/229-312                   ......................................................................YPTLPSVGHTLIN......NY.K.N.LL.....AVAIA..S.......G.Y.H...Y.......AE............I.E...EL.I.DR.I.ENPDKY--............................................AS-AA.P.VA...A....A..A...G....G.....A..A...E...S...G......A...A....E..E....A.AE..EEE-...................E..ESDA........DMG..FGLF...............................
A0A059BIC8_EUCGR/233-319               ......................................................................YPTLAAAPHMFIN......AY.K.N.VL.....AVAVE..T.......E.Y.S...Y.......PH............A.D...EV.K.EF.L.KDPSKFAV............................................AVAPA.G.AA...D....S..G...A....A.....P..A...A...A...A......K...E....E..E....K.KD..EPA-...................E..ESDD........DMG..FSLF...............................
A0A0Q4B269_9EURY/16-102                ......................................................................EITDDAIAAILSA......AG.V.E.AD.....AAKIK..A.......L.T.A...S.......LE............G.V...DI.K.EA.I.ASASVM--............................................--AAP.A.AG...A....A..P...A....A.....A..A...A...A...P......G...E....E..K....K.EE..PEEEa.................vS..EEEA........AAG.lSALF...............................
A0A094GEC3_9PEZI/64-151                .....................................................................d-ITAEKLQTLIAA......AK.VaD.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGSGGG............................................APAAG.G.AA...A....G..G...A....A.....A..A...S...E...D......A...P....V..E....E.KE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A0N5E0B1_TRIMR/58-147                .....................................................................k-VSVDGIKSILKA......AN.V.Q.VE.....AVWPD..L.......F.A.N...A.......LE............S.V...SV.G.DL.V.STIGGGVGa..........................................gVVAAA.P.VV...A....A..E...V....P.....A..E...G...A...K......A...P....E..K....K.EE..KKEE...................S..ESDE........DMG..LGLF...............................
U4LVS9_PYROM/228-312                   ......................................................................YPTLPSVIHSVVN......AY.K.K.AV.....SVALC..T.......D.Y.S...W.......EA............I.D...EL.K.DR.I.ANPDAY--............................................AS-AA.P.AA...A....A..S...G....S.....A..P...E...A...S......K...T....E..E....K.KD..EEE-...................E..ESEE........DGG.fGGLF...............................
A0A1J9PR42_9EURO/229-312               .....................................................................f-PTLPSVMHSVVN......SY.K.N.MI.....AIAVE..T.......E.Y.G...W.......SE............I.E...EL.K.DR.I.ANPEAY--............................................---AV.A.AP...T....A..E...A....T.....K..G...E...E...S......K...E....D..T....K.KE..ESEA...................E..ESED........EGG.fGDLF...............................
A0A1U8JIR4_GOSHI/16-114                sakqlegeiessaastyelqrklvqaatacdssggvtssfsvvtpnsaafqvviggavggafiggxxxxx-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.--------............................................-----.-.--...-....-..X...A....A.....A..A...E...A...P......A...A....E..E....K.KE..EKE-...................-..ESDD........DMG..FSLF...............................
I0YK96_COCSC/20-115                    ......................................................................SPSADDINKILGS......VG.I.E.AD.....SERVD..A.......L.L.K...E.......LD............G.K...DI.A.EV.I.ASGVSKLAsvps...................................gggavAASGG.G.GG...G....G..G...G....G.....G..A...E...A...A......K...E....E..E....K.KE..EEE-...................E..EEDE........DMG..FSLF...............................
RLA2_MOUSE/17-114                      ......................................................................SPSAKDIKKILDS......VG.I.E.AD.....DDRLN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGVGKLAsvpa....................................ggavAVSAA.P.GS...A....A..P...A....A.....G..S...A...P...A......A...A....E..E....K.KD..EKKEe.................sE..ESDD........DMG..FGLF...............................
RLA2A_MAIZE/17-111                     ......................................................................SPSADDLTAILES......VG.C.E.VD.....NEKME..L.......L.L.S...Q.......LS............G.K...DI.T.EL.I.AAGREKFAsvp......................................cggGGVAV.A.AA...A....P..A...A....G.....G..A...A...P...A......A...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
R0HZN3_9BRAS/233-319                   ......................................................................YPTLAAAPHMFIN......AY.K.N.AL.....AIAVA..T.......E.Y.T...F.......PQ............A.E...KV.K.EF.L.KDPSKF--............................................AVAVA.A.VS...A....D..A...G....G.....G..A...Q...A...A......A...A....P..K....V.EE..KKEE..................sD..EEDY........DGG..FGLF...............................
A0A151F372_9EURY/16-100                ......................................................................EVTEENLKSIIKA......AG.G.T.PD.....EVQIR..Q.......L.L.A...A.......LE............G.V...DI.K.EA.L.SKAVAA--............................................PVAVA.A.AA...P....V..A...A....E.....K..G...E...T...K......K...E....E..E....E.KE..EAK-...................-..EEEA........LEG.lGALF...............................
A0A1V6R9H6_9EURO/17-108                .....................................................................a-PSAADIKAVLSS......VG.I.D.AE.....GDRLD..K.......V.I.S...E.......LQ............G.K...DL.Q.QL.I.AEGSTKLAsv.......................................psgGAGGA.A.AP...A....A..A...G....G.....A..A...A...A...A......P...A....E..E....K.EE..EKE-...................E..ESDE........DMG..FGLF...............................
L9KS94_TUPCH/44-138                    ...................................................................lrv----KDFKKILDS......VG.I.K.TD.....HNQLN..K.......V.I.S...E.......LN............G.K...NM.K.DV.I.AHGIGKLAafpl....................................awqwHSAAL.G.SA...A....P..A...A....G.....S..A...S...A...A......T...E....E..E....K.VE..KGES...................G..KSND........DMG..FGLF...............................
A0A1G4IZ11_9SACH/19-106                .....................................................................d-ITADSLTTLTKA......AG.A.S.ID.....NVWAE..T.......F.A.K...A.......LE............G.K...DL.K.QV.L.SGFHAAGS...........................................gSASAG.G.AS...A....G..A...A....A.....A..G...D...A...A......A...E....E..E....A.PE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A287A934_PIG/198-276                 ............................................................htsyptvasw-------------......--.-.-.VL.....ALSVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFVA............................................AA-PV.A.AT...T....T..A...A....S.....A..A...A...A...A......A...P....A..K....V.GA..KEES...................E..ESGE........DMG..FGL-...............................
A0A194VQP3_9PEZI/17-109                .....................................................................k-PASGDVKKVLES......VG.I.E.AD.....SDRLE..K.......L.L.S...E.......LE............G.K...DI.N.EL.I.AEGSSKLAsvp......................................sggAGGAP.A.AA...G....A..A...A....G.....G..A...A...E...P......A...A....E..E....K.KE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A095AN35_SCHHA/17-112                .....................................................................k-PTENDIKTVLNS......VG.I.E.HD.....SERLD..K.......L.L.S...S.......IS............G.K...DI.P.QL.I.AEGSTKLSsip.....................................ssgaVVSSA.P.AA...A....A..S...S....K.....T..E...A...P...Q......E...V....K..P....A.KV..EVKE...................E.sESDE........DMG..FGLF...............................
A0A0P7XY39_9TELE/22-112                .....................................................................t-VTEDKLNALIKA......AG.V.T.VE.....PFWPS..L.......F.A.K...A.......LA............S.V...DI.G.SL.I.CSVGAGGGa..........................................pVAAAT.G.AP...A....A..A...A....A.....G..A...A...P...A......E...E....E..K....K.EE..KKEE..................sE..ESDD........DMG..FGLF...............................
A0A0F4GXM4_9PEZI/17-110                ......................................................................SPSAEDIKGVLSA......VG.I.E.AD.....EERLT..Q.......L.L.S...E.......LE............G.K...DI.N.EL.I.TEGSAKLAsvp.....................................sggaAAPAA.G.GA...A....A..G...G....A.....A..A...T...E...A......A...P....E..A....A.KE..EEK-...................E..ESDE........DMG..FGLF...............................
S0E8J0_GIBF5/17-109                    ......................................................................SPSAADVKAVLES......VG.I.E.AD.....DERLN..T.......L.I.S...E.......LE............G.K...DI.Q.EL.I.AEGSEKLAsvp......................................sggAGGAA.A.GG...A....A..A...A....G.....G..A...A...E...E......A...K....E..E....E.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A0B2RNV2_GLYSO/234-319               .....................................................................y-PSIAAAPHMFVN......SY.K.N.IL.....AVAVA..T.......E.Y.S...F.......PE............A.D...KV.K.EY.L.KDPSKFAV............................................AVVAA.P.AT...K....S..G...A....A.....P..A...A...A...S......K...V....E..E....K.KE..EA--...................D..ESDD........DMG..FSLF...............................
H2LZD7_ORYLA/132-215                   ......................................................................YPTLASIPHSVIN......GY.K.R.VL.....AVAVE..T.......D.Y.T...F.......PQ............A.E...KV.K.AF.L.ADPTAF--............................................AAVAA.P.AA...A....A..E...T....A.....A..A...A...P...A......A...K....E..E....V.KE..ESE-...................-..ESDE........DMG..FGLF...............................
A0A218NNM9_9ARCH/16-101                .....................................................................d-ISEQSMTEVIKA......AG.L.T.PD.....EAKVK..S.......V.V.E...S.......LK............G.V...DI.K.SV.I.ENAQSM--............................................QVAAA.P.GK...A....E..A...K....A.....E..G...K...K...E......S...K....A..E....A.KS..EAK-...................S..EEEA........AGG.lAGLF...............................
A0A182FNS5_ANOAL/231-315               ......................................................................YPTLASVPHSIAN......GF.R.N.LL.....AIAAV..T.......E.V.E...F.......KE............A.E...TV.K.EF.I.KDPSKFA-............................................AANAS.A.AP...A....A..A...A....A.....S..A...A...P...A......A...K....A..E....E.KE..ESE-...................-..DEDE........DMG..FGLF...............................
E3S6K2_PYRTT/21-111                    .....................................................................d-ITADKLQSLIKA......AN.IeD.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGSGGGa.........................................apAAGAA.A.GA...A....A..G...G....A.....D..A...A...E...P......A...A....E..E....K.KE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A0V1K4Y5_TRIPS/231-318               ......................................................................YPTAASAPHMIAN......AF.K.N.LL.....SIAAV..T.......D.I.T...F.......KE............A.E...KL.K.EY.L.ADPSKFA-............................................VAAAP.A.AS...A....A..A...A....P.....K..A...E...K...E......D...S....S..S....K.KE..EKVE...................E..ESDE........EEG.mGGLF...............................
A0A2K5JVY5_COLAP/231-317               ......................................................................YPTVASVPHSIIN......GY.K.R.VL.....ALSVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFVA............................................AA-PV.A.AA...T....T..A...A....P.....A..A...A...A...A......A...P....A..K....V.EA..KEES...................E..ESDE........DMG..FGLF...............................
W7L7T8_9CREN/16-103                    ......................................................................EITEESLKNVLTA......AG.V.Q.AD.....DVRIK..A.......V.V.A...A.......LK............E.V...NI.D.EV.L.KNAAAM--............................................PVAAA.P.AP...A....A..T...E....E.....K..K...E...A...K......E...E....K..K....E.EE..EKKG..................pS..EEEI........AGG.lSSLF...............................
D8SB36_SELML/32-119                    ..................................lelqkqmrdlalqsagagavsvdfalitpsagvlqv-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.I.VGGGAGGAa.........................................faSGGGA.P.AA...G....G..A...A....A.....A..A...P...A...P......A...E....E..E....K.KE..EKEA...................-..SEDE........DMG..FSLF...............................
A0A094AE68_9PEZI/66-153                .....................................................................d-ITAEKLQTLITS......AK.ViD.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGSGGG............................................APAAG.G.AA...A....G..G...A....A.....A..A...T...E...D......A...P....A..E....E.KE..EEK-...................E..ESDE........DMG..FGLF...............................
G8YFW0_PICSO/80-163                    ......................................................................EITSDNLLAVTKA......AG.A.N.VE.....NIWAD..V.......Y.A.K...A.......LE............G.K...DL.K.EL.L.FSFA----............................................AAAPA.A.AP...A....G..G...D....A.....A..A...A...G...E......T...E....A..A....K.EE..APAE...................E..ESDE........DLG..MGLF...............................
G3B9G8_CANTC/17-109                    .....................................................................a-PSASDVSSLLSA......VN.A.D.VD.....EARIS..A.......L.L.K...E.......LE............G.K...DI.Q.EL.I.AEGNTKLAsv.......................................ptgGAAAS.S.GA...G....A..A...A....G.....G..A...A...A...A......E...E....E..A....A.AE..EEEK...................E..ESDD........DMG..FGLF...............................
R9T4G7_METII/9-101                     ..............................................................vlhaagka-VDEDAIANVLKS......AG.V.E.PD.....AAKIK..S.......L.T.A...S.......LE............G.V...NI.D.EA.I.ASAAIA--............................................PVAAA.A.PA...A....A..A...A....P.....A..D...V...P...K......S...A....E..E....E.KK..EEV-...................S..EDEA........AAG.lAALF...............................
A0A061FL90_THECC/234-319               ......................................................................YPTLAAAPHMFIN......AY.K.N.VL.....ALAIA..T.......E.Y.S...F.......PQ............A.D...KV.K.EY.L.ADPSKF--............................................AVAAA.P.VA...A....D..A...G....A.....A..P...A...A...P......A...A....V..E....E.KK..PEPE...................E..ESDD........DMG..FSLF...............................
Q5CR36_CRYPI/239-317                   .................................................................iptlp-----SARDGIIS......SF.R.N.CV.....ALGLD..V.......D.F.D...F.......PE............M.Q...AI.K.NA.L.ANPSSF--............................................VA-AS.T.AA...D....N..T...T....A.....V..G...A...S...A......P...-....-..-....-.VE..EEE-...................-..EEEG........DLG..FSLF...............................
A0A1D1VXI9_RAMVA/22-113                .....................................................................a-VTGDKIQTLLKA......AS.V.D.VE.....PYWPD..L.......F.A.R...S.......LE............S.V...SL.K.EL.V.SSFGSAAP............................................-AAAP.A.AA...A....A..P...A....A.....A..A...A...P...A......A...E....D..K....G.KK..EDKKaa..............keeE..PEDE........DMG..FGLF...............................
A0A0V1PJV9_9BILA/22-119                ......................................................................NPEVADLKKIITS......AT.D.E.FD.....ESKAK..M.......V.V.D...S.......CK............G.N...DL.L.KL.I.AEGATKLSsvpsg.................................pavatgGASVA.A.DA...A....A..P...A....A.....T..E...S...S...K......K...E....D..S....K.KK..EES-...................E..EEDE........DMG..FGLF...............................
RLA2_BRUMA/18-113                      ......................................................................SPSAKDIEDVLGS......VG.L.D.VD.....MEDAN..K.......V.V.S...A.......LS............G.K...SI.D.EV.I.TAGLAKVSsv.......................................psdAAVSA.I.AP...V....V..S...A....T.....P..T...D...A...L......Q...A....G..S....K.KG..ETKEg................pkE..ESDE........DMG..FGLF...............................
RLA2_CAEEL/17-106                      ......................................................................SPSAQDVLKVLEA......GG.L.D.CD.....MENAN..S.......V.V.D...A.......LK............G.K...TI.S.EV.I.AQGKVKLSs.........................................vpSGGSA.P.AA...A....A..P...S....G.....G..A...A...P...K......A...E....E..K....K.KE..EPK-...................E..ESDD........DMG..FGLF...............................
H3GGS5_PHYRM/27-114                    ......................................................................EITPESINHILHA......SG.N.E.VE.....PYWPN..L.......F.S.S...L.......LS............K.E..gKV.I.EI.I.STGGAAAG............................................GAAAA.S.GA...A....A..G...A....A.....G..A...E...A...A......K...E....E..E....K.AV..EE--...................-..EEEV........DMG..GGM-dmf............................
F0YQD0_AURAN/17-110                    ......................................................................SPTAADVKAVIEA......AG.G.T.AD.....EEQLT..A.......L.C.A...A.......ME............G.K...SF.A.EM.C.AAGMEKIKdvp......................................mggGGGGG.G.GG...G....G..G...G....G.....G..G...A...A...P......A...E....E..E....K.KE..EEE-...................-..EEEI........DMG..GGM-dmf............................
Q5NB69_ORYSJ/60-118                    .............................................................pssavfqvi-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.I.GAVGGGAA...........................................iGGAAA.G.GA...A....A..G...G....A.....A..A...E...A...P......K...A....E..E....K.KE..EEK-...................E..ESED........DLG..FSLF...............................
A0A0F7IG78_9EURY/16-105                ......................................................................EITEENVKAVLEA......AG.I.E.VN.....EARVK..A.......L.V.A...A.......LE............G.V...DI.D.EA.I.SKAAFAPA...........................................vAAPAA.A.AA...P....A..E...A....G.....A..A...E...E...K......A...E....E..A....K.EE..EEEQ...................K..EEEA........LEG.lGALF...............................
W2QPS0_PHYPN/27-114                    ......................................................................EITSDSIQQVVNA......SG.N.E.VE.....PYWPT..L.......F.A.S...L.......LS............K.E..gKV.L.EL.I.STGGAAAG............................................GAAAA.P.GA...A....A..G...A....A.....G..A...E...E...E......K...V....E..E....K.AK..EE--...................-..EEEA........DLG..GGM-dmf............................
A0A1J8QY12_9HOMO/30-119                ......................................................................EITADKILALTNA......AS.V.E.LE.....PIWAS..L.......L.A.K...A.......LE............G.K...NV.K.DL.L.SNVGAGGGg.........................................paVGAPA.A.AA...A....G..G...A....P.....A..A...E...A...P......K...E....E..E....K.KE..EAK-...................E..ESDD........DMG..FGLF...............................
A0A260ZCD4_9PELO/17-106                .....................................................................d-PKADDLKKILSS......VG.I.D.AD.....AEKVD..S.......V.V.A...A.......LK............G.K...NL.A.EV.I.TEGKAKIAs..........................................vPSGGA.P.AA...S....S..A...A....P.....A..A...A...A...A......D...T....K..A....A.KK..EEPK...................E..ESDD........DMG..FGLF...............................
A0A026VZT8_OOCBI/231-316               ......................................................................YPTVASAPHSIAN......GF.K.N.LL.....AIAAV..T.......E.V.E...F.......TE............A.A...TI.K.EY.I.KDPSKF--............................................AVAAA.S.VA...A....P..A...A....A.....A..D...A...P...A......A...E....K..K....E.EK..KEES...................E..SEDE........DMG..FGLF...............................
A0A0V0YPL7_9BILA/17-70                 .....................................................................k-PSANDLKHILGS......VG.A.D.AD.....DERID..L.......L.L.S...Q.......VK............G.K...DI.T.EL.I.AAGREKFA............................................SV---.-.--...-....-..-...-....-.....-..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----psggg..........................
A0BDW7_PARTE/34-121                    .....................................................................d-IDATKLAKIIKA......SN.L.R.VE.....PIWTK..V.......F.E.K...A.......LK............G.K...KV.G.DL.L.HGSSGSASs.........................................apQTQTT.S.TP...A....A..A...E....T.....K..K...A...E...P......V...K....E..V....K.KA..EEP-...................-..EEDV........DMG..-GLF...............................
A0A1X2J0Q3_9FUNG/17-108                ......................................................................EPSAEDITKLLGS......VG.V.E.GD.....QARLT..S.......L.L.K...A.......LE............G.K...TV.E.EV.I.AEGSSKLAsv.......................................ssgPAAGA.A.AG...A....A..A...G....G.....A..A...A...D...A......P...A....E..E....A.KE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A1E4RSB0_9ASCO/17-105                ......................................................................SPSAADIKSVLES......VS.I.E.VD.....DEKIA..K.......L.L.G...E.......VE............G.K...NA.E.EL.I.AEGNEKLSs.........................................vpAGAPA.G.AA...A....A..A...G....G.....A..A...E...E...A......A...E....E..A....A.PE..AA--...................E..ESDD........DMG..FGLF...............................
L1I8D2_GUITH/1-95                      ......................................................................-PSAEDVKKLLNS......VG.A.K.AD.....DSSIN..F.......V.V.K...E.......LN............G.K...KL.D.EV.I.AAGNLKMAsvggg..................................sggggGGGAA.A.PA...A....A..A...A....A.....P..A...A...G...G......K...A....A..A....K.KE..PEP-...................-..EEEE........DMG..FSLF...............................
A0A1V1SUP7_9FUNG/17-110                ......................................................................SPSAADVKKVLDS......VG.I.E.AD.....DERLE..K.......L.I.S...E.......LE............G.K...DI.N.EL.I.AEGSSKLAsv.......................................psgGAGGG.A.AA...G....G..A...A....A.....G..G...A...A...A......A...E....E..K....A.EE..KEEE..................kE..ESDD........DMG..FGLF...............................
A0A2B7XFY1_9EURO/21-109                .....................................................................d-VTSDKLQSLLKA......AD.IqD.VE.....PIWSS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGSGGG............................................AAPAA.G.GA...A....P..V...A....A.....E..A...G...G...A......E...E....K..K....E.EK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A0A2L9T9_PENIT/17-107                .....................................................................a-PSSADIKAVLSS......VG.I.D.AE.....GDRLE..K.......V.I.S...E.......LQ............G.K...DL.Q.EL.I.SEGSAKLAsv.......................................psgGAGAA.A.PA...A....A..A...A....G.....G..A...A...A...P......A...E....E..K....V.EE..KE--...................E..ESDE........DMG..FGLF...............................
A0A183W8R7_TRIRE/17-114                ......................................................................NPTESDLKSVLNS......VG.I.E.HD.....SEKLS..S.......V.M.S...S.......LS............G.K...DI.T.QL.I.AEGSKKISsvpa...................................agavaSAPAQ.S.AP...A....A..A...A....K.....T..E...A...P...K......E...S....K..P....A.KE..EVKE...................E.sESEE........DMG..FGLF...............................
A0A1E3PRK0_9ASCO/229-310               ......................................................................YPTLPAVGHSIIN......HY.K.N.VL.....ALSIA..T.......E.Y.T...Y.......EG............S.E...SV.K.DR.L.ANPEAY--............................................-AAAA.P.AA...A....A..A...S....G.....S..S...E...A...A......A...E....A..A....V.EE..EE--...................-..ESDD........DMG..FGLF...............................
A0A2H0ZCD7_CANAR/50-139                .....................................................................a-PSAADIKKVLES......VS.I.E.VE.....DEKVD..Q.......L.L.A...E.......VD............G.K...NV.E.EL.I.AEGTEKLSa..........................................vPTGAP.A.AS...G....A..A...A....G.....G..A...A...P...E......A...A....A..E....E.KE..EEAA...................E..ESDD........DMG..FGLF...............................
K8EDG0_9CHLO/232-314                   ......................................................................YPTLAAVPHYIVN......SY.K.N.VL.....AISIG..T.......E.Y.T...F.......EL............A.Q...KV.K.DY.L.ADPSAF--............................................QSAGG.G.GG...G....G..G...G....G.....D..K...P...A...A......A...A....A..A....P.VE..EE--...................-..EEEE........DMG..FDLF...............................
D7EAE2_METEZ/16-105                    .....................................................................d-ITEDTVKNVLDA......AG.I.E.VD.....DARVK..A.......L.V.A...A.......LE............D.V...DI.E.EA.M.SQAAFAAP............................................AAGGS.S.PS...G....E..S...G....G.....A..A...E...E...S......A...A....E..E....K.EE..EEE-...................E..ESEEs......gMAG.lGALF...............................
Q22XR4_TETTS/108-197                   .....................................................................a-ITVDNINKVLTK......AK.VqN.VE.....KYLPK..L.......Y.V.S...N.......IT............P.A...VI.A.ST.I.ANGGSSSS............................................GSAPA.A.AA...V....A..K...E....A.....P..K...E...E...K......K...A....E..V....K.EE..KKAE..................kE.pEEDL........DMG..-DLF...............................
G4T639_SERID/17-115                    ......................................................................SPSADDIKKLLST......VG.I.D.AD.....EDRLT..S.......L.M.S...A.......LE............G.K...SI.D.EL.I.SAGSSKLSsvpsg..................................gggggAVAAA.S.GG...G....G..A...A....G.....G..G...A...A...P......A...E....E..K....A.EE..KKEE..................kE..ESDD........DMG..FGLF...............................
RL10_THEKO/232-339                     ......................................................................YPTKQTIEAILQK......AY.L.-.-G.....AKNVA..V.......E.A.G...Y.......IT............K.D...TV.E.DI.F.GRAIRAVLliaqnlpedl........................ldektkellnAQAQM.A.VA...A....A..P...Q....P.....T..E...E...K...V......E...E....A..E....E.EE..EEEE..................aS..EEDA........LAG.lGALF...............................
B8D5P6_DESA1/16-106                    ......................................................................EISEENVKKVLEA......AG.V.E.VD.....EVRVK..S.......L.V.T...A.......IK............N.I...DI.A.KV.L.EQASVAPV...........................................aAAPVQ.A.AP...A....A..A...P....A.....G..E...E...K...K......G...G....E..E....K.KE..ESK-...................E..LSEEa......lSEG.fSALF...............................
A0A2H3IC99_9EURO/229-312               ......................................................................YPTLPSVMHSLVN......SY.K.K.VL.....AVAIE..T.......D.F.S...W.......PE............I.E...EL.K.DR.I.ANPEAY--............................................AAAAP.V.AA...A....A..T...G....G.....E..A...A...P...A......A...A....E..E....K.EE..SEE-...................E..SGDE........GFG..-GLF...............................
J8Q3S6_SACAR/17-109                    ......................................................................SPSVADIKSVIES......VG.A.E.AD.....EARIN..E.......L.L.S...S.......LE............G.K..gSL.E.EI.I.AEGQKKFAsa.......................................paaGSSAG.A.AG...A....A..G...A....A.....A..G...G...D...A......A...E....E..E....K.EE..EA-K...................E..ESDD........DMG..FGLF...............................
RLA4_YEAST/17-109                      .....................................................................a-PSAADIKAVVES......VG.A.E.VD.....EARIN..E.......L.L.S...S.......LE............G.K..gSL.E.EI.I.AEGQKKFAtv.......................................ptgGASSA.A.AG...A....A..G...A....A.....A..G...G...D...A......A...E....E..E....K.EE..EAK-...................E..ESDD........DMG..FGLF...............................
#=GR RLA4_YEAST/17-109           SS    .....................................................................X-XXXXXXXXXXXX......XX.X.X.XX.....XXXXX..X.......X.X.X...X.......XX............X.X..XXX.X.XX.X.XXXXXXXXXX.......................................XXXXXXXX.X.XX...X....X..X...X....X.....X..X...X...X...X......X...X....X..X....X.XX..XXX-...................X..X---........S--..XXXX...............................
A0A0M9G2S6_9TRYP/238-325               .....................................................................i-PTPATIGHMVVD......AF.K.N.LL.....AISVA..T.......S.Y.E...F.......EEh..........nG.K...EL.R.EA.A.INGTLA--............................................GAGGA.A.EE...A....A..A...A....P.....A..A...A...A...G......G...A....A..A....K.KE..ETE-...................E..DEEE........DFG.mGGLF...............................
A0A024TZ76_9STRA/29-112                ......................................................................EVSADNLNEALSA......AG.V.T.VP.....AYLPT..L.......Y.A.N...A.......VE...........rG.L...KV.S.KA.L.AGPSAG--............................................-GAAA.P.AP...A....A..G...A....A.....G..A...A...A...P......K...K....E..E....K.KE..EEE-...................-..EADL........GGG..MDMF...............................
L9KM63_TUPCH/231-323                   ......................................................................YPTVASVPHSIIN......GY.K.R.VL.....ALSVE..T.......D.Y.T...F.......PL............A.E...KV.K.RS.Y.REHSQGLLdpp......................................alvPAAPV.A.AA...T....T..A...A....P.....A..A...A...A...A......P...A....K..V....E.AK..EES-...................E..ESDE........DMG..FGLF...............................
A0A1U8AI74_NELNU/21-110                .....................................................................p-VTPEKIATLVKS......AN.V.S.VE.....SYWPS..L.......F.S.K...L.......AE............K.R...NI.E.DL.I.MNAGSGGGg.........................................apVAVSA.P.AG...G....G..G...A....A.....A..D...A...A...P......A...A....E..E....K.KE..EPK-...................E..ESDD........DMG..FSLF...............................
K6VAU9_9APIC/32-118                    .....................................................................s-ITSENIVKLIKK......SN.N.T.VL.....PYLPM..L.......F.E.K...A.......LK............G.K...DI.E.GL.L.SNLSVG--............................................GGAPA.A.AA...Q....A..A...A....D.....K..P...S...D...D......K...K....E..A....K.KE..EKVE..................eE..EEED........DLG..FSLF...............................
A0A0C3JZ86_PISTI/229-311               ......................................................................YPTIVSVMHSLVN......SY.K.N.LI.....AVALA..T.......D.Y.T...F.......EG............A.E...KA.K.AF.L.ENPEAF--............................................-AVAA.A.PA...A....E..E...A....A.....P..A...A...A...A......E...E....E..K....P.AE..KEE-...................-..ESDD........DMG..FGLF...............................
RLA1_HUMAN/22-113                      .....................................................................t-VTEDKINALIKA......AG.V.N.VE.....PFWPG..L.......F.A.K...A.......LA............N.V...NI.G.SL.I.CNVGAGGPa..........................................pAAGAA.P.AG...G....P..A...P....S.....T..A...A...A...P......A...E....E..K....K.VE..AKKEe.................sE..ESDD........DMG..FGLF...............................
#=GR RLA1_HUMAN/22-113           SS    .....................................................................----HHHHHHHHHH......HT.-.-.--.....THHHH..H.......H.H.H...H.......TT............T.S...-C.G.GG.G.TTTT-----..........................................------.-.--...-....-..-...-....-.....-..-...-...-...-......-...-....-..-....-.--..---S-.................-S..--S-........--S..-S--...............................
H3FJM0_PRIPA/251-331                   ......................................................................YPTAASVPHSIAA......GL.Q.S.ML.....GIAAV..T.......D.I.T...F.......KQ............A.E...KI.K.AY.L.ANPGAF--............................................AVAAA.P.AA...A....A..A...-....-.....-..-...A...P...A......A...A....A..A....K.KE..EPK-...................E..ESDD........DMG..FGLF...............................
A0A2K5KWB2_CERAT/186-268               ...................................................................pvt-----SVPHSIIS......GY.K.G.GL.....VLSVE..T.......D.Y.T...F.......PP............A.E...KI.M.TF.L.ADPSAF--............................................VATAP.V.AT...T....A..T...A....A.....S..A...A...A...A......A...P....N..K....F.ED..EEL-...................E..ELDE........DMG..FGLF...............................
A0A0C4EIJ4_PUCT1/17-111                .....................................................................k-PSAEDVKALLSS......VG.V.D.SE.....EERLQ..K.......L.I.S...E.......LK............D.K...TI.A.DL.I.AEGSTKLAsvps...................................gggggAAAAA.P.AT...A....G..G...A....A.....A..A...E...A...P......K...A....E..A....K.AE..EKE-...................-..ESDD........DMG..FGLF...............................
M4CAU5_BRARP/233-320                   .....................................................................f-PTIAAAPHMFIN......AY.K.N.AL.....AICIA..T.......E.Y.T...F.......PQ............A.E...KV.K.EY.L.KDPSKFAV............................................AVAAV.S.AD...A....G..G...G....A.....S..A...G...A...A......K...V....E..E....K.KE..VVE-...................E..SDEE........DYG.gFDMF...............................
S2JPQ0_MUCC1/20-104                    ......................................................................EITADKLQTLVSA......AG.V.E.VE.....PIWFS..L.......Y.A.K...A.......LA............G.Q...DL.K.AL.L.LNVGAP--............................................GSGPA.V.SA...G....A..A...A....G.....G..A...A...D...A......P...A....E..E....E.KE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A2A2FFV2_9EURY/16-112                ......................................................................EINEENVTGVLEA......AG.V.D.VE.....ESRVK..A.......L.V.A...A.......LE............D.V...DI.E.EA.I.ETAAAAPAa.........................................gaASGGS.P.DA...A....D..A...D....E.....A..D...E...G...D......D...E....D..E....E.EA..---Aeea.............addD..EEDG........DGG..EGL-gelf...........................
A0A1U8NFT9_GOSHI/17-105                .......................................................npsaadikkilasvs-------------......--.-.-.--.....-----..-.......-.-.-...A.......LGn.........alG.K...DV.T.EL.I.ASGREKLAsvpc...................................gggggVVAAA.P.GA...G....A..A...A....A.....A..T...P...A...A......A...E....A..K....K.EE..KVEEk.................aE..SSDD........DMG..FSLF...............................
A0A0V0U7F6_9BILA/22-112                .....................................................................s-ITMENFQSVLEA......SN.V.H.VD.....KIWLN..L.......Y.V.N...A.......LS............K.V...DV.G.DL.L.NCLSCGIGs..........................................aSVAAA.P.AT...A....E..A...P....K.....P..E...A...S...A......P...A....A..K....K.EE..KKPE..................sD..EEDE........DMG..FGLF...............................
A0A1U8P582_GOSHI/234-319               ......................................................................YPTLAAAPHMFIN......GY.K.N.VL.....AVAVA..T.......E.Y.S...F.......PQ............A.D...KV.K.EY.L.ADPSKF--............................................AVAAA.P.VS...A....A..G...G....A.....A..P...A...A...A......A...P....V..E....E.KK..PEPE...................E..ESDD........DMG..FSLF...............................
A0A2G2VUC0_CAPBA/1-77                  .....................................................................m----------FTN......AY.K.N.VL.....AIAVE..T.......E.Y.S...F.......PL............A.D...KV.K.EY.L.ADPSKF--............................................AAVAV.A.PV...A....D..A...S....S.....G..A...T...P...V......A...K....E..E....E.KK..DEPA...................E..ESDD........DMG..FSLF...............................
A0A0W8DX01_PHYNI/27-107                ......................................................................EITSDSIQQVVNA......SG.N.E.VE.....PYWPT..L.......F.A.S...L.......LS............K.E..gKV.L.EL.I.STGGAAAG............................................GAAAA.P.GA...A....A..G...A....A.....G..A...E...E...E......K...V....E..E....K.AK..EEEE...................-..E---........---..----avs............................
A0A1S4E3U5_CUCME/17-112                .....................................................................t-PSAQDINTILYS......VG.A.E.AD.....VEKIE..L.......L.L.A...E.......VK............G.K...DI.T.EL.I.ACGREKMAslpt....................................gavvA--AV.V.AA...V....P..S...T....V.....D..A...A...A...P......V...A....A..E....A.KK..EEKDd.................aM..DSDE........DIC..FSLF...............................
A0A2H3E6B9_ARMGA/17-111                ......................................................................SPSAADIKKVLSA......VG.I.E.AD.....DDRLS..S.......L.I.S...E.......LS............G.K...SI.D.QL.I.AEGSSKLAsv.......................................psgGAGGA.A.AP...A....A..A...S....G.....G..A...A...P...A......A...A....E..E....K.KE..EKEEe.................kE..ESDD........DMG..FGLF...............................
K3ZVC4_SETIT/234-318                   ......................................................................YPTLAAAPHMFIN......GY.K.N.VL.....AVAVE..T.......D.Y.S...Y.......PH............A.D...KI.K.EY.L.KDPSKF--............................................AAAAP.V.AS...A....D..S...G....A.....A..A...A...P...K......E...E....E..K....K.AE..EPA-...................E..ESDD........DMG..FSLF...............................
W4KDF3_9HOMO/229-312                   ......................................................................YPTIVSVTHSLVN......AY.K.N.LI.....AVSLA..T.......D.Y.T...F.......EG............A.E...KA.K.EY.L.ANPEAF--............................................AVAAA.P.AA...A....A..A...A....D.....A..A...P...A...A......A...E....E..A....K.EE..EKE-...................-..ESDD........DMG..FGLF...............................
W0T7L8_KLUMD/17-108                    .....................................................................a-PSATEIKAVLES......VG.I.E.AE.....DAKID..A.......L.F.A...A.......LE............G.K...SI.N.EL.I.AEGQTKLAsv.......................................pagGAAAA.A.GS...S....G..A...A....A.....A..S...E...E...A......A...A....E..E....K.EE..EAK-...................E..ESDD........DMG..FGLF...............................
G1UBJ0_METIK/16-101                    ......................................................................EITEDAVKAVLSA......AG.V.E.VD.....EARVK..A.......L.V.A...A.......LE............G.V...NI.D.EA.I.ENAAMP--............................................VA-AA.A.PA...A....A..A...A....P.....A..A...E...E...K......K...E....E..E....K.KE..EKKD...................D..TAAA........AAG.lAALF...............................
A0A1S3PW10_SALSA/33-129                .....................................................................s-PQAADIKKILES......VG.I.E.AD.....NTRME..K.......V.V.T...E.......LG............G.K...NV.E.EV.I.AQGYGKLAsmp.....................................aggaVAVAS.S.GG...A....A..T...A....G.....A..A...A...P...A......A...A....E..E....K.KE..EKEEs.................eE..GSDD........DMG..FGLF...............................
A0A139HJP5_9PEZI/17-112                ......................................................................SPSAEDIKGLLSA......VG.V.E.AD.....QERLE..K.......L.L.S...E.......LE............G.K...DI.N.EL.I.SEGSTKLAsvps...................................ggaggAPAAG.G.AA...A....G..A...G....G.....D..S...A...A...P......A...A....E..E....A.KE..EEK-...................E..ESDE........DMG..FGLF...............................
Q2UKH6_ASPOR/229-312                   .....................................................................f-PTLPAVMHYLVN......SY.K.K.VL.....AVAVS..T.......E.I.S...W.......PE............I.E...EL.K.DR.I.ANPDAY--............................................AA-AA.P.VA...G....A..G...A....A.....A..G...G...D...A......P...A....E..E....K.KE..EEE-...................E..ESDD........DMG..FGLF...............................
A0A099P5Y8_PICKU/19-102                ......................................................................EVSSENLQTVLNA......AG.A.N.VD.....SIWTS..V.......F.A.K...A.......LE............G.K...DL.K.EI.L.FSMAAA--............................................APAAA.A.GS...A....A..A...A....G.....G..A...E...E...A......A...A....E..A....V.EE..EKE-...................-..ESDD........DMG..FGLF...............................
E1Z866_CHLVA/233-313                   ......................................................................YPTIASVPHSLIN......GY.K.N.VL.....AIAVE..T.......D.Y.S...F.......PL............A.E...KV.K.AF.L.ADPSAF--............................................AVAAA.P.AA...G....G..E...A....A.....P..A...A...A...A......A...A....A..-....-.-E..PEE-...................-..EEDE........DMG..FSLF...............................
A0A177B0Y2_9METZ/25-109                .....................................................................p-VTENKLEKVLSA......AD.I.S.IE.....PFYTK..A.......F.A.K...C.......CQ............Q.K...DYmQ.TL.L.TNASSV--............................................--NTV.S.AP...T....T..A...A....V.....E..T...T...S...A......P...V....E..E....K.KE..ESEE...................E..DSGS........DNG..FGLF...............................
A0A084WHE2_ANOSI/23-113                .....................................................................a-VTDEKISTILKA......AN.V.D.IE.....PYWPG..L.......F.A.K...A.......LE............G.I...DV.K.SL.I.TSIGSGVGs..........................................gGGGGA.P.AA...A....A..A...G....G.....G..A...A...P...A......A...A....E..K....K.EE..KEEE..................pE..ESDD........DMG..FGLF...............................
A0A0B4H8T9_9HYPO/21-108                ......................................................................EISADKLQALIKA......AG.V.EgVE.....PIWTS..I.......F.A.K...A.......LE............G.K...DV.K.DL.L.VNVGSGGG............................................AAAPA.A.GG...A....A..A...A....G.....G..D...A...A...A......P...A....E..E....E.KV..EEK-...................E..ESDE........DMG..FGLF...............................
A0A0V0X243_9BILA/22-119                ......................................................................NPEVADLKKIITS......AT.D.E.FD.....ESKAK..M.......V.V.D...S.......CK............G.N...DL.L.KL.I.AEGATKLSsvpsg.................................pavatgGASAA.A.DA...A....A..L...A....A.....T..E...S...S...K......K...E....D..S....K.KK..EES-...................E..EEDE........DMG..FGLF...............................
A0A096PAI6_OSTTA/229-310               ......................................................................YPTLASVPHSIVN......AY.K.N.VL.....AVSIG..T.......E.Y.T...F.......EL............A.Q...KV.K.DY.L.ANPGAFA-............................................-A-AA.P.AG...G....A..A...A....G.....G..D...S...G...A......K...A....A..A....A.AV..EE--...................-..EEEE........EMD..FDLF...............................
A0A1R3JJS3_COCAP/307-395               .....................................................................p-ITAEKIATLVKA......AN.V.S.VE.....SYWPS..L.......F.A.K...L.......LE............K.R...SC.D.DL.I.MNVGSGGGa.........................................apAAVAA.P.AG...A....G..G...A....A.....A..A...A...P...A......V...E....E..K....K.EE..PK--...................E..ESDD........DMG..FSLF...............................
H2LPR5_ORYLA/17-112                    ......................................................................SPSAKDIKDILGS......VG.I.E.AD.....DERLN..K.......V.I.G...E.......LN............G.K...NI.N.EV.V.NSGLSKLAsvp.....................................aggaVAAPA.A.AP...S....G..A...T....G.....A..A...P...A...P......A...E....E..K....K.EE..KKEE..................sE..ESDE........DMG..FGLF...............................
A0A0D9WH38_9ORYZ/17-111                ......................................................................SPTADDVKNILES......VG.V.E.AN.....EERLE..F.......L.I.S...E.......LE............G.K...DI.T.EV.I.AAGREKFAsvp......................................sggGAMAV.A.AP...A....A..A...A....G.....G..A...A...P...A......E...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
A0A183TEY4_SCHSO/17-115                .....................................................................h-IGADDIKAILDS......VG.I.E.CE.....EER--..-.......L.L.A...Q.......LK............G.K...NA.H.DL.I.NAGKAKLSsvsvaa................................paahaaG-GAA.A.PS...A....P..A...A....G.....K..E...E...A...G.....gK...K....E..K....A.EE..KK-Pe................sdE..ESDD........DMG..FGLF...............................
A0A0D1Z6K8_9EURO/17-113                .....................................................................d-PSEDDIKSVLSS......VG.I.D.AD.....EERLS..K.......L.L.E...E.......LK............G.K...DI.N.EL.I.AEGSTKLAsvpt....................................ggagGAAAP.A.AG...G....A..A...A....G.....G..A...A...A...A......E...E....E..K....P.AE..KEEE..................kE..ESDE........DMG..FGLF...............................
A0A0V1CZ80_TRIBR/231-319               ......................................................................YPTAASAPHMIAN......AF.K.N.LL.....SIAAV..T.......D.I.T...F.......KE............A.E...KL.K.EY.L.ADPSKFAV............................................AAAPA.A.AA...A....D..S...S....K.....A..E...K...E...D......S...S....S..K....K.KE..EKVE...................E..ESDE........EEG.mGGLF...............................
A0A182QAP0_9DIPT/23-112                .....................................................................a-VTDEKIATILKA......AS.V.D.IE.....PYWPG..L.......F.A.K...A.......LE............G.I...DV.K.SL.I.TSIGSGVG............................................SGGGA.P.AA...A....A..A...G....G.....A..A...A...P...A......A...A....E..K....K.EE..KKEEe.................pE..ESDD........DMG..FGLF...............................
A0A0N4VYA0_HAEPC/17-71                 .....................................................................s-PKLEDIKNILGA......VG.V.D.TD.....AEAAK..L.......V.I.S...R.......LQ............G.K...NI.E.EV.I.AEGSAGLV............................................-----.-.--...-....-..-...-....-.....-..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----svscafft.......................
C1MX55_MICPC/17-108                    ......................................................................SPSEADVKSVLSS......VS.A.E.VD.....DEKLK..A.......F.F.A...A.......ID............G.K...DV.A.EL.I.KEGTEKLAsvp......................................sggGGGGG.G.GG...G....G..G...G....G.....G..G...G...G...A......A...A....A..P....E.PE..PE--...................E..EEEE........AMD..FDLF...............................
G1QHI2_NOMLE/231-316                   ......................................................................YPTVASVPHSIIN......GY.K.R.VL.....ALSVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFVA............................................--AAP.V.AA...A....T..T...A....A.....P..A...A...A...A......A...P....A..K....V.EA..KEES...................E..ESDE........DMG..FGLF...............................
L5LCV2_MYODS/2-92                      ...................................................................ted----NKINALIKA......AG.V.M.GE.....LFWPG..L.......F.A.K...A.......LA............N.V...NI.G.SL.I.CNVGAGGPa..........................................pAASAA.P.AG...G....P..A...P....S.....T..A...A...A...P......A...E....E..T....K.VE..AKKEd.................pE..ESDD........DMG..FGLF...............................
RLA25_ARATH/17-113                     ......................................................................NPSVADLKKIVES......VG.A.E.ID.....QEKID..L.......F.F.S...L.......IK............D.R...DV.T.EL.I.AVGREKMAalss....................................gggaVAVAS.G.GG...G....G..A...A....P.....A..A...E...P...A......S...V....E..S....K.KK..EEEK...................E..ESED........DGG.mMSLF...............................
A0A091FQM0_9AVES/17-114                ......................................................................SPTSKDLKKILDS......VG.I.E.TD.....DERMN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGNGKLAsmpa....................................ggavAVSAG.G.GS...A....A..P...A....A.....A..A...A...P...A......A...A....E..E....K.KE..EKKEe.................sE..ESDD........DMG..FGLF...............................
A9PCM7_POPTR/17-112                    .....................................................................c-PTAEDLKNILGS......VG.A.D.AD.....DDRIE..L.......L.L.S...S.......VK............G.K...DI.T.EL.I.ASGREKLAsvp.....................................sgggVAVSA.G.AA...P....A..A...A....G.....G..A...A...P...A......A...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
A0A1B7P4U5_9EURO/17-111                ......................................................................SPSAADIKSVLGA......VG.I.D.AD.....DERLE..K.......L.I.S...E.......LK............G.K...EL.S.EL.I.AEGSTKLAsv.......................................psgGAAAA.P.AA...G....G..A...A....A.....G..G...E...A...A......A...A....A..E....K.AE..EKEEe.................kE..ESDE........DMG..FGLF...............................
A0A1S3C8T5_CUCME/17-114                .....................................................................s-PGVDDVKAILNS......VG.V.E.ID.....EERIT..L.......L.L.S...E.......VK............G.K...DV.T.EL.I.ASGREKLAsvps...................................gggaiAVSAS.A.GG...A....A..G...G....G.....A..A...P...A...P......A...E....Q..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
S5Z820_9CREN/16-105                    ......................................................................EINEESVKKILEA......AG.I.Q.VD.....DVRVK..A.......L.V.A...A.......LK............E.V...NI.E.EA.I.KTAALPVA............................................VGGAA.P.AA...A....P..A...Q....A.....P..A...E...Q...K......K...E....E..K....K.EE..KKEE..................vK..EETV........EEG.lAGLF...............................
A0A0M0BYG7_9ARCH/16-102                ......................................................................EISEKNISEVLTA......AG.V.N.AD.....VARVK..A.......L.V.A...S.......VA............E.V...DI.E.EA.I.KSAPAMM-............................................AAVPA.P.AA...A....A..P...A....K.....E..E...K...K...A......E...E....E..P....E.ED..ESKK...................-..EEAA........MEG.lGSLF...............................
A0A067KDN6_JATCU/17-86                 ..................................................................apsv-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.D...DI.K.DI.L.SHVRADVDdvkiry................................llleieAVAPV.G.GA...A....S..T...P....A.....V..A...V...E...A......K...K....E..E....K.VE..EKE-...................-..ELDD........DIG..FSLF...............................
A0A1D6C729_WHEAT/36-119                ...................................rqlvsaacaedksggvqssftmvspnsaifqvvig-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.--GASAGPi.........................................ggGAGGG.G.AA...A....S..G...G....A.....A..A...E...A...P......K...A....E..E....K.KE..EEK-...................E..ESED........DLG..FSLF...............................
A0A1S3ZR95_TOBAC/234-318               ......................................................................YPTLAAIPHMFIN......GY.K.N.VL.....SFAIA..T.......E.Y.S...F.......PQ............A.E...KV.K.EY.L.KDPSKF-A............................................AATAA.P.VA...A....K..P...A....A.....K..P...A...T...A......K...E....E..K....K.EE..PAE-...................-..EDDD........DFV..GGLF...............................
F7DX87_MACMU/220-302                   ...................................................................pvt-----SVPHSIIS......GY.K.G.GL.....ALSVE..T.......D.Y.T...F.......PP............A.E...KI.M.TF.L.ADPSAF--............................................VA-TA.P.VA...T....T..T...T....T.....A..S...A...A...A......A...A....P..N....K.FE..DEEL...................E..ELDE........DMG..FGLF...............................
RLA2_BOVIN/17-114                      ......................................................................SPSAKDIKKILDS......VG.I.E.AD.....DDRLN..K.......V.I.S...E.......LH............G.K...NI.E.DV.I.AQGIGKLAsvpa....................................ggavAVSAA.P.GS...A....A..P...A....A.....G..S...A...P...A......A...A....E..E....K.KE..EKKEe.................sE..ESDD........DMG..FGLF...............................
S9W177_SCHCR/17-108                    ......................................................................SPSTSDIETVLST......VG.I.E.SE.....SARVE..S.......L.L.N...E.......LQ............G.K...NL.E.EL.I.AAGNEKLAt.........................................vpSGGAA.A.AP...A....A..A...G....G.....A..A...T...P...A......A...E....E..A....K.KE..EAKE..................eE..ESDE........DMG..FGLF...............................
Q9U1X9_CAEEL/17-109                    ......................................................................NPKVDDLKNILSA......VG.V.D.AD.....AETAK..L.......V.V.S...R.......LA............G.K...TV.E.EL.I.AEGSAGLVsv........................................sgGAAPA.A.AA...A....P..A...A....G.....G..A...A...P...A......A...D....S..K....P.AK..KEEP..................kE..ESDD........DMG..FGLF...............................
Q4DWU6_TRYCC/16-106                    .....................................................................t-PSKSAVEAVLKA......AG.V.P.VD.....PSRVD..A.......L.F.A...E.......FA............G.K...DF.D.TV.C.TEGKSKLVggv.....................................trpnAATAS.A.PT...A....A..A...A....A.....S..S...G...A...A......A...P....A..A....A.AE..E---...................-..EEDD........DMG..FGLF...............................
A0A0B4HZI1_9HYPO/17-109                ......................................................................SPSAKDIKNVLSA......VG.I.E.AD.....DDRLK..T.......L.L.S...E.......LE............G.K...DV.S.EL.I.AAGSEKLAsv.......................................psgGAGGA.P.AA...G....G..A...A....A.....G..G...A...A...A......E...E....K..A....E.EK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A1B7MWK1_9HOMO/21-110                ......................................................................EITADKILALTNA......AS.V.E.LE.....PIWAS..L.......L.A.K...A.......LE............G.K...NV.K.DL.L.SNVGAGGGa.........................................paVGAPA.A.AA...A....G..G...A....P.....A..A...E...A...P......K...E....E..E....K.KE..EAK-...................E..ESDD........DMG..FGLF...............................
A0A0D9WXB0_9ORYZ/28-86                 .................................................rslsswpsgtrcspsprpllv-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.--------............................................--AAV.A.AQ...L....V..A...A....G.....D..E...K...E...E......E...E....E..K....A.EE..KVV-...................E..EEED........DSM..FSLF...............................
A0A0L9UNI9_PHAAN/17-77                 .....................................................................t-PSASDIKNILGA......VG.A.E.AE.....DELIN..L.......L.L.A...E.......VK............G.K...DF.N.EL.L.ASGREKMSa..........................................vS--GG.G.AA...V....A..V...A....-.....-..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----ai.............................
F9CUR1_9ARCH/16-97                     ......................................................................EVNEANISSVVKA......SG.A.A.VN.....DAQVK..A.......L.V.A...A.......LA............D.V...NI.E.EA.I.KAAPVAVA............................................AAAPA.A.AA...A....G..E...A....K.....K..E...A...P...V......D...T....S..K....N.EE..----...................-..--AA........MEG..----lsslf..........................
C5Z967_SORBI/61-118                    ........................................................tsavfqvivgavgg-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.---GAMM-............................................VSGGG.G.AA...A....A..S...G....G.....A..A...A...E...A......P...K....E..E....K.KE..EEK-...................E..ESDD........DMG..FSLF...............................
A0A0W7VNC0_9HYPO/229-312               .....................................................................f-PTLPSVMHSLVN......SY.K.K.VL.....AVAIE..T.......E.I.S...W.......PE............I.E...QL.K.DR.I.ANPDAY--............................................AAAAP.A.AS...S....G..A...A....A.....A..T...E...A...A......P...A....E..E....K.KE..EEE-...................E..EDEE........GFG..-GLF...............................
W7A957_9APIC/19-110                    ......................................................................NPTAKEVKKVLSA......VN.A.G.VE.....DDVLT..N.......L.M.N...S.......LN............G.K...CY.H.EL.I.SEGMKKLQn.........................................igGGGGG.A.AA...V....A..T...A....D.....T..G...A...V...K......A...E....E..K....K.EE..KKEE..................eE..EEED........DLG..FSLF...............................
A0A1D6C4Q5_WHEAT/227-311               ......................................................................YPTMAAAPHMFLN......AY.K.N.VL.....AVALE..T.......D.Y.S...Y.......DH............A.D...KI.K.EY.L.KDPSKF--............................................AVAAP.A.AA...A....S..G...G....A.....A..A...A...A...P......K...E....E..E....K.KD..EPE-...................E..ESDG........EMG..FSLF...............................
A0A0P7V4N1_9TELE/231-295               ......................................................................YPTLASIPHSIIN......GY.K.R.VL.....AVAVE..T.......D.Y.T...F.......PL............A.E...KV.K.AY.L.ADPSAF--............................................AA-AA.P.AA...A....A..A...E....T.....A..A...A...P...A......A...A....-..-....-.--..----...................-..----........---..----a..............................
A0A0X8V2L6_9EURY/16-102                ......................................................................EITEDAITAILNA......AG.A.E.VD.....AAKVK..A.......L.V.A...S.......LE............G.V...DI.K.EA.I.ANASFA--............................................-APAA.A.AA...A....A..P...A....A.....A..A...D...A...P......A...A....A..P....A.EE..EEEK..................vS..EDEA........AAG.lSALF...............................
A0A1S2Z8G7_CICAR/21-75                 .....................................................................a-ITAEKINTILKA......VG.V.T.VE.....SYWPS..L.......F.A.K...L.......AQ............N.K...SI.D.DL.V.LNAGAT--............................................GGAAV.A.VS...A....-..-...-....-.....-..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----p..............................
E4WQM2_OIKDI/20-106                    .....................................................................d-ISGDKIASLLKA......AN.V.D.VE.....PFWPG..L.......F.A.G...A.......LK............N.C...NV.S.EL.I.SNISSGV-............................................GAGPS.A.AG...G....A..A...A....G.....G..A...A...E...E......A...K....E..E....E.KK..PESS...................S..ESDD........DMG..FDMF...............................
A8A9N2_IGNH4/16-106                    ......................................................................EITEDAVKKVLEA......AG.V.E.VD.....ETRVK..A.......L.V.A...A.......LS............E.V...NI.E.EA.I.KSAAFP--............................................-VAAA.P.AA...A....P..A...A....A.....G..G...E...A...K......E...E....K..K....E.EE..EEEEkk..............eavS..EEEL........SAG.lGALF...............................
A0A1U8FRL2_CAPAN/22-113                .....................................................................p-VTAEKIATVVKA......AN.L.Q.VE.....SYWPS..L.......F.A.K...L.......CE............K.K...NV.E.DL.I.MNVGSGGTaa........................................ptGAVAG.A.PP...V....T..G...D....D.....A..A...T...A...S......S...T....A..D....K.KK..EEPK...................E..ESDD........EAM..FSLF...............................
D7MFV8_ARALL/23-118                    ..................eleasasstyelqrklvqaalsadssggvqssfslvsptsavfqvivggggg-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.------GG...........................................fAAGGA.A.SG...G....G..G...A....G.....E..S...A...A...A......P...K....E..D....E.KK..KEES...................E..EEEG........DFG..FDLF...............................
A0A093Q0C2_9PASS/17-114                ......................................................................SPTSKDLKKILDS......VG.I.E.TD.....DERMN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGNGKLAsmpa....................................ggavAVSAG.G.GS...A....A..P...A....A.....A..A...A...P...A......A...A....E..E....K.KE..EKKEe.................sE..ESDD........DMG..FGLF...............................
G0QTQ2_ICHMG/21-107                    .....................................................................e-TSAENIEKVLKA......AN.L.K.VN.....ASQNA..A.......F.Q.R...L.......FA............H.T...PA.S.KL.V.PQLGGGV-............................................ASSAP.T.QS...A....Q..A...S....A.....P..A...K...A...A......A...K....E..A....P.KE..EPKK...................E..EEED.......yDMG..-DLF...............................
A0A1D2WL69_9EURY/16-99                 ......................................................................EINEENVKSIIEA......AG.I.E.AE.....DARIK..A.......L.I.A...A.......LE............D.V...DI.D.EA.M.ETTA----............................................MAAAA.P.AA...A....P..A...A....A.....E..A...A...E...E......E...E....E..E....E.EE..EEA-...................S..EEEA........AAG.lGALF...............................
I1GWP5_BRADI/14-119                    ...........ewtakqhkgeleasaattydlhrqlvaaasaadssagvqssftavsptsaicqviigav-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.---GGG-Am.........................................vgGPAAG.G.AP...A....S..G...G....A.....A..A...E...A...P......K...A....E..E....K.KE..EEK-...................E..ESED........DLG..FSLF...............................
A0A1L7X3R8_9HELO/21-109                .....................................................................d-VTADKLQTLIKA......AK.IeD.VE.....PIWSS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGSGG-............................................GAAAA.P.TA...G....G..A...A....G.....G..E...A...A...A......E...E....A..K....E.EE..KEEA..................kE..ESDE........DMG..FGLF...............................
K5XEM2_AGABU/17-111                    .....................................................................s-PDEAAIRKVLDA......GG.V.E.TD.....EDQLS..K.......L.L.S...E.......LK............G.K...DI.N.DL.I.AEGSSKLAsvp......................................sggGGGGG.G.AA...A....A..A...S....G.....G..A...A...P...A......A...E....E..K....K.EE..KEEE..................kE..ESDD........DMG..FGLF...............................
A0A177VL13_9BASI/21-108                ......................................................................EVTADKLNALLTA......AG.V.Q.VQ.....PIWAT..L.......L.A.K...A.......LA............D.K...DV.K.SL.L.TNVGGGSG...........................................pAVSVS.A.AP...A....A..G...G....A.....A..P...E...A...A......K...E....E..E....K.KE..EEK-...................E..ESDD........DMG..FGLF...............................
T0M453_9EURY/16-100                    ......................................................................EIDEENLKKVLTD......AG.V.A.AD.....DARLK..S.......L.L.E...S.......MK............N.V...NI.E.EV.L.KNAA----............................................AAPVA.A.AP...A....K..E...E....K.....K..E...E...K...K......K...E....E..K....K.EE..KKDE...................S..DSDA........MAG.lSSLF...............................
F9XB28_ZYMTI/229-312                   ......................................................................YPTLPSVMHSVVN......SY.K.K.VI.....SVAIE..T.......E.Y.E...W.......DA............I.H...EL.K.DR.I.KNPDAY--............................................AS-AA.P.AA...A....A..A...T....E.....T..A...A...D...A......P...A....A..A....K.EE..EKE-...................E..SEDD........DMG..FGLF...............................
A2STT7_METLZ/16-102                    .....................................................................t-VDEESVKAVLSA......AG.I.A.VD.....DSRVK..A.......L.I.A...A.......LD............G.V...DI.E.EA.I.SKAAAAPV............................................AVAAA.P.AA...A....G..A...A....A.....A..V...E...E...A......A...A....P..E....E.NK..EEE-...................-..EENA........MAG.lGALF...............................
W5JMB2_ANODA/231-315                   ......................................................................YPTLASVPHSIAN......GF.R.N.LL.....AIAAV..T.......E.V.E...F.......KE............A.E...TV.K.EF.I.KDPSKFA-............................................AANAS.A.AP...A....A..A...A....A.....S..A...A...P...A......A...K....A..E....E.KE..ESE-...................-..DEDE........DMG..FGLF...............................
A0A2H3FSQ9_9HELO/229-312               .....................................................................f-PTLPSVMHSVVN......SY.K.K.VL.....AVAIS..T.......E.Y.S...W.......PE............I.D...EL.K.DR.I.ANPDAY--............................................AS-AG.P.AA...T....T..E...A....A.....P..A...A...A...A......A...A....A..E....P.EE..EEEE...................D..SADE........GFG..-GMF...............................
D7G7B6_ECTSI/10-100                    ......................................................................SPTKEDVTTALAA......VG.I.E.CD.....EARLD..Q.......L.I.A...D.......MA............G.K...DI.A.AL.I.EAGKGKLAs.........................................fgGGGGG.G.GG...G....G..G...G....G.....D..A...A...P...A......A...E....E..K....K.VE..EEE-...................-..EEEI........DMG..GGM-dmf............................
A0A0L0D948_THETB/17-104                ......................................................................SPSAADVEKILNA......VG.S.E.VD.....STCTA..K.......V.I.E...S.......LN............G.Q...SV.E.AL.I.EAGQEKFAs..........................................vPTGAA.A.PA...A....G..A...A....P.....A..A...G...D...A......P...A....A..A....A.EE..EE--...................E..SSDG........SMG..FGLF...............................
A0A154NZP4_9HYME/231-316               ......................................................................YPTLASAPHSIVN......GF.K.N.LL.....AIAAV..T.......D.I.E...F.......AE............A.A...TI.K.EY.I.KDPSKF--............................................AAAAA.V.VA...P....V..A...A....A.....A..E...A...P...A......A...E....K..K....E.EK..KEET...................E..SEDE........DMG..FGLF...............................
W6ZJF7_COCMI/21-119                    ......................................................................EITADKLQSLIKA......AK.VeD.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGSGGGaa........................................apAAAGG.A.AA...A....G..G...A....A.....D..A...A...P...A......A...E....E..K....K.EE..---Ddptn..........tptekE..ESDE........DMG..FGLF...............................
F2X232_AILME/17-114                    ......................................................................SPSAKDIKKILDS......VG.I.E.AD.....DDRLN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGIGKLAsvpa....................................ggavTVSAA.P.GS...A....A..P...A....A.....G..A...A...P...A......A...A....E..E....K.KD..EKKEe.................sE..ESDD........DMG..FGLF...............................
A0A2C5WV68_9PEZI/17-107                .....................................................................a-PSKEQIVKILSS......VG.I.E.SD.....DERLE..K.......L.L.S...E.......LE............G.K...NI.S.EL.I.AEGSAKLAsv........................................psGGAAA.A.SS...G....A..A...A....G.....G..A...A...E...E......A...K....E..E....A.KE..EEK-...................E..ESDD........DMG..FGLF...............................
G8JUX7_ERECY/20-104                    ......................................................................EISSEKLLTLAKA......AN.V.E.IE.....GIWAD..I.......Y.A.R...A.......LD............S.Q...NL.K.DL.L.VKFEGG--............................................-AAAA.P.VV...G....A..A...A....G.....G..A...A...A...E......E...E....A..E....E.KE..EEAK...................E..ESDD........DMG..FGLF...............................
H2NIU8_PONAB/231-316                   ......................................................................YPTVASVPHSIIN......GY.K.R.VL.....ALSVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFVA............................................--AAP.V.AA...A....T..T...A....A.....P..A...A...A...A......A...P....A..K....V.EA..KEES...................E..ESDE........DMG..FGLF...............................
N4V8B6_COLOR/17-109                    ......................................................................SPSAADVKAVLES......VG.I.E.AD.....DERLN..K.......L.I.S...E.......LE............G.K...DI.N.EL.I.SEGSSKLAsvp......................................sggAGGAA.P.AA...G....A..A...A....G.....G..A...A...A...D......E...P....E..A....P.KE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A2K1XTJ3_POPTR/21-92                 ......................................................................SITAEKIATLVKA......AN.V.Q.IE.....SYWPG..L.......F.A.K...L.......AE............K.R...NI.E.DL.I.MNVGSGGG............................................AAVAV.A.AP...A....G..G...A....T.....A..P...A...D...A......P...A....A..E....E.K-..----...................-..----........---..----k..............................
A0A0E0IXV3_ORYNI/687-772               ......................................................................YPTIAAAPHMFLN......GY.K.N.VL.....AVAVE..T.......E.Y.S...Y.......PH............A.D...KI.K.EY.L.KDPSKF--............................................AVAAP.V.AA...A....D..S...G....A.....A..A...V...A...A......S...K....E..E....E.KK..EEPE...................E..ESDV........---..----knylgls........................
D7LPU7_ARALL/17-115                    ......................................................................NPTSNDLKKILES......VG.A.E.ID.....ETKID..L.......L.F.S...L.......IK............D.H...DV.T.EL.I.AAGREKMAalssg..................................gpavaMVAGG.G.GG...G....G..G...A....S.....A..A...E...P...V......A...E....S..K....K.KV..EEVK...................D..ESSD........DAG.mMGLF...............................
A4FVF5_XENLA/17-110                    .....................................................................s-PSAGDIKSILKS......VG.I.D.AD.....DERVK..K.......V.I.G...E.......LG............G.K...DL.D.DV.V.NSGLAKLSsvp......................................sggAAAAA.P.AS...T....P..A...A....G.....G..A...A...P...A......E...K....K..E....E.EK..KEES...................E..ESDD........DMG..FGLF...............................
A0A2G9GVC5_9LAMI/17-114                ......................................................................SPSADDLKDILAS......VG.A.D.AD.....EDRIE..L.......L.L.S...Q.......VK............D.K...DV.T.EL.I.AAGREKLAsvpa....................................gggaVAIAA.P.AG...G....A..S...G....G.....A..A...P...A...A......A...A....E..T....K.KE..EKVEe.................kE..ESDD........DMG..FSLF...............................
A0A0R3SI00_HYMDI/231-320               .....................................................................y-PNFASVGHMIAD......GF.K.N.LL.....ALSAA..T.......D.Y.T...F.......KE............S.E...QI.K.EY.L.NDPSKFAT............................................AAPAA.V.EA...V....A..P...A....D.....A..T...A...Pt.kA......A...E....E..T....K.KE..ESEE...................E..ESDE........DMG..FNLF...............................
A0A016VCV0_9BILA/17-92                 ......................................................................SPSAKDILKILGA......GG.L.D.CD.....MEDAN..K.......V.V.D...A.......LA............G.K...SI.A.EL.I.EEGKKKLSsvp......................................sggSAAPA.A.AP...A....A..G...G....G.....G..G...S...A...P......K...D....-..-....-.--..----...................-..----........---..----apr............................
A0A1J6K3D1_NICAT/234-321               .....................................................................y-PTLAAAPYMFVK......GY.K.N.VL.....ALALQ..T.......D.Y.S...Y.......PQ............A.H...QV.K.EY.I.KDPSKFTV............................................AIAAA.A.ES...A....A..S...Q....G.....D..G...D...V...V......K...T....K..Q....D.KK..EDEA...................E..ESED........DAI..FGLF...............................
G3SDP0_GORGO/231-316                   ......................................................................YPTVASVPHSIIN......GY.K.R.VL.....ALSVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFVA............................................--AAP.V.AA...A....T..T...A....A.....P..A...A...A...A......A...P....A..K....V.EA..KEES...................E..ESDE........DMG..FGLF...............................
U6MU67_9EIME/9-107                     .....................................................................a-PTAADVSRVLEA......VG.A.E.VN.....PEVLK..T.......L.I.D...A.......MQ............G.K...TA.H.EV.I.SAGLEKLQkvpcg.................................ggaaaaAAPAA.A.AA...A....A..G...G....G.....D..S...S...S...A......A...K....D..K....K.KE..EPEE...................E..EEDA........DMG..LSLF...............................
A2FUC9_TRIVA/17-102                    .....................................................................k-PTADQVKKILEA......AG.V.D.ID.....AAQLE..Q.......V.V.T...K.......MN............E.K...AV.E.EL.V.ETGKNEMGk..........................................vAGAAP.A.AS...A....A..A...P....A.....A..A...A...E...V......P...K....E..E....A.KE..EE--...................-..----........---..----apmpiglddm.....................
A0A0E3NSU5_9EURY/16-102                .....................................................................a-ISEEAIAAVLQA......AG.V.E.VN.....EARAK..A.......L.V.A...A.......LD............G.V...NI.E.EA.I.AKAAFA--............................................--APA.A.AA...A....P..A...A....A.....E..A...P...A...A......A...E....A..A....V.EE..EEEDd.................tS..EEDG........MAG.lGALF...............................
K3YIN8_SETIT/234-317                   ......................................................................YPTLAAAPHMFIN......GY.K.N.VL.....AVAVE..T.......D.Y.S...Y.......PH............A.D...KI.K.EY.L.KDPSKF--............................................-AVAA.P.VA...A....V..G...S....G.....A..A...A...A...P......K...E....E..E....K.AP..EPA-...................E..ESDE........EMG..FSLF...............................
A0A151X8W5_9HYME/231-317               ......................................................................YPTVASAPHSIVN......GF.K.N.LL.....AVAAV..T.......E.V.E...F.......AE............A.T...TI.K.EY.V.KDPSKFAV............................................AAAAV.A.TP...A....A..A...A....T.....D..A...P...A...A......E...K....K..E....E.KK..EES-...................D..SEDD........DMG..FGLF...............................
R1EJ84_EMIHU/17-113                    ......................................................................SPSAADVTSILDS......VG.V.E.PD.....SEKLE..K.......L.L.G...S.......LE............G.K...DL.V.EV.L.AAGKAKMAampsgg................................ggggggGGGGG.G.DA...A....P..A...A....G.....E..A...A...A...A......P...A....E..K....A.PE..PE--...................-..EEEE........EMG..FDLF...............................
A0A0D2DFG5_9EURO/229-314               ......................................................................YPTLPSVIHSLVN......GY.K.N.LI.....SVALE..V.......D.Y.S...W.......EA............I.E...EL.K.DR.I.ANPDKY--............................................ASAAP.A.AA...A....A..S...S...gG.....A..A...P...A...A......A...K....E..E....E.KE..EEKE...................E..SEDE........GFG..-GLF...............................
H2AX77_KAZAF/229-310                   ......................................................................YPTLPSVGHTLIN......NY.K.D.LL.....AVAIG..S.......G.Y.H...Y.......AE............I.E...EL.V.DR.I.ENPDKY--............................................-ASAA.P.VA...A....A..G...A....S.....E..S...A...P...A......E...A....A..A....E.EE..EE--...................-..ESDA........DMG..FGLF...............................
A0A059DCP2_EUCGR/17-105                .....................................................................c-PSADDLKDILGS......VG.A.E.AD.....DDRIE..L.......L.L.S...E.......VK............G.K...DI.T.EL.I.AAGRERLAs.........................................vpSGGGG.A.VA...V....A..A...A....P.....G..A...A...E...A......K...K....E..E....K.VE..EK--...................E..ESDD........DMG..FSLF...............................
A0A0D3AWE2_BRAOL/17-112                .....................................................................k-PTKDDLKSIFDS......VG.A.E.FD.....EAETD..L.......L.F.S...L.......VK............D.H...DV.A.EL.I.AAGREKMGalss....................................ggagVAMVS.G.AG...G....D..A...P....S.....A..A...E...P...A......A...E....T..K....K.VE..EEK-...................E..ESDD........GEG.mMSLF...............................
A0A195CJ37_9HYME/231-317               ......................................................................YPTVASAPHSIVN......GF.K.N.LL.....AVAAV..T.......D.V.E...F.......AE............A.T...TI.K.EY.I.KDPSKFAV............................................AAAAV.A.TP...A....A..A...A....T.....D..A...P...A...A......E...K....K..E....E.KK..EES-...................D..SEDD........DMG..FGLF...............................
A0A1U7QK56_MESAU/22-113                .....................................................................t-VTEDKINALIKA......AG.V.N.VE.....PFWPG..L.......F.A.K...A.......LA............N.V...NI.G.SL.I.CNVGAGGPa..........................................pAAGAA.P.AG...G....P..A...P....S.....T..A...A...A...P......A...E....E..K....K.VE..AKKEe.................sE..ESDD........DMG..FGLF...............................
M0CQB0_9EURY/16-113                    ......................................................................EINEDNLTDVLDA......AG.V.D.VE.....ESRVK..A.......L.V.A...A.......LE............D.V...DI.D.EA.V.EEAAAVPA............................................GGAAA.G.GA...A....A..A...E....G.....G..D...E...E...G......D...E....E..E....A.SD..V--Pdtt.............dedE..--DE........D--..----edeeasgeglgelf.................
S6F164_ZYGB2/20-106                    ......................................................................EISSDKLLTLTNA......AN.V.P.VE.....GIWAD..I.......F.S.R...A.......LE............A.Q...NL.K.DL.L.VNFSAGAS............................................VGGVA.G.VA...G....G..A...S....G.....E..A...A...G...E......G...E....E..E....K.EE..EAK-...................E..ESDD........DMG..FGLF...............................
A0A200R957_9MAGN/51-120                ............................................vsssfsmitpssavfqviiggggggg-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.-------Gsf........................................vsGGAAA.A.AS...S....G..G...A....A.....A..A...E...A...P......A...A....E..E....K.KE..EKE-...................-..ESDD........DMG..FSLF...............................
Q12UP7_METBU/16-99                     .....................................................................d-ITEESVSAVLSA......AG.T.E.VN.....ESRAK..A.......L.V.A...A.......LE............D.V...DI.E.EA.M.ATAAFA--............................................----P.A.AA...V....V..A...A....P.....V..A...E...T...A......A...E....E..V....P.AE..ENKA...................E..EEES.......gMAG.lGALF...............................
U1HEL1_ENDPU/17-113                    ......................................................................SPSASDIKGVLES......VG.I.D.AE.....DDRLE..K.......L.L.S...E.......LK............D.K...DI.S.TL.I.QEGSSKLAsvps....................................ggagGGAGA.G.GA...A....P..A...A....G.....G..A...A...A...A......E...E....E..K....P.AE..KEEE..................kE..ESDE........DMG..FGLF...............................
A0A2H0ZMX0_CANAR/20-107                ......................................................................EISADKLATLTAK......AD.V.Q.VE.....PIWTE..I.......F.A.R...A.......LE............G.K...DL.K.EL.F.FNIQAAPA............................................AGAAA.A.GA...G....A..A...A....A.....G..G...A...E...D......A...A....A..E....E.KE..EEAK...................E..ESDD........DMG..FGLF...............................
A0A182V6B4_ANOME/23-112                .....................................................................a-VTDEKIATILKA......AN.V.D.IE.....PYWPG..L.......F.A.K...A.......LE............G.I...DV.K.SL.I.TSIGSGVG............................................SGGGA.P.AA...A....A..G...G....A.....G..A...A...P...A......A...A....E..K....K.EE..KKEEe.................pE..ESDD........DMG..FGLF...............................
A0A2H3FCT1_9HELO/17-111                ......................................................................SPSAADVKAVLES......VG.I.E.AD.....DERLS..T.......L.I.S...E.......LK............D.K...DI.N.EL.I.AEGTSKLAsvp......................................sggAGGAA.P.AA...G....G..A...A....A.....S..G...G...A...A......A...D....A..P....A.EE..KEEE..................kE..ESDE........DMG..FGLF...............................
D4AV09_ARTBC/21-109                    ......................................................................EITSDKLQTLIKA......AG.VtD.VE.....PIWTS..L.......F.A.K...A.......LD............G.K...NL.K.DI.L.VNVGSGGGa..........................................pAAGGA.P.AA...G....G..A...A....A.....A..E...A...A...P......A...E....E..E....K.AE..EAE-...................-..ESDE........DMG..FGLF...............................
A0A017S3R6_9EURO/229-310               ......................................................................YPTLPSVMHSLVN......GY.K.K.VL.....SVAVE..T.......E.Y.S...W.......PE............I.D...EL.K.DR.I.ANPEAY--............................................---AS.A.AP...A....A..A...A....P.....S..G...G...D...A......P...A....E..K....K.EE..EEE-...................E..ESDA........DMG..FGLF...............................
I1JPZ4_SOYBN/17-112                    .....................................................................a-PSADDLRDILGS......VG.A.D.AN.....DDNIS..N.......F.L.S...E.......VK............G.K...DI.V.EL.I.ASGREKLAsvp......................................sggGAAVA.V.AA...A....P..G...G....G.....P..A...A...P...A......A...A....E..S....K.KE..EKVEe.................kE..ESDD........DMG..FSLF...............................
W4J340_PLAFP/1-47                      .................................................................qnigg-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.--------............................................GVAAA.P.AG...A....A..A...V....E.....T..A...E...A...K......K...E....D..K....K.EE..KKEE..................eE..EEED........DLG..FSLF...............................
A0A165CDA1_9APHY/229-314               ......................................................................YPTIVSVMHSLVN......AY.K.N.VL.....AVSIA..T.......D.Y.T...F.......EG............S.E...KI.K.EV.L.ANPEAFA-............................................AAAAA.A.AP...A....A..E...A....A.....A..A...E...A...E......A...A....P..A....A.KE..EEE-...................E..ESEG........DMG..FGLF...............................
A0A1F5LFD3_9EURO/229-312               .....................................................................y-PTIPATMHSLIN......GY.K.K.VL.....AVAVE..T.......A.Y.S...W.......PE............I.D...EL.K.DR.I.ANPDAY--............................................ASAAP.A.AA...A....A..A...T....S.....G..G...D...A...P......A...A....A..A....P.AE..DEE-...................-..ESDE........DMG..FGLF...............................
A0A0D2BED2_9EURO/17-112                ......................................................................EPSADDIKGVLSS......VG.V.D.AD.....DERLE..K.......L.I.G...E.......LK............G.K...DI.S.EL.I.AEGSTKLAsvp......................................sggAGGAA.P.AA...G....G..A...A....A.....G..G...A...A...A......A..eE....E..K....P.AE..KEEE..................kE..ESDE........DMG..FGLF...............................
E9Q3T0_MOUSE/22-113                    .....................................................................t-VTEDKINALIKA......AG.V.S.VE.....PFWPG..L.......F.A.K...A.......LA............N.V...NI.G.SL.I.CNVGAGGPa..........................................pAAGAA.P.AG...G....A..A...L....S.....T..A...A...A...P......A...E....E..K....K.VE..AKKEe.................sE..ESED........DMG..FGLF...............................
A0A0D2VUN1_CAPO3/231-314               .....................................................................f-PTVASVPHSIVN......AY.K.N.VL.....AVVAE..I.......D.Y.T...F.......KQ............A.E...KL.K.AY.L.ANPSAF--............................................--AAA.A.AP...V....A..V...A....A.....K..T...E...A...K......K...E....E..P....K.KE..EKKE...................E..SEEG........DMG..FGLF...............................
H0GKN0_SACCK/229-311                   ......................................................................YPTLPSVGHTLIN......NY.K.D.LL.....AVAIV..A.......S.Y.H...Y.......PE............I.E...DL.V.DR.I.ENPEKY--............................................-AAAA.P.AA...S....S..A...A....S.....G..D...A...A...P......A...E....E..A....A.AE..EEE-...................-..ESDD........DMG..FGLF...............................
I3J3T8_ORENI/22-113                    .....................................................................t-VTEDKLNALIKA......AG.V.T.VE.....PFWPS..L.......F.A.K...A.......LS............S.I...DI.G.SL.I.CNVGAGGGa..........................................pAGVAA.A.AG...G....T..T...A....A.....G..D...A...P...A......K...E....E..E....K.KE..EKKEe.................sE..ESDD........DMG..FGLF...............................
F4Q1Q9_CAVFA/17-102                    .....................................................................p-VNADNINKVAKA......AN.I.T.VR.....SFEVE..T.......V.V.R...A.......LS............K.K...SV.E.SI.I.ASAAVA--............................................APSAA.A.AA...P....V..A...A....A.....A..A...A...P...V......A...A....A..K....K.VV..EEKK...................E..ESDD........DMG..MGLF...............................
M7T3Z7_9EURY/16-107                    .....................................................................d-INEENLKKILTA......AG.V.K.AD.....DARVK..A.......L.T.A...S.......LD............G.V...NI.E.EA.I.KTAAVPVA...........................................aAPVAT.P.GA...P....A..V...E....G.....E..A...A...E...K......K...E....E..K....K.KE..KEKPe.................vS..EEEA........AAG.lGALF...............................
A0A063BT28_9HYPO/22-108                .....................................................................d-ITSDKLQALIKA......AG.IqD.VE.....PIWTS..I.......F.A.K...A.......LE............G.K...DI.K.DL.L.VNVGSG--............................................GGAAA.P.AA...A....G..G...A....A.....A..G...G...D...A......A...P....A..E....E.EK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A0B2QYX5_GLYSO/17-78                 .....................................................................t-PSADDIKEILGS......VG.I.E.AD.....EDRIE..S.......F.L.S...E.......VK............G.K...DI.V.EL.I.AAGKEKLA............................................SV-PS.G.G-...-....-..-...-....-.....-..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----gggggvlve......................
A0A2H3CEN0_9AGAR/229-311               ......................................................................YPTIVSVAHSLVN......AY.K.N.VL.....AISLA..T.......E.Y.T...F.......DG............S.E...KV.K.EY.L.ANPDAF--............................................AVAAA.P.AA...A....E..-...A....A.....P..A...A...A...A......V...E....E..K....E.PE..KEE-...................-..ESDD........DMG..FGLF...............................
G7KGX1_MEDTR/234-320                   ......................................................................YPTLAAAPHMFVN......AY.K.N.VL.....AVAVA..T.......E.Y.S...F.......PE............A.D...KV.K.EF.L.KDPSKFAV............................................AAVAA.P.AD...V....S..G...A....T.....P..A...P...A...A......A...A....A..A....A.AA..EPE-...................E..ESDD........DIG..FGLF...............................
A0A0V0X2Y9_9BILA/251-339               ......................................................................YPTAASAPHMIAN......AF.K.N.LL.....SIAAV..T.......D.I.T...F.......KE............A.E...KL.K.EY.L.ADPSKFAV............................................AAAPA.A.AA...A....D..S...S....K.....A..E...K...E...D......S...S....S..K....K.KE..EKVE...................E..ESDE........EEG.mGGLF...............................
A0A1C7NK93_9FUNG/20-105                ......................................................................EITADKLQALVAA......AG.I.E.VE.....PIWFS..L.......Y.A.K...A.......LA............G.Q...DL.K.AL.L.LNVGAP--............................................GAGPA.V.AA...G....G..A...A....A.....G..G...A...A...D......A...P....A..E....E.EK..AEEK...................E..ESDD........DMG..FGM-l..............................
A0A1J4L1F2_9EUKA/21-105                ......................................................................EVSADNVNKLLSA......AG.V.K.LE.....SYWVD..L.......F.A.E...Y.......FK............S.H...DI.S.EL.V.KGTCLG--............................................--GAA.P.AA...G....A..A...A....A.....G..G...A...A...A......E...E....T..K....E.EK..KEEE...................E..V---........---..----velaggfddlf....................
A0A2A9PE40_9HYPO/229-312               .....................................................................f-PTMPSVMHSVVN......GY.K.K.LL.....AVAIE..T.......E.Y.S...W.......PE............I.E...EL.K.DR.I.ANPDAY--............................................ASAAP.V.AA...A....G..G...A....G.....G..G...K...P...A......A...E....E..K....K.EE..SEE-...................-..DSDD.......pGMG..-GLF...............................
A0A094E2H5_9PEZI/60-137                ....................................................................qr-------------......--.-.-.AD.....SERLD..A.......L.I.A...E.......LK............G.K...DI.N.TL.I.SEGSAKLAsvp......................................sggGGGAA.A.AG...G....A..A...A....G.....G..A...A...E...A......A...P....A..E....E.KE..EEK-...................E..ESDE........DMG..FGLF...............................
G1LEW2_AILME/231-316                   ......................................................................YPTVASVPHSIIN......GY.K.R.VL.....ALSVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFVA............................................--AAP.V.AA...A....T..T...A....A.....P..A...A...A...A......A...P....A..K....V.EA..KEES...................E..ESDE........DMG..FGLF...............................
I7MA52_TETTS/93-183                    ......................................................................QPSEADVKALIES......VN.G.T.VD.....ATKLS..S.......F.M.N...V.......IK............G.K...NI.E.DV.I.KAGLSKVGn.........................................igGAAPA.A.AP...A....A..A...T....K.....A..P...E...A...K......K...E....E..P....K.KE..EPKK...................-..EEDD........FEG.aGDLF...............................
A0A1S3E015_CICAR/21-111                .....................................................................a-ITAEKINTMLKA......AG.A.T.VE.....SYRPS..L.......F.A.K...L.......AQ............N.K...SI.D.DL.V.LNAGAAGGav........................................vvVSAPA.A.AA...A....G..G...A....A.....A..A...A...A...P......A...A....E..A....K.KE..EAK-...................E..ESDD........DMG..FSLF...............................
A0A0D2MQK0_9AGAR/229-311               .....................................................................y-PTIVSVSHTLVN......AY.K.N.VL.....AISLA..T.......E.Y.T...F.......EA............S.E...KI.K.EY.L.ANPDAF--............................................-AVAA.P.VA...A....A..A...D....A.....P..A...A...A...A......A...V....E..E....K.EE..EKE-...................-..ESDD........DMG..FGLF...............................
A0A1J1H4Q7_PLARL/32-117                .....................................................................s-ITSDNILKLIKK......SK.N.T.VL.....PYLPM..L.......F.E.K...A.......LK............G.K...DI.E.GL.L.TNLNVG--............................................GAPSP.S.AQ...V....T..T...E....K.....P..S...E...E...K......K...E....A..K....K.EE..KVEE...................E..EEED........DLG..FSLF...............................
A0A1L9PUF3_ASPVE/17-113                ......................................................................EPSGEDIKEVLAS......VG.I.Y.AD.....ESRLG..Q.......L.L.D...E.......LR............G.R...DI.N.EL.I.AEGTSKLAtigs....................................nasgGGDNV.P.DT...E....K..G...A....D.....D.gS...G...S...A......N...G....G..S....D.AD..GDED...................E..DEDG........DFG..LGLF...............................
A0A0G2K4Q1_RAT/59-92                   .................................................................spiht-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.--------............................................-----.-.--...-....-..A...A....A.....P..A...E...E...K......K...V....E..T....K.KE..ES--...................E..ESED........DMG..FGLF...............................
F1NB66_CHICK/231-315                   ......................................................................YPTIASVPHSIVN......GY.K.R.VL.....AVAVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFVA............................................AAPVV.V.ET...A....A..P...A....A.....A..A...A...P...A......K...E....A..P....K.EE..SE--...................-..ESDE........DMG..FGLF...............................
B6H919_PENRW/229-311                   ......................................................................YPTLPSVMHSLIN......GY.K.K.VL.....AAAIS..T.......D.Y.S...W.......AE............I.D...EL.K.DR.I.ANPDAY--............................................-ASAA.P.VA...A....A..A...T....S.....G..G...E...A...A......A...A....A..A....P.AE..EEE-...................-..ESDE........DMG..FGLF...............................
I2GVW8_TETBL/16-105                    .....................................................................t-PSADKVQAVLES......VG.I.E.VE.....ADKVS..S.......L.M.T...A.......LE............G.K...SV.E.EL.V.AEGTEKMAsv........................................paAGPAA.S.GS...A....G..A...A....A.....G..A...A...D...A......A...E....E..A....A.AE..EAE-...................-..ESDD........DMG..FGLF...............................
A0A2K5N115_CERAT/13-96                 ...................................................................alt----------LHA......TG.V.N.VE.....PFWSS..L.......F.A.M...A.......LA............N.V...NT.G.SL.I.YNVGAGGPa..........................................pAAGAT.P.AG...D....P..A...H....S.....T..T...A...A...P......A...K....E..K....K.VE..AKK-...................E..ESEEc......dDMG..FS--rf.............................
U1QTC0_9EURY/16-113                    ......................................................................EINEQNLTDVLEA......AG.V.S.VE.....QSRVK..A.......L.V.A...A.......LE............D.V...DI.D.EA.V.DEAAAVPAg.........................................gaATGGA.A.AG...G....A..E...T....V.....E..E...D...D...D......D...E....E..V....E.EE..EAEE...................-..EDDDdd...dddDAG..----eglgelf........................
A0A1E4RTV6_CYBJA/229-311               ......................................................................YPTLPSVGHSVVN......SY.K.D.LL.....AVAIA..S.......K.F.I...F.......PE............I.E...EL.A.DR.I.ENPDKY--............................................AS-AA.P.VA...A....A..A...S....G.....S..A...E...A...A......P...A....E..A....A.AE..EEE-...................-..ESDD........DMG..FGLF...............................
A0A0D3DC34_BRAOL/17-112                ......................................................................NPNKGDLKNIFDS......VG.A.E.FD.....ETKTD..L.......F.F.S...L.......VK............D.H...DV.T.EL.I.AAGREKMGals.....................................sgggAVAMV.A.GA...G....G..D...A....P.....S..A...A...E...P......A...T....E..S....K.KV..EEEK...................E..ESDD........GEG.mMSLF...............................
C6H5J3_AJECH/21-109                    ......................................................................EITADKLQTLLKA......AN.VqD.VE.....PIWST..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNIGSGGG............................................AAAAV.A.SG...A....G..P...V....A.....A..E...T...G...G......A...E....E..K....V.EK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A2K5JI75_COLAP/22-113                .....................................................................t-VTEDEINALIKA......AG.V.N.VE.....PFWPG..L.......F.A.K...A.......LA............N.V...NI.G.SL.I.CNVGAGGPa..........................................pAAGAA.S.AG...G....P..A...P....S.....T..A...A...A...P......A...E....E..K....K.VE..AKKEe.................sE..ESDD........DIG..FGLF...............................
J9K3E2_ACYPI/23-110                    .....................................................................d-ITGEKIQTVLKA......AN.V.E.VE.....PYWPG..L.......F.A.K...A.......LE............N.A...NV.K.DL.I.TNIGSAVG............................................AVPAA.G.AA...A....A..A...P....A.....A..E...A...K...E......E...K....K..E....E.KK..EEES...................E..EEDD........DMG..FGLF...............................
A0A0Q4B8R9_9EURY/231-332               ......................................................................YPTKQTINPLLVK......AY.R.-.-E.....ATAVS..M.......K.A.A...I.......PT............R.D...NI.K.LL.L.AKANAEMLavasripgl..........................eddrlkqqlTAQVA.A.AP...A....P..Q...E....K.....K..A...E...E...K......K...D....E..D....K.PE..V---...................S..EEEA........AAG.lSALF...............................
A0A1A9ZQR1_GLOPL/22-109                .....................................................................a-VTGEKISTILKA......AN.V.E.VE.....PYWPG..L.......F.A.K...A.......LE............G.V...NV.K.DL.I.TNIGSG--............................................VG-GA.P.AA...A....A..P...A....G.....G..E...A...A...P......A...A....E..A....K.KE..EKKEs................epE..ESDD........DLG..FALF...............................
M1D5E9_SOLTU/21-107                    .....................................................................p-ITAEKISTLVKA......AN.V.T.VE.....PYWPL..L.......F.A.K...L.......AE............K.R...NL.G.DL.I.MNVGAGGG...........................................gGAVAV.A.AP...T....G..G...A....A.....A..A...A...P...A......A...E....E..K....K.EE..PKE-...................-..ESDD........DMG..FSLF...............................
A4I2U1_LEIIN/238-323                   .....................................................................i-PTSSTIGPMLVD......AF.K.N.LL.....AVSVA..T.......S.Y.E...F.......EEh..........nG.K...EL.R.EA.A.INGLLA--............................................--GSG.S.AA...A....E..P...A....A.....A..A...P...A...A......P...S....A..A....A.KE..EPE-...................E..SDED........DFG.mGGLF...............................
A0A060S2P3_PYCCI/21-109                ......................................................................EITPDKILTLTSA......AH.V.E.LE.....PIWAT..L.......L.A.K...A.......LE............G.K...NV.K.DL.L.SNVGAGGAg..........................................pAAAAA.P.AA...G....A..S...A....G.....A..A...A...E...A......P...K....E..E....E.KK..EEK-...................E..ESDD........DMG..FGLF...............................
Q7PNA9_ANOGA/23-112                    .....................................................................a-VTDEKIATILKA......AN.V.D.IE.....PYWPG..L.......F.A.K...A.......LE............G.I...DV.K.SL.I.TSIGSGVG............................................SGGGA.P.AA...A....A..G...G....A.....G..A...A...P...A......A...A....E..K....K.EE..KKEEe.................pE..ESDD........DMG..FGLF...............................
V8NRP9_OPHHA/69-153                    .....................................................................t-ITEDKINVLIKA......AG.M.N.VE.....PFWLG..L.......F.E.K...A.......PT............N.I...DI.G.SL.I.CNVGVGGG...........................................aPAASA.P.TG...G....G..T...P....A.....G..G...A...A...P......A...E....E..K....K.EE..EKK-...................E..ESEE........PM-..----tt.............................
A0A1E5RL84_9ASCO/16-104                .....................................................................t-PSVEAISAVVAA......SG.V.E.AD.....AAQIE..A.......L.I.A...K.......LE............G.K...TV.E.EL.V.AAGNEKLSs..........................................vPVGAA.A.PS...G....A..A...A....S.....G..S...S...E...A......A...A....E..E....K.EA..SEA-...................E..ESDD........DMG..FGLF...............................
A0A182XZS7_ANOST/37-127                .....................................................................a-VTDEKIATILKS......AN.V.E.IE.....PYWPG..L.......F.A.K...A.......LE............G.I...DV.K.SL.I.TSIGSGVG...........................................sGGGAA.P.AA...A....A..A...G....A.....G..A...A...P...A......A...A....E..K....K.EE..KKEEe.................pE..ESDD........DLG..FGLF...............................
G3HDY7_CRIGR/192-273                   .........................yptvasvphsiingykrvlxxxxxxxxxxxxxxxxxxxxxxxxxx-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.--------............................................-XGPP.P.PP...S....L..P...A....A.....A..A...A...P...A......K...A....E..A....R.EE..SE--...................-..ESDE........DMG..FGLF...............................
A0A0B0MIG5_GOSAR/166-252               .....................................................................f-PTLAAAPHMFIN......AY.K.T.AL.....SLAVA..T.......E.Y.T...F.......PQ............A.E...KI.K.EY.L.KDPTKFAV...........................................aVGGDA.G.AP...A....T..S...A....K.....E..E...K...A...E......Q...S....E..P....A.KE..EEE-...................-..ESDE........DLV..AGLF...............................
H0XF20_OTOGA/17-114                    ......................................................................SPSAKDIKKILDS......VG.I.E.AD.....DDRLN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGIGKLAsvpa....................................ggavAVSAA.P.GA...V....V..P...A....A.....G..S...A...P...A......A...A....E..E....K.KD..EKKEe.................sE..ESDD........DMG..FGLF...............................
A0A2H3E459_ARMGA/229-311               ......................................................................YPTIVSVAHSLVN......AY.K.N.VL.....AVSLA..T.......E.Y.T...F.......DG............S.E...KV.K.EY.L.ANPDAF--............................................AVAAA.P.AA...A....E..-...A....A.....P..A...A...A...A......V...E....E..K....E.PE..KEE-...................-..ESDD........DMG..FGLF...............................
A0A0L1I1Z2_9PLEO/21-110                .....................................................................d-ITSDKLQSLIKA......AK.IeD.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGSGGG............................................AAAPA.A.GG...A....A..A...A....G.....G..A...A...D...A......A...P....A..A....E.EK..KEEE..................kE..ESDE........DMG..FGLF...............................
B9SNZ6_RICCO/35-121                    .............................qrklvnlaassdssggvqssfsyvtpssavfqviigggggg-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.-------Gfi........................................ggGAAAA.A.AP...A....G..G...A....A.....A..A...A...E...A......P...A....E..E....K.KK..EEPA...................E..ESDD........DMG..FSLF...............................
Q29N41_DROPS/22-111                    .....................................................................a-VTGEKISTILKA......AN.V.E.VE.....PYWPG..L.......F.A.K...A.......LE............G.I...NV.K.DL.I.TSIGSGVGa.........................................apAGGAA.A.PA...A....A..D...A....P.....A..A...E...S...K......K...E....E..K....K.KE..EES-...................D..VSDD........DMG..FGLF...............................
A0A1I7U4V3_9PELO/17-106                .....................................................................d-PKADDLKKILTA......AG.V.N.AD.....AEGIN..S.......V.V.T...A.......LQ............G.K...TI.Q.EV.I.AEGKTKIAs.........................................vpTGGAP.A.AS...S....S..A...P....A.....A..A...A...A...D......S...K....P..A....K.KE..EP-K...................E..ESDE........DMG..FGLF...............................
H2P057_PONAB/231-311                   ......................................................................YPTVASVPHSVIN......GY.K.Q.VL.....ALSVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADSSAF--............................................--VAA.A.TT...A....A..P...A....A.....A..A...A...P...A......K...V....E..A....K.EE..SE--...................-..ESDE........DMG..FGLF...............................
B4N0U4_DROWI/22-112                    .....................................................................a-VTGEKISTILKA......AN.V.E.VE.....PYWPG..L.......F.A.K...A.......LE............G.V...NV.K.DL.I.TNIGSGVGaa........................................paGGAAA.P.AA...A....A..A...P....A.....G..G...E...A...K......K...E....E..K....K.KE..EES-...................D..VSDD........DMG..FGLF...............................
A0A094ELX9_9PEZI/229-311               .....................................................................f-PTLPSVMHSVVN......SY.K.N.VL.....AVAVS..T.......E.Y.S...W.......TE............I.E...EL.K.ER.I.ANPEKF--............................................--ASA.T.VA...T....T..S...D....A.....P..K...A...A...A......A...E....E..K....K.EE..SEA-...................-..EESG........DEG.fGGLF...............................
B7GA61_PHATC/17-105                    ......................................................................SPTKDDITQALSA......VG.V.E.VD.....GADLD..R.......M.L.A...D.......LE............G.Q...DL.E.AL.L.ESGNALLA...........................................tFGGGG.G.GG...G....A..A...A....A.....G..G...E...A...A......V...E....E..K....V.EE..KE--...................E..EEEM........DLG..GGM-dmf............................
A0A1L8I062_XENLA/231-313               ......................................................................YPTVASVPHSVIN......GY.K.R.VL.....AIAVE..T.......D.Y.S...F.......PL............A.D...KV.K.AF.L.ADPSAF--............................................-VVAA.P.AA...Q....A..A...A....A.....P..A...A...E...A......A...K....D..E....K.QE..ESE-...................-..ESDD........DMG..FGLF...............................
A0A135VNQ3_9ARCH/16-102                ....................................................................kl--TAKAMEDTLTA......AG.V.T.PD.....KGRVK..A.......L.L.A...A.......LK............D.V...DI.D.EA.L.KSAAAM--............................................PVAAA.P.VA...A....G..G...A....A.....A..A...E...E...K......K...E....A..K....K.EE..KEEE...................K..EEEF........TAG.lGSLF...............................
A0A0D3HR34_9ORYZ/795-880               ......................................................................YPTXAAAPHMFLN......GY.K.N.VL.....AVAVE..T.......E.Y.S...Y.......PH............A.X...KI.K.EY.L.KDPSKF--............................................AVAAP.V.AA...A....D..S...G....A.....A..A...V...A...A......S...K....E..E....E.KK..EEPE...................E..ESDV........---..----knylgls........................
L5LJH3_MYODS/63-135                    .....................................................................s-VTEDKINTLIKA......AG.V.N.VE.....PFWPG..L.......F.A.K...A.......LA............N.V...KI.G.SL.I.CNVGADGPa..........................................pAASAA.P.AG...G....P..A...P....S.....T..A...A...A...P......A...E....E..K....-.--..----...................-..----........---..----dt.............................
A0A182LYR4_9DIPT/17-111                .....................................................................a-PSNSDIEKILSS......VG.I.E.AD.....STRVT..K.......V.V.N...E.......LK............G.K...SI.E.EL.I.ASGREKLSsmp.....................................agggAAAAA.P.AA...A....A..G...G....A.....A..A...A...P...A......A...E....K..K....E.EK..KEES...................E..DEDE........DMG..FGLF...............................
M4E983_BRARP/17-112                    ......................................................................NPTKGDLKNIFDS......VG.A.E.FD.....ETKTD..L.......F.F.S...L.......VK............D.H...DV.T.EL.I.AAGREKMGalss....................................ggaaVAMVA.G.AG...G....D..A...P....S.....A..A...E...P...A......A...E....S..K....K.VE..EE-K...................E..ESDD........GEG.mMSLF...............................
A0A068XUG9_ECHMU/22-120                ......................................................................EVTADKLNTLLKA......AN.C.KfVE.....SYVTS..L.......F.A.N...A.......LS............G.R...NI.K.DI.V.SATSSVSVa.........................................paPAVAP.G.PA...A....S..K...A....S.....G..A...A...P...A......A...Ec.vpE..S....K.KE..EEKKke...............esE..ESDG........DMG..FDLF...............................
A0A078IFI2_BRANA/35-119                ................................qrklvqtalsadssggvqssfslvspssavfqviiggg-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.----SGGGf..........................................aAGGGA.A.AG...G....G..G...G....G.....E..A...A...A...A......T...K....E..E....E.KK..KEES...................E..EEEG........DFG..FDLF...............................
A0A0L0SPN6_ALLMA/231-310               .....................................................................v-PTVASVPHSLIN......AY.K.N.VL.....SIALA..T.......E.I.S...F.......PL............A.D...AV.K.DR.I.NNPEAY--............................................-----.A.AA...A....P..A...A....S.....E..A...A...P...A......A...A....A..A....V.VE..EEE-...................E..EEDD........DMG..FGLF...............................
L0AAV7_CALLD/21-108                    ....................................................................ql--NEDNLKKVVES......LG.L.Q.AD.....DAKVK..M.......L.V.A...S.......LS............E.L...KL.D.EV.L.KSAAVAVS............................................APVSA.P.VS...A....P..A...E....A.....E..K...K...E...E......K...K....E..E....K.KE..EENK...................-..EVDV........SEG.lSGLF...............................
A0A1B7NG81_9HOMO/17-89                 ......................................................................SPSAGDVQKVLNA......VG.I.E.SD.....EDRLE..K.......L.I.S...E.......LD............G.K...DI.N.AL.I.AEGSAKLS............................................-----.-.--...-....-..-...-....-.....-..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----svsldqkntkelitygrsrfllaals.....
H2LMY7_ORYLA/17-114                    ......................................................................NPEAGDIKKILDS......VG.I.E.AD.....SERLG..K.......V.L.S...E.......LK............G.K...NV.E.EV.I.AAGYSKLAsmpa....................................ggavAVASS.A.AG...G....A..G...G....A.....A..A...P...A...A......A...V....E..E....K.KE..EKKEe.................sE..ESDD........DMG..FGLF...............................
A0A2K5HM78_COLAP/23-114                .....................................................................s-VTEDKIKALIKA......AG.V.N.VE.....PFRPG..L.......F.A.K...A.......LA............N.V...SI.G.SL.I.CNVGAGGPa..........................................pAAGAA.P.AG...G....P..A...P....S.....T..A...A...A...A......A...E....E..K....K.VE..AKKEe.................sE..DSDD........DMG..FGLF...............................
RLA1_SCHPO/21-108                      ......................................................................EITSDKLLSLTKA......AN.V.D.VE.....PIWAT..I.......F.A.K...A.......LE............G.K...DL.K.EL.L.LNIGSGAG............................................AAPVA.G.GA...A....A..P...A....A.....A..D...G...E...A......P...A....E..E....K.EE..AKEE...................E..ESDE........DMG..FGLF...............................
F2U1N9_SALR5/229-310                   .....................................................................l-PNAASVPHMVAN......GY.K.N.VL.....AVAVA..T.......E.I.S...F.......PL............A.E...KA.K.AF.L.ADPSAF--............................................---IV.A.AP...A....A..A...T....G.....G..A...E...E...K......K...D....E..P....E.PE..PEE-...................-..ESDD........DMD.gFSLF...............................
S9V3Y4_9TRYP/21-107                    ....................................................................nd---AASILAVTKA......AG.V.D.VS.....SGMAA..A.......F.A.S...A.......LA............T.V...KV.S.EV.L.DNISFGGA...........................................aPAAGG.A.AP...A....A..-...A....A.....G..G...A...A...P......A...A....A..K....K.EE..KPAE...................E..EGDD........DMG..FGLF...............................
A4SAM0_OSTLU/232-312                   ......................................................................YPTLASVPHSIVN......AY.K.N.VL.....AISIG..T.......D.Y.T...F.......EL............A.Q...KV.K.DY.L.ANPGAF--............................................AS-AA.P.AA...G....G..D...A....A.....A..G...G...A...A......K...A....A..A....V.EE..EE--...................-..-EEA........EMD..FDLF...............................
B4LE06_DROVI/231-316                   ......................................................................YPTIASAPHSIAN......GF.K.N.LL.....AIAAT..T.......E.V.E...F.......KE............A.T...TI.K.EY.I.KDPSKF--............................................AAAAA.T.SA...P....A..A...A....G.....G..A...A...E...K......K...E....E..A....K.KV..ESES...................E..EEDD........DMG..FGLF...............................
A0A0G4KSX6_9PEZI/192-274               .....................................................................f-PTLPSVIHSLVN......SY.K.K.VL.....AVAIE..T.......E.I.S...W.......PE............I.E...SL.K.DR.I.ANPDAY--............................................---AA.A.AP...A....A..S...S....G.....A..V...E...T...K......A...E....E..K....A.EE..KEE-...................E..ESDE........DGG.fGGLF...............................
A0A195BNB3_9HYME/231-317               ......................................................................YPTVASAPHSIVN......GF.K.N.LL.....AVAAV..T.......E.V.E...F.......AE............A.T...TI.K.EY.V.KDPSKFVV............................................AAAAV.A.TP...A....A..A...A....A.....D..A...P...A...A......E...K....K..E....E.KK..EES-...................D..SEDD........DMG..FGLF...............................
A0A0C2YUF0_9HOMO/21-110                ......................................................................EITAEKITTLTTA......AG.V.D.FE.....AIWAN..L.......L.A.K...A.......LE............G.K...DI.K.EL.L.LNVGAGGGap........................................aaGAVTA.G.GA...A....P..A...A....A.....E..A...E...A...P......K...E....E..E....K.KE..EK--...................E..ESDD........DMG..FGLF...............................
A0A0R3XDL8_HYDTA/1-76                  .....................................................................l-------------......--.-.-.-L.....AISVA..S.......D.Y.T...F.......KE............S.E...EI.K.EY.L.ADPSKFAGvv.......................................aagGPVAC.G.EA...E....V..V...D....K.....A..A...A...P...T......E...T....K..A....S.ES..EKEE...................S..ESEG........DMG..FSLF...............................
A0A1E3H9Z9_9TREE/229-313               .....................................................................i-PTIASVVHSLVN......SY.K.N.VL.....NVSLA..T.......D.Y.E...F.......EG............S.Q...KI.K.EY.L.ANPEAF--............................................AVAAA.P.AA...A....E..G...A....A.....A..G...G...D...A......P...A....A..K....E.EA..KDE-...................E..SEDD........DMG..FGLF...............................
A0A238F902_9BASI/229-310               ......................................................................YPTIASVTHSLVN......SY.K.N.LL.....AIALA..T.......D.V.T...F.......EG............A.E...KV.K.EY.L.ANPEAF--............................................---AA.A.AP...A....V..T...E....S.....A..A...A...P...A......K...A....E..E....K.EP..EKE-...................E..ESDD........DMG..FGLF...............................
A0A074XFT6_AURPU/17-108                ......................................................................QPSAEDIKSVLSS......VG.V.D.AE.....GERLD..K.......L.I.S...E.......LE............G.K...NI.Q.EL.I.SEGSAKLAsv.......................................psgGAGAA.A.GS...A....P..A...A....G.....A..A...A...E...A......A...P....A..E....E.KA..EEK-...................E..ESDD........DMG..FGLF...............................
Q5ANH5_CANAL/17-110                    ......................................................................SPSASDITALLES......VG.V.E.AE.....ESRLQ..A.......L.L.K...D.......LE............G.K...DL.Q.EL.I.AEGNTKLAsvp.....................................sggaAAGGA.S.AS...A....G..A...A....A.....G..G...A...A...E......A...E....E..E....K.EE..EAK-...................E..ESDD........DMG..FGLF...............................
A0A1R2BCH2_9CILI/246-329               .....................................................................i-PTVVSAPHSVIS......GF.K.N.LV.....ALAYG..G.......N.Y.T...F.......AQ............G.A...GL.L.EV.L.KDPSKL--............................................ASLAA.P.TS...A....A..P...T....A.....V..T...A...A...K......E...E....A..K....K.EE..PAD-...................E..EA-G.......iDMG..-GMF...............................
A0A165UA00_9HOMO/17-111                ......................................................................SPTADDVKKVLSA......VG.I.E.AD.....EERLE..K.......L.I.S...E.......LE............G.K...DV.N.EL.I.AEGSSKLAsvp.....................................aggaAVSAA.P.AA...G....A..A...A....A.....G..A...A...A...A......E...E....A..E....E.KK..EEEK...................E..ESDD........DMG..FGLF...............................
F4WNI7_ACREC/22-109                    .....................................................................a-VTGEKIQTILKA......AN.V.N.VE.....SYWPG..L.......F.A.K...A.......LE............G.I...SV.K.EL.I.TNIGSGVGa..........................................aPVGAV.P.AA...A....A..P...V....S.....T..E...A...A...P......A...K....E..E....K.KK..EEPE...................E..ESDD........DMG..F---v..............................
A0A067Q3X5_9HOMO/17-111                ......................................................................NPSAADIKKVLSS......VG.I.E.AD.....EDRLK..T.......L.L.S...E.......LK............G.K...DI.N.TL.I.AEGSSKLAsvp......................................sggAVASS.G.AA...S....G..G...G...gA.....P..A...A...A...A......A...E....E..K....E.EE..KEEE...................K..ESDD........DMG..FGLF...............................
A0A0F2LX59_SPOSC/100-165               .................................................................tpacn-------------......--.-.-.--.....-----..-.......-.-.D...A.......LE............G.K...EV.K.DL.L.SNVGSG--............................................GGAAA.P.AA...G....G..A...A....G.....G..A...A...A...A......A...E....E..T....K.EE..EKVEe.................kE..ESDD........DMG..FGLF...............................
H0GEJ4_SACCK/17-109                    .....................................................................a-PSAADIKAVVES......VG.A.E.VD.....EARIN..E.......L.L.S...S.......LE............G.K..gSL.E.EI.I.AEGQKKFAtv.......................................ptgGASSA.A.AG...A....A..G...A....A.....A..G...G...D...A......A...E....E..E....K.EE..EAK-...................E..ESDD........DMG..FGLF...............................
F4PNB1_CAVFA/622-701                   ......................................................................YPTVASVPHSVMD......AY.K.S.LL.....AIALT..T.......E.I.T...F.......PA............A.D...KF.K.AA.L.SAA-----............................................PVAAA.P.VA...A....A..P...A....A.....A..S...A...P...A......A...-....-..K....V.KE..EPK-...................E..ESDD........DMG..MGLF...............................
M2XVP1_GALSU/18-114                    .....................................................................k-PTADDIKKILTS......VG.V.E.VE.....EDRVT..Q.......V.V.E...A.......LN............G.K...DL.D.EL.M.EQGLQKMTtvpsg..................................ataalA--AA.V.GA...A....P..A...A....T.....G..G...E...S...K......E...S....A..K....A.AE..KEEA..................aE..ESDE........DLG..FGLF...............................
A0A024UC28_9STRA/26-113                ......................................................................EITSEALSTVIAA......SG.N.E.VE.....PYWPT..L.......F.A.G...L.......LS...........kD.G...KM.L.EL.I.TSGGAI--............................................GGGAA.A.AP...A....A..A...A....A.....A..D...A...G...A......A...A....P..A....K.KE..EKK-...................E..EEDA........DLG..GGM-dmf............................
A0A093NXI2_PYGAD/17-114                ......................................................................SPTSKDLKKILDS......VG.I.E.TD.....DERMN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGNGKLAsmpa....................................ggavAASAG.G.GS...A....A..P...A....A.....A..A...A...P...A......A...A....E..E....K.KE..EKKEe.................sE..ESDD........DMG..FGLF...............................
F6TTP1_HORSE/55-140                    ......................................................................YPTVASVPHSIIN......GY.K.R.VL.....ALSVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFVA............................................--AAP.V.AA...A....T..T...A....A.....P..A...A...A...A......A...P....A..K....V.EA..KEES...................E..ESDE........DMG..FGLF...............................
B9PJK1_TOXGV/19-112                    .....................................................................a-PTKKQVEKTLSS......VG.I.D.VE.....DDIMD..A.......F.F.K...A.......VE............G.K...TP.H.EL.I.AAGMEKLQkvp.....................................sggvAAAAA.P.AA...G....A..A...D....A.....G..A...G...A...A......A...K....K..E....E.EK..KEE-...................E..EEED........DMG..FSLF...............................
A0A285N6F7_9EURY/16-115                ......................................................................EINEDNLTGVLEA......AG.V.D.VE.....ESRVK..A.......L.V.A...A.......LE............D.V...DI.D.EA.V.DEAAAV--............................................PAAGG.A.AG...G....A..A...G....D.....A..A...A...D...D......D...D....E..D....V.EE..ADEElpdta........ddddddD..EE--........---..----edasgeglgelf...................
A0A0D0D097_9AGAR/229-311               .....................................................................y-PTIVSVMHTLVN......AY.K.N.LI.....AVSLA..T.......D.Y.T...F.......EG............S.E...KI.K.EY.L.ENPEAF--............................................-AVAA.P.AA...A....A..A...A....P.....A..A...E...A...A......K...E....E..A....K.EE..EAE-...................-..ESDE........DMG..LGLF...............................
A0A2K5MZV3_CERAT/17-114                ......................................................................SPSAKDIKKILDS......VG.I.E.AD.....DDRLN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGIGKLAsvpa....................................ggavAVSAA.P.GS...A....A..P...A....A.....G..S...A...P...A......A...A....E..E....K.KD..EKKEe.................sE..ESDD........DMG..FGLF...............................
L0KZG3_METHD/16-101                    ......................................................................EITEDTITAVLQA......AS.T.E.VN.....ESRVK..A.......L.I.A...A.......LE............D.V...DI.E.EA.M.ATAA----............................................-VAAA.P.AA...A....A..P...A....A.....A..A...E...A...P......A...A....E..A....Q.KE..EDTK...................E..EAEEs......gMAG.lGALF...............................
A0A087TID0_9ARAC/17-104                ......................................................................NPSVGDIEKILGS......VG.I.E.VD.....KERAK..K.......V.I.S...E.......LS............G.K...DI.N.EV.I.QSGKSKLAsmpsg..................................ggvvvSGVAA.P.AA...A....A..E...S....S.....P..A...K...E...D......K...K....E..A....K.KE..ESE-...................-..ES--........---..----e..............................
RLA6_SCHPO/17-109                      ......................................................................SPSASDIESVLST......VG.I.E.SE.....SERVE..A.......L.I.K...E.......LD............G.K...DI.D.EL.I.AAGNEKLAtv........................................psGGAAA.A.AA...P....A..A...A....G.....G..A...A...P...A......A...E....E..A....A.KE..EAKE..................eE..ESDE........DMG..FGLF...............................
A0A1X7RAJ0_9SACH/229-311               ......................................................................YPTLPSVGHTLIN......NY.K.D.LL.....AVAIG..S.......G.Y.H...Y.......AE............I.E...EL.V.DR.I.ENPDKY--............................................-ASAA.P.VA...A....A..A...S....A.....S..A...D...A...G......A...E....A..A....A.EE..EES-...................-..EEDD........DMG..FGLF...............................
A0A231MDT6_9EURO/21-109                ......................................................................EITADKIQTLLGA......AK.VaD.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DI.K.DL.L.TNVGSGGA...........................................aAPAAA.G.GA...A....A..G...A....A.....A..P...A...E...A......A...A....E..E....K.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A093XNG5_9PEZI/54-141                .....................................................................d-ITAEKLQTLIAA......AK.VvD.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGSGGG............................................APAAG.G.AA...A....G..G...A....A.....A..A...T...E...D......A...P....A..E....E.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A0K0CUE7_ANGCA/18-89                 .............................................................dnetavctg------------A......GG.L.D.CD.....MEDAS..K.......V.V.D...A.......LA............G.K...SL.N.EV.I.EVGKKKLSsmp.....................................svgvS----.T.AA...A....A..P...S....A.....A..A...A...P...S......-...-....-..-....-.--..----...................-..----........---..----sapqgkl........................
U6NFM5_HAECO/22-114                    .....................................................................a-ITGDKIATLLKA......AN.V.D.FE.....PFWPG..L.......F.A.K...A.......VE............G.V...DV.K.NL.I.TSVSSGVGsg.......................................ggaAAPAG.G.AP...A....A..A...A....P.....A..A...A...A...P......A...A....E..T....K.KK..EEPK...................E..ESDD........DMG..FGLF...............................
A0A151ZJ20_9MYCE/227-306               ......................................................................YPTVASIPHSIVN......AF.K.N.LL.....AVTFE..T.......E.Y.T...F.......DA............A.T...KF.K.AA.A.AAT-----............................................--PVA.T.VA...A....T..P...V....A.....A..T...T...A...K......K...V....E..A....K.VE..EKK-...................E..ESDE........DMG..MSLF...............................
H3AB03_LATCH/17-111                    ......................................................................SPSAKDIKKILSS......VG.I.E.AE.....DDRLN..K.......V.I.S...E.......LS............G.K...DI.N.DV.V.NAGLSKLAcvp......................................agtAVAPA.A.AG...A....A..P...A....A.....G..D...V...P...A......A...E....K..K....E.EE..KKEE..................sE..ESDE........DMG..FGLF...............................
A0A1U7LUW1_9ASCO/172-253               ......................................................................YPTLVSVMHSLVN......SY.K.N.VL.....GVSIA..T.......D.Y.T...F.......DG............S.E...QI.K.GY.L.ANPSAF--............................................-AMAA.P.AA...A....A..E...P....F.....G..S...A...K...P......-...E....D..K....P.AE..EEE-...................-..ESDE........DMA..FGLF...............................
A0A0F9XN31_TRIHA/21-107                ......................................................................EITADKLQTLIAA......AK.V.E.VE.....PIWTS..I.......F.A.K...A.......LE............G.K...DI.K.DL.L.VNVGSGG-............................................GAAAA.P.GA...A....A..A...A....G.....G..A...V...A...D......A...P....A..E....E.AK..EEEK...................E..ESDE........DMG..FGLF...............................
RLA22_ARATH/17-114                     ......................................................................SPTSADIKTILGS......VG.A.E.TE.....DSQIE..L.......L.L.K...E.......VK............G.K...DL.A.EL.I.AAGREKLAsvps...................................gggggVAVAS.A.TS...G....G..G...G....G.....G..G...A...S...A......A...E....S..K....K.EE..KKEE..................kE..ESDD........DMG..FSLF...............................
A0A251TCE4_HELAN/61-156                ......................................................................SPSADDLKNILGS......VG.A.D.AD.....EDTIE..L.......L.L.K...E.......VK............G.K...DI.T.EL.I.ASGREKLAsvp.....................................sgggGVAVA.A.AT...G....G..G...A....A.....P..A...A...A...A......A...E....T..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
A0A1E5REY8_9ASCO/16-107                .....................................................................t-PSADSIKSVLES......VG.I.E.VE.....DEKVS..T.......L.L.S...S.......LE............G.K...SV.E.EL.I.AEGNEKLAsv.......................................ptsAPAGA.A.GS...S....G..A...A....A.....G..G...A...D...A......A...E....E..E....A.QE..EEA-...................E..ESDE........DMG..FGLF...............................
A0A1I8CEK9_9BILA/22-108                .....................................................................a-ITADQISAILKA......AN.V.T.VE.....PFWPG..L.......F.A.K...A.......LE............G.V...NV.A.DL.I.SNIGSG--............................................AGSAG.P.AA...A....A..P...A....A.....A..A...A...A...P......A...A....A..K....K.EK..EPVK..................eE..SEDE........DMG..FGLF...............................
N1PQL2_DOTSN/21-111                    .....................................................................d-ITADKLQSLITA......AK.VpD.IE.....PIWTT..L.......F.A.K...A.......LE............G.K...DV.K.EL.L.LNVGSGGGa.........................................apAAGGA.A.PA...A....A..G...G....A.....D..A...P...A...A......E...A....E..K....P.KE..EE-K...................E..ESDE........DMG..FGLF...............................
A0A139A309_GONPR/26-117                ......................................................................EITAEHITSLLEA......AS.I.E.VD.....SFYPR..V.......F.A.K...A.......LA............G.K...DL.S.FL.T.KIGAAGPAaa........................................paAAAAA.P.AA...A....A..A...P....A.....A..A...A...A...A......P...A....A..A....K.VE..EKKE...................E..EEDD........DMG..FGLF...............................
A0A2G3CRU5_CAPCH/234-317               ......................................................................YPTIAAASHMFVN......GY.K.N.VL.....GVAVE..T.......E.Y.T...Y.......SQ............A.E...QV.K.EY.L.KDPSKFAV............................................GTVGV.A.ES...G....A..T...F....Q.....G..V...V...E...S......K...E....E..D....D.ES..E---...................-..-SDE........EEA.lFNLF...............................
A0A1Y1UL69_9FUNG/57-146                ......................................................................SPSAADVKKIINT......IG.A.E.VD.....DEKVD..A.......V.V.A...A.......LN............G.K...DI.D.EV.I.ADGFSKLSa.........................................apVASGS.A.AS...G....A..A...A....S.....G..A...G...A...A......A...E....E..T....K.EE..SEE-...................E..ESDS........DMG..FGLF...............................
I2GVA9_TETBL/17-108                    .....................................................................t-PSVADIKAVVET......VG.V.E.AN.....DARIK..E.......L.L.A...S.......LE............G.K..gSL.A.EI.I.AEGQKKFAsv........................................paGGAAA.A.TS...G....A..A...A....A.....G..G...A...A...A......A...E....E..E....K.EE..EAK-...................E..ESDD........DMG..FGLF...............................
A0A1X0NTR3_9TRYP/20-106                ....................................................................kc--DASSLLAVTKA......AG.V.E.VS.....KGMAG..A.......Y.A.A...V.......LE............T.V...NI.N.DV.L.SNIAFGG-............................................GAPAA.G.GA...A....A..P...A....A.....A..G...G...A...A......A...P....A..A....K.KE..EKVE...................E..EEDD........DMG..FGLF...............................
A0A0F4G702_9PEZI/21-110                ......................................................................EITADKLQSLISA......AK.VaD.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.EL.L.LNVGSGGGa..........................................aPAAAG.G.AS...A....A..A...A....G.....G..E...A...E...A......A...P....E..A....A.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A1I7TE45_9PELO/17-110                ......................................................................NPKVDDLKNILSA......VG.V.D.AD.....AETAK..L.......V.V.S...R.......LQ............G.K...TI.E.EL.I.AEGSSGLVsv.......................................sggGAPAA.A.SA...A....P..A...A....G.....G..A...A...P...A......A...D....S..K....P.AK..KEEP..................kE..ESDD........DMG..FGLF...............................
M4D695_BRARP/17-112                    ......................................................................SPTSADIKQILGS......VG.C.E.SE.....DSQIE..L.......L.L.K...E.......VS............G.K...DL.C.DL.I.AAGREKLAsvps....................................ggggVAMAA.A.PS...A....G..G...G....G.....G..A...P...A...A......A...A....K..K....E.EK..KEEK...................E..ESDD........DMG..FSLF...............................
A0A1Y3N6M7_PIRSE/228-312               ......................................................................YPTVASVPHSLAN......GY.K.N.LI.....AISLV..S.......D.Y.C...L.......DS............V.K...EL.K.EL.L.DNPEALAS...........................................lQ---A.A.SA...S....A..A...A....T.....T..E...D...T...G......A...G....A..A....A.EE..EEE-...................E..ESDS........DMG..FGLF...............................
A0A139CK36_9EURY/16-104                .....................................................................d-VTEEAITAVLEA......AG.T.E.VN.....DARAK..A.......L.V.A...A.......LE............D.V...DI.E.EA.M.ATAAVA--............................................APAAA.G.AP...A....A..A...A....E.....E..A...P...A...A......E...E....E..A....A.AE..EESE..................eE.aEEDG........MAG.lGALF...............................
V9F855_PHYPR/231-311                   .....................................................................i-PTLASIPHSIAN......AF.K.D.LV.....AIAVE..C.......EeF.S...F.......EK............A.E...PY.K.AF.L.ADPSAF--............................................---AV.A.AP...A....G..G...A....A.....-..-...-...-...A......T...E....E..K....K.EE..AVE-...................E..EEEV........DMG..GGM-dmf............................
A0A0D7BGG0_9AGAR/229-311               .....................................................................y-PTIVSVVHSLVN......SY.K.N.LL.....AVSIA..T.......E.Y.T...F.......EG............S.A...KA.K.EY.L.ANPEAF--............................................AV-AA.A.PA...A....A..A...E....A.....A..A...A...P...A......A...E....E..K....K.EE..EEE-...................-..EEDD........DMG..FGLF...............................
I1H2D6_BRADI/17-109                    ......................................................................SPTKDDVRAILGS......VG.A.E.VE.....EYKLD..I.......L.F.K...E.......VE............G.K...DI.S.EL.L.AAGREKFAfap.....................................rggaAMDAV.P.AA...A....A..A...A....E.....E..K...K...D...G......K...V....E..A....K.VE..EDE-...................E..EEDL........DM-..FSLF...............................
A0A167XV60_9PEZI/17-109                ......................................................................SPSAKDIKNVLES......VG.I.E.AD.....DDRLA..K.......L.L.E...E.......LK............G.K...DV.N.EL.I.AEGSTKLAsvp......................................sggGGGAA.A.GG...A....A..A...G....G.....A..A...A...E...E......A...K....E..E....P.KE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A1D5PMT8_CHICK/17-114                ......................................................................SPTSKDLKKILDS......VG.I.E.TD.....DERLN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGNGKLAsmpa....................................ggavAVSTG.G.VS...A....A..P...A....A.....G..A...A...P...A......A...A....E..E....K.KE..EKKEe.................sE..ESDD........DMG..FGLF...............................
A0A2I2V3N0_FELCA/22-109                .....................................................................t-VTEDKINALIKA......AG.V.N.VE.....PFWPG..L.......F.A.K...A.......LA............N.V...NI.G.SL.I.CNVGAGGPa..........................................pAAGAA.P.AG...G....P..A...P....S.....T..T...A...A...P......A...E....E..K....K.VE..AKKE...................-..ESEE.......sDE-..----igs............................
Q0PXZ8_DIACI/22-112                    .....................................................................t-VTGEKIQTVLKA......AG.V.E.VE.....PYWPG..L.......F.A.K...A.......LE............G.V...NV.K.EL.I.SNVGSGAGa..........................................gPAAAA.P.AA...A....Q..A...A....A.....P..A...A...A...E......A...K....E..D....K.KK..KEES..................dE..GSDD........DMG..FGLF...............................
A0A151NXJ6_ALLMI/43-118                ......................................................................SPTSKDLKKILDS......VG.I.E.TD.....DERVN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGNSKLAsmpa....................................ggavAVAAG.A.GS...A....A..P...A....G.....G..A...A...P...A......A...-....-..-....-.--..----...................-..----........---..----ai.............................
A0A2G3CXU2_CAPCH/21-109                .....................................................................p-ITSEKIATVVKA......AN.I.S.VE.....SYWPS..L.......F.A.K...L.......FE............K.R...DI.E.DL.I.LNVGTGGGp.........................................avAVAAA.P.VA...G....G..G...A....A.....A..A...A...P...A......A...A....E..K....K.EE..TK--...................E..ESDD........DLG..LNLF...............................
A0A087UME9_9ARAC/2-70                  ....................................................................qp----EKISTILKA......AN.V.D.VE.....SYWPG..L.......F.S.R...A.......LE............G.I...DI.K.QL.I.TNVGSGV-............................................--GAA.P.TA...A....P..A...S....G.....G..A...A...A...E......A...A....G..G....E.KK..E---...................-..----........---..----a..............................
A0A135T9P7_9PEZI/21-108                ......................................................................EITADKLQTLIKA......AK.IeE.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.SNVGSGGG............................................AAAPA.A.GG...A....A..A...G....G.....A..T...E...A...A......A...E....E..A....P.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A165GAE5_9APHY/17-81                 ......................................................................SPSADDVKKVLGA......VG.I.E.SE.....DDRLG..K.......L.I.S...E.......LE............G.K...DI.N.EL.I.AEGSSKLAs.........................................vrP----.-.--...-....-..-...-....-.....-..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----shlflrspadsacv.................
V7BL51_PHAVU/17-113                    ......................................................................SPSAAVIKDILGS......VG.A.E.AD.....DDRIE..L.......F.L.S...E.......VK............G.K...DI.V.EV.I.AAGREKLAsvps....................................ggggGVAVA.A.AS...G....G..G...G....A.....A..A...A...P...A......A...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
A0A0C2YV85_HEBCY/17-110                ......................................................................SPSAADVKKLLGV......VG.I.E.TD.....DDRLS..A.......L.I.S...E.......LK............G.K...ST.A.EL.I.AEGSSKLAsv.......................................psgGGGGG.A.AA...A....P..A...A....G.....G..A...A...A...A......V...E....E..K....K.EE..KVEE..................kE..ESDD........DMG..FGLF...............................
R8BRB9_TOGMI/21-109                    ......................................................................EITADKITTLLKA......AA.IeE.VE.....PIWAQ..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.SNVGSGGG...........................................aAAAAG.G.AP...A....A..G...G....A.....G..A...A...E...E......A...A....E..E....A.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A109FEK9_9BASI/17-109                ......................................................................SPSAEDIKTILGA......AD.V.S.VD.....EERLS..K.......L.L.S...E.......LE............G.K...DI.N.EV.I.AEGSKKLAsvp......................................sggAAPAA.A.AG...G....A..A...A....A.....G..G...D...A...A......P...A....A..E....K.AE..EE-K...................E..ESDD........DMG..FGLF...............................
A0A0R3UK10_9CEST/17-121                .....................................................................r-PQESDLKTILSS......VG.I.E.CE.....QERVK..L.......L.L.D...Q.......LH............G.K...NM.N.EL.I.NAGKEKMStvsfsga.............................vapssgaaPAAAA.P.AA...S....G..A...A....P.....A..G...K...P...A......A...E....A..P....P.KE..EPKEe.................sE..ESDA........DMG..FSLF...............................
W2SC27_9EURO/21-113                    .....................................................................d-ITADKLTTIIKA......AG.VaD.VE.....PIWSS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGSGGGaa.......................................aapAAGGA.G.GA...A....A..G...G....D.....A..A...D...A...P......A...A....E..E....K.KE..EEK-...................E..ESDD........DMG..FGLF...............................
B8CG46_THAPS/231-316                   .....................................................................i-PTQASVTHSIAN......AF.K.A.IL.....SVTVE..L.......E.N.Y...S.......FD............K.A...DIyK.AY.L.ADPSAFAG............................................SGGGG.G.GG...G....D..G...G....E.....T..S...A...A...A......A...V....E..E....V.EE..EEA-...................-..----........---..----ppavdmfggg.....................
A4S7T7_OSTLU/17-106                    ......................................................................SPSEADVKAILAG......AA.A.E.VD.....DSKLS..A.......F.F.K...E.......IE............G.K...DV.A.EL.I.AEGNAKLAsvp.....................................sgggG--GG.G.GG...G....D..G...G....G.....D..A...G...G...A......A...A....A..A....A.PE..AE--...................E..EEEA........DMD..FE--l..............................
A0A165T2J2_9HOMO/7-97                  ...................................................................htq---SDKIIALTSA......AD.V.E.LE.....PIWAT..L.......L.A.R...A.......LE............G.K...NV.K.DI.L.SNVGAGGAg..........................................pAVGAA.P.AA...G....A..A...A....A.....G..G...A...A...A......A...E....E..K....A.EE..KEEE..................kE..ESDD........DMG..FGLF...............................
C1GLK3_PARBD/21-110                    .....................................................................d-ITSEKLQSILKA......AN.VeD.VE.....PIWSS..L.......F.A.K...A.......LQ............G.K...NV.K.DI.L.LNVGSGGG............................................AAPAA.A.GN...A....P..A...A....A.....G..G...A...A...A......A...E....E..K....V.EE..KEEE..................kE..ESDE........DMG..FGLF...............................
G4MKJ9_MAGO7/229-312                   .....................................................................f-PTWPSVIHSVVN......SY.K.N.IL.....SIALE..T.......E.Y.S...F.......PA............V.E...EL.K.DR.I.ANPDAY--............................................-ASAA.P.AA...G....G..A...G....G.....G..D...A...P...A......A...E....A..K....K.DE..SEE-...................E..QSDE........DMG..FGLF...............................
V4KPP2_EUTSA/17-114                    ......................................................................SPTSADIKDILGS......VG.A.E.TE.....DAQIE..L.......L.L.K...E.......VK............G.K...DL.A.EL.I.AAGREKLAsvps...................................ggggvAMASA.P.SA...G....G..G...G....G.....G..A...A...P...A......A...E....A..K....K.EE..KKEE..................kE..ESDD........DMG..FSLF...............................
A0A200QQZ5_9MAGN/21-108                .....................................................................s-ISAEKIATLVKS......AN.V.D.VE.....PFWPS..L.......F.A.K...L.......LQ............K.I...NV.E.DGnV.GSGGGAAA............................................VAVAA.P.SG...G....G..A...A....A.....A..T...A...A...P......A...A....E..E....K.KE..EPK-...................E..ESDD........DMG..FSLF...............................
A0A1S3LEC7_SALSA/81-176                .....................................................................s-PSSKDIKTILGS......VG.I.E.AE.....DERLD..K.......V.V.N...E.......LN............G.K...DI.N.EV.M.NSGLSKLAsvp......................................aggAVAAP.A.AA...G....S..A...A....A.....G..V...S...P...T......A...A....E..E....K.KE..EKEEs.................eE..GSDD........DMG..FGLF...............................
A0A1A6GCN7_NEOLE/30-86                 .....................................................................t-VMEDKINALIKA......AG.V.N.VE.....SFWPG..L.......F.A.K...A.......LA............N.V...NI.G.SL.I.CNIG----............................................PGGPA.P.AA...G....A..A...P....-.....-..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----df.............................
A0A195B898_9HYME/22-109                .....................................................................a-VTGEKIQTILKA......AN.V.N.VE.....SYWPG..L.......F.A.K...A.......LE............G.I...NV.K.EL.I.TNIGSGVGa..........................................aPVGAA.P.AA...A....A..P...V....S.....T..E...A...A...P......T...K....E..E....K.KK..EEPE...................E..ESDD........DMG..F---v..............................
A0A1Y9IV09_9DIPT/231-314               ......................................................................YPTLASVPHSIAN......GF.R.N.LL.....AIAAV..T.......E.V.E...F.......KE............A.E...TV.K.EF.I.KDPTKF--............................................-ASAS.T.AA...A....P..A...A....S.....A..A...A...P...A......A...K....A..E....E.KK..EES-...................E..SEDE........DMG..FGLF...............................
A0A1D2VIL8_9ASCO/12-104                ......................................................................NPTAKEIKKVLKS......VN.A.E.ID.....ETKLD..K.......F.L.D...E.......VS............G.K...TP.E.EL.I.AEGNSKLSsv........................................pgGSSGS.A.AG...G....A..T...T....T.....D..S...T...D...K......A...E....E..K....E.EE..ADES..................eE..ESDD........DMG..FGLF...............................
J3MJT3_ORYBR/17-122                    ......................................................................SPSKDDVRAILAS......VG.A.D.VVgdrdaNAKLD..L.......L.F.A...Q.......VA............G.K...DV.A.EL.I.AVGSEKFAfap......................................cggAAAAA.A.AP...P....A..G...A....A.....A..E...E...K...E......K...E....E..E....E.EE..EEEKave.............kveE..EDDD.......dDIV..FSLF...............................
A0A0V1I0I6_9BILA/231-318               ......................................................................YPTAASAPHMIAN......AF.K.N.LL.....SIAAV..T.......D.I.T...F.......KE............A.E...KL.K.EY.L.ADPSKF--............................................AVAAA.P.AA...A....A..A...A....D.....S..K...A...A...K......D...D....S..S...sK.KE..EKVE...................E..ESDE........EEG.mGGLF...............................
A0A0R3PL14_ANGCS/17-112                .....................................................................s-PKLEDIKNILDA......VG.V.D.TD.....AEAAN..L.......V.I.S...R.......LQ............G.K...NI.E.QV.I.AEGAADLVtisg....................................gvpaASTPA.A.AA...V....D..A...P....A.....A..A...A...P...A......A...E....T..K....P.AK..KEEK...................E..ESDD........DMG..FGLF...............................
A0A0U5G341_9EURO/229-313               ......................................................................YPTLPSVIHSVLN......SY.K.N.VL.....SVAVE..T.......E.Y.S...W.......PE............I.E...EL.K.DR.I.ANPEAY--............................................-AAAA.P.AA...G....A..A...A....G.....G..A...A...P...A......A...A....A..E....A.AP..AEEE...................E..QSDE........DMG..FGLF...............................
J4UJH5_BEAB2/17-110                    ......................................................................SPSAKDITGVLSA......VG.I.E.AD.....EERVK..T.......L.L.S...E.......LK............D.K...DI.N.EL.I.AEGSSKLAsvp.....................................sggaGGAAA.A.GG...A....A..A...A....G.....G..A...A...D...A......P...A....A..E....E.KE..EE-K...................E..ESDE........DMG..FGLF...............................
A0A0D3C2E8_BRAOL/17-112                .....................................................................c-PTSADIKVILNS......VG.C.E.TE.....DSQIE..L.......L.L.K...E.......VN............G.K...DV.A.EL.I.AVGREKLAsvps....................................ggggVAMAS.A.PS...A....G..G...G....G.....G..A...A...P...A......E...D....K..K....E.EK..KEEK...................E..ESDD........DMG..FSLF...............................
A0A1V6QLN2_9EURO/17-107                .....................................................................a-PSSADIKSVLSS......VG.I.D.AE.....GDRLE..K.......V.I.A...E.......LQ............G.K...DL.Q.EL.I.SEGSAKLAsv........................................psGGAGA.A.AP...A....A..A...A....A.....G..G...A...D...A......P...A....E..E....K.VE..EKE-...................E..ESDE........DMG..FGLF...............................
A0A093BVF1_TAUER/207-293               ......................................................................YPTIASVPHSIVN......GY.K.R.VL.....AVAVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFVA............................................AIPVV.A.EA...A....A..P...A....A.....A..A...A...A...A......P...A....K..E....A.AK..EES-...................E..ESDE........DMG..FGLF...............................
A0A091CK14_FUKDA/177-262               ......................................................................YPNVASVPHSIIN......GY.K.P.VL.....AFSVE..T.......D.Y.T...F.......PL............V.E...KV.K.AF.L.AGPSAF--............................................VAVPP.V.TA...A....T..T...A....A.....P..A...A...A...A......A...P....A..K....V.EA..TEKS...................E..ESDD........DMG..FGLF...............................
A0A1U8N2L0_GOSHI/234-320               ......................................................................YPTLAAAPHMFIN......GY.K.N.VL.....AVAVA..T.......E.Y.S...F.......PQ............A.D...KV.K.EY.L.ADPSKFAV............................................VAAPV.A.GG...G....G..G...A....A.....P..A...A...A...P......A...E....E..E....K.KP..EPE-...................E..ESDD........DMG..FSLF...............................
A0A024W572_PLAFA/231-315               .....................................................................v-ITEASYPHVFVE......AF.K.N.IV.....ALIID..S.......D.Y.T...F.......PL............M.E...NI.K.KM.V.ENPEAF--............................................AAVAA.P.AS...A....A..K...A....D.....E..P...K...K...E......E...A....K..K....V.EE..EEE-...................E..EEDG........FMG..FGMF...............................
A0A0D2N385_GOSRA/17-115                ......................................................................NPSADDLKAILGS......VA.A.E.AD.....DDKIE..M.......L.L.S...E.......VK............G.K...DI.T.EL.I.ASGREKLAsvpsg.................................ggggggVAVAA.P.TT...G....G..G...A....G.....D..A...P...A...A......E...T....K..K....E.EK..VEEK...................E..ESDD........DMG..FSLF...............................
A0A078JT63_BRANA/15-83                 ................................................................nespsa-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.G...DL.K.KI.L.ESVEKMAAlss.....................................ggptVAVAA.G.GG...G....A..A...A....P.....A..A...E...P...A......A...A....E..K....K.KE..EEK-...................E..ESED........DGG.mMSLF...............................
A0A0E0CLG0_9ORYZ/586-681               ......................................................................NPSAEDLSTILES......VG.A.E.VD.....HGKMD..L.......L.L.S...Q.......LA............G.K...DI.T.EI.I.ASGREKFAsvp......................................cggGGIAV.A.AA...A....P..A...A....G.....G..G...A...A...P......Q...S....E..A....K.KE..EKVEe.................kE..ESDD........DMG..FSLF...............................
A0A0M9FQ02_9TRYP/85-173                .....................................................................p-VTADNISAAVKA......AG.V.E.VR.....PTLPI..I.......F.A.R...F.......LE............K.K...SV.D.SL.M.AAAAAVAPa..........................................aAEAPA.A.AA...G....G..A...A....P.....A..A...G...G...K......A...K....E..E....K.KK..EVE-...................E..EGDD........DMG..FGLF...............................
K7MZ77_SOYBN/17-112                    .....................................................................a-PSADDLRTILGS......VG.A.D.AN.....DDNIS..N.......F.L.S...E.......VK............G.K...DI.A.EL.I.AAGREKLAsvp......................................sggGAAVS.V.AA...A....P..G...G....G.....A..A...A...P...A......A...A....E..S....K.KE..EKVEe.................kE..ESDD........DMG..FSLF...............................
A0A094HEI7_9PEZI/63-140                ....................................................................qr-------------......--.-.-.AD.....SERLD..A.......L.I.S...E.......LK............G.K...DI.N.TL.I.SEGAAKLAsvp......................................sggGGGAA.A.AG...G....A..A...A....G.....G..A...T...E...D......A...P....V..E....E.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A2EIR1_TRIVA/17-105                    .....................................................................t-PSAADVKAILES......VG.A.A.VD.....EQKLN..H.......V.I.A...K.......FE............G.K...NI.E.EL.I.EEGAKKMI............................................STGAA.V.AA...A....P..A...A....G.....A..A...G...A...A......A...E....E..A....P.KE..EAKE...................E..EPAAp......lDLG..----dmf............................
A0A067S6N2_GALM3/41-133                ....................................................................tq---ADKIIALTNA......AG.V.E.LE.....PIWAT..L.......L.E.K...A.......LA............G.K...NI.M.EL.L.TDIGARGAs..........................................aSGGSA.V.AT...A....A..T...S....G.....E..S...P...P...A......A...P....N..I....E.EK..EENE..................gD..DSDD........DLG.iT---gfllf..........................
A0A074WAS3_9PEZI/21-108                ......................................................................EITADKLNTLISA......AK.L.E.VE.....PIWTQ..L.......F.A.K...A.......LE............G.K...DV.K.EL.L.LNVGSGS-............................................GAAAA.P.AA...G....G..A...A....A.....G..G...A...A...A......E...D....A..P....A.EE..KAEE..................kE..ESDD........DMG..FGLF...............................
A0A0E0EHH4_9ORYZ/234-318               ......................................................................YPTIAAAPHMFLN......GY.K.N.VL.....AVAVE..T.......E.Y.S...Y.......PH............A.D...KI.K.EY.L.KDPSKF--............................................AVAAP.V.AA...D....S..G...A....A.....A..P...S...A...A......K...E....E..E....K.KE..EPE-...................E..ESDG........DLG..MSLF...............................
B3S1Z8_TRIAD/22-109                    ......................................................................EITADKITALLKA......AK.V.D.YE.....PYWPN..L.......F.A.K...A.......LA............G.R...NI.K.DL.I.TNVGSGAA............................................AAPAA.A.AA...G....G..G...D....A.....T..D...A...P...A......A...E....K..E....A.EK..EVEE...................E..ESDD........DMG..FGLF...............................
K4MC06_9EURY/16-102                    ......................................................................EISEATVTAVLQA......AG.V.E.VN.....DARAK..A.......L.I.A...A.......LE............G.V...DI.E.EA.M.ATAAVAAP............................................AAAAA.P.AA...A....A..A...A....A.....P..A...A...A...T......K...S....E..E....E.DK..E---...................-..EAEEs......gMAG.lGALF...............................
B0DA55_LACBS/229-311                   ......................................................................YPTIVSVTHTLVN......AY.K.N.LI.....AISLA..T.......E.Y.T...F.......EG............S.E...KV.K.EY.L.ANPDAF--............................................---AS.A.AP...A....E..E...A....A.....P..A...A...A...A......A...V....V..E....E.KE..PEKE...................E..ESDD........DMG..FGLF...............................
A0A251SQ67_HELAN/56-152                ......................................................................SPSAEDLKKILGS......VG.A.D.AD.....DDKIE..L.......L.L.S...E.......VK............G.K...DI.T.EL.I.ASGREKLAsvps....................................ggggVAVAA.A.AG...G....G..G...A....A.....P..A...A...A...A......A...E....S..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
A0A0L0C8Z6_LUCCU/22-112                .....................................................................a-VTGEKISTILKA......AN.V.E.VE.....PYWPG..L.......F.A.K...A.......LE............G.I...NV.K.DL.I.TNIGSGVGa.........................................gaPAGAA.A.AG...G....D..A...A....P.....A..A...G...E...A......K...K....E..E....K.KK..EEEP...................E..ESDD........DMG..FALF...............................
A0A087VLU5_BALRE/213-295               ......................................................................YPTIASVPHSIVN......GY.K.R.VL.....AVAVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAF--............................................-VAAV.P.VP...A....P..P...P....A.....A..A...A...A...P......A...K....E..A....A.KE..ESE-...................-..ESDE........DMG..FGLF...............................
X6NNN7_RETFI/14-130                    .....................................................................p----QDIAKILDS......VG.I.E.AN.....KEKLN..A.......L.F.E...D.......LEk..........sG.K...TV.D.EA.I.QQGLDKLAavpadrttfcvkkkq..............pkknlaaiftinkggAGVAV.A.AG...A....A..P...A....A.....G..G...A...A...A......A...T....E..A....K.KE..EEEE...................E..EKES........ED-..----gittl..........................
A0A1G4JZC9_9SACH/17-107                .....................................................................a-PSADNVKAVLES......VG.I.E.IE.....EEKVS..S.......L.L.S...A.......VE............G.K...SV.E.EL.I.AEGNEKLAa.........................................vpASSGA.A.AS...S....G..A...A....T.....G..G...A...A...E......E...A....A..E....E.AA..PEAE...................E..ESDD........DMG..FGLF...............................
A0A078G324_BRANA/22-110                ......................................................................EITAEKIAKLVKA......AN.V.N.VE.....SYWPS..L.......F.A.K...L.......CQ............K.K...NI.D.DL.I.MNVGASGD............................................AAAPV.A.TN...V....P..A...A....A.....Q..A...V...P...A......A...E....E..T....K.KK..KEEV..................kE..ESED........DMV..FGLF...............................
K4D9W7_SOLLC/17-112                    ......................................................................SPSAADLKKILAS......VG.A.E.AD.....DDRIE..L.......L.L.S...Q.......VK............G.K...DI.T.EL.I.AAGREKLAsvps...................................gggggVAVAV.S.GG...G....G..A...A....A.....P..A...A...E...E......K...K....E..E....K.KV..EEK-...................E..ESDD........DMG..FSLF...............................
S7Q1Q1_MYOBR/22-112                    .....................................................................m-VTEGKINALIKA......AG.V.N.GE.....PFWPG..L.......L.A.K...A.......LA............N.V...NI.G.SL.V.CNVEAGGPa..........................................pAASAA.P.AG...G....P..A...P....S.....T..A...A...A...P......A...E....K..K....V.EA..KKEE..................sK..ESDD........DMG..FGLF...............................
J3LDF6_ORYBR/17-112                    ......................................................................NPSAEDLSTILES......VG.A.E.VD.....QGKME..F.......L.L.S...Q.......LA............G.K...DI.T.EI.I.ASGREKFAsvpc....................................ggggVAVAA.A.AP...-....V..V...G....G.....G..A...A...P...Q......A...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
A7E8S1_SCLS1/17-111                    ......................................................................SPSAKDITTVLES......VG.I.E.ID.....QERLD..T.......L.I.K...E.......LD............G.K...DI.N.EL.I.AEGSSKLAsvp......................................sggSGAAA.P.AA...G....G..A...A....A.....S..G...G...A...A......A...E....E..K....A.EE..KAEE..................kE..ESDE........DMG..FGLF...............................
D3ZJT4_RAT/193-278                     ......................................................................EPTVTSVPHSIIN......GS.K.R.VL.....ALSVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAF--............................................AAAAP.V.AA...A....T..T...A....A.....P..A...A...A...A......A...P....A..K....A.KA..KEES...................E..ESDE........DVR..FGLF...............................
C6T1E4_SOYBN/17-113                    .....................................................................t-PSADDIKEILGS......VG.I.E.AD.....EDRIE..S.......F.L.S...E.......VK............G.K...DI.V.EL.I.AAGKEKLAsvps....................................ggggAVAVA.A.AP...G....G..G...G....G.....G..A...A...P...A......A...E....V..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
L9XJ51_9EURY/16-116                    ......................................................................EINEDNLTDVLDA......AG.V.D.VE.....ESRVK..A.......L.V.A...A.......LE............D.V...DI.D.EA.V.SEAAVAPA............................................-AGGA.A.AG...G....A..A...A....A.....G..G...D...E...G......G...D....E..G....D.AE..ETSDvpdtt.........dddddD..----........---..----dedeeaggeglgelf................
A0A1U7YB93_NICSY/22-111                .....................................................................p-ITAEKIATVVKA......AN.I.S.VE.....SYWPS..L.......F.A.K...L.......FE............K.R...DV.E.DL.I.LNVGIGGGg.........................................aaVAVAA.P.VA...G....G..G...A....A.....A..A...A...P...A......A...E....E..K....K.EE..KKE-...................E..SDDE........DLG..LSLF...............................
Q6BGT0_DEBHA/20-104                    ......................................................................EITSDKLLAITKA......AG.A.S.VE.....DVWAD..V.......Y.A.K...A.......LE............G.K...DL.K.EL.L.FSFAAA--............................................APAAA.P.AG...G....A..A...A....A.....A..G...D...A...P......A...A....A..E....E.AE..EEA-...................E..ESDG........DMG..MGLF...............................
A0A1U8K049_GOSHI/23-110                .....................................................................i-----TIATLVKA......AN.V.S.VE.....SYWPS..L.......F.A.K...L.......FE............K.C...NI.E.DL.I.TNVGAAGAga.......................................avaAAAPV.A.AG...A....G..G...G....A.....A..A...P...P...P......A...E....E..K....K.KE..EPE-...................E..ESDD........DMG..FSLF...............................
F4IGR5_ARATH/35-126                    .................................................................vldcv-----------VI......VG.A.E.TE.....DSQIE..L.......L.L.K...E.......VK............G.K...DL.A.EL.I.AAGREKLAsvps...................................gggggVAVAS.A.TS...G....G..G...G....G.....G..G...A...P...A......A...E....S..K....K.EE..KKEE..................kE..ESDD........DMG..FSLF...............................
A0A1Y2BVI4_9FUNG/23-113                ......................................................................EITAEKLNTLIAA......AG.I.E.IE.....SIWPS..L.......F.A.K...A.......LA............G.K...DL.S.AF.L.FAVGSGAGa.........................................gaA-APA.A.AA...A....A..P...A....A.....G..A...A...A...A......A...P....A..A....K.EE..KKEE..................kE..ESDD........DMG..FGLF...............................
I2H6R1_TETBL/229-311                   ......................................................................YPTLPSVGHTLIN......NY.K.D.LL.....AVAIA..S.......K.Y.I...Y.......PE............I.E...EL.M.DR.I.ENPEKY--............................................AS-AA.P.AA...A....A..A...S....G.....S..-...S...D...A......A...P....A..A....A.AE..EDE-...................E..SEDD........DMG..FGLF...............................
A0A150VEX9_9PEZI/21-110                ......................................................................EITADKLQSLISA......AK.VpD.VE.....PIWCQ..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGSGGG............................................AAAAA.P.AA...G....GapA...A....T.....E..E...A...A...P......A...A....E..E....K.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A251UIM0_HELAN/8-94                  .....................................................................l---AEKIATILKA......AN.V.E.CE.....SYWPS..L.......F.A.K...L.......AE............K.K...NI.E.DL.I.VNVGAGGGg.........................................gaPAVAA.P.AA...G....G..A...A....A.....A..A...A...P...P......P...E....E..K....K.EE..PK--...................E..ESDD........DMG..FSLF...............................
A0A0P7B2G0_9HYPO/21-107                ......................................................................EITADKLQTLIKA......AK.VeD.VE.....PIWTS..I.......F.A.K...A.......LE............G.K...DV.K.DL.L.VNVGSGGG............................................AA-AA.S.GG...A....A..A...T....G.....G..D...A...A...E......A...V....E..E....K.AE..SEK-...................E..ESDE........DMG..FGLF...............................
A0A094ASH8_9PEZI/229-310               .....................................................................f-PTLPSVMHSVVN......SY.K.N.VL.....SVAIS..T.......E.Y.S...W.......TE............I.E...EL.K.ER.I.ANPEKF--............................................---AS.A.AP...V....A..S...D....A.....P..K...A...A...A......A...E....E..K....K.EE..SEAE...................-..-ESG........DEG.fGGLF...............................
W1PR36_AMBTC/34-119                    .............................lqrklvqaassqdssggvqssfamvspssavfqvviggggg-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.-----G-Gfi........................................ggGAAAA.A.AP...S....G..A...P....A.....A..A...E...A...P......P...A....E..E....K.KE..EK--...................E..ESDD........DMG..FSLF...............................
A0A128A151_9ARCH/16-98                 ......................................................................EINEANIANVVKA......SG.A.E.VN.....EAQVK..A.......L.V.A...A.......LA............D.V...NI.E.EA.I.KAAPVA--............................................--VAA.P.AA...P....S..G...G....G.....A..S...E...A...K......K...E....A..D....L.PS..AKT-...................-..EEQA........MEG.lSALF...............................
A0A1B8C7A3_9PEZI/17-109                .....................................................................a-PTAADITAVLSS......VG.I.E.AD.....SDRLD..A.......L.I.S...E.......LK............G.K...DI.N.TL.I.SEGASKLAsvp......................................sggGGGAA.A.AG...G....A..A...A....G.....G..A...A...E...A......A...P....V..E....E.KE..EEK-...................E..ESDE........DMG..FGLF...............................
K4B212_SOLLC/21-111                    .....................................................................a-ITAEKISAIVKA......AN.V.T.VE.....PYWPL..L.......F.A.K...L.......AE............K.K...NI.S.DL.I.MNVGAGGGgv........................................aaVAAPV.G.GA...A....A..G...G....G.....A..A...A...A...P......A...A....E..E....K.KE..EPK-...................E..ESDD........DMG..FSLF...............................
A0A1Y2F3F5_9BASI/20-106                ......................................................................EISSEKILALTSA......AK.V.E.VE.....PIWAT..L.......L.A.K...A.......LE............G.K...DV.K.DL.L.SNVGAGGA............................................-APAA.A.AA...G....G..A...A....P.....A..A...A...A...E......A...E....P..E....K.AK..EEEK...................E..ESDD........DMG..FGLF...............................
R9NZM7_PSEHS/230-312                   ......................................................................YPTIASVMHSLVN......GY.K.N.LI.....AVSIA..T.......D.Y.E...F.......EG............S.K...KA.K.EY.L.ANPEAF--............................................-AAAA.P.AA...A....A..A...D....T.....G..A...A...A...A......A...E....E..E....K.EE..EKE-...................-..ESDD........DMG..FGLF...............................
A0A0W7VSD8_9HYPO/21-107                ......................................................................EITADKLQTLISA......AK.V.E.VE.....PIWTS..I.......F.A.K...A.......LE............G.K...DI.K.DL.L.VNVGSGGG............................................AAAAP.G.AA...A....A..A...G....G.....A..A...A...E...A......A...P....E..E....E.KV..EEK-...................E..ESDE........DMG..FGLF...............................
A0A0P7GR51_9EURY/16-107                ......................................................................EINEENVTAVLEA......AG.V.D.VE.....ESRVK..A.......L.V.A...A.......LE............D.V...DI.E.EA.I.ETAAAAPA............................................AGGAA.A.GG...A....S..G...A....D.....E..A...E...D...E......A...D....E..A....E.EE..AEAE..................eE..EEDE........DEG.dG---geglg..........................
S8APN6_DACHA/21-108                    ......................................................................EITAEKLQTLVKA......AS.V.E.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGSGGG............................................AAAAA.G.PS...A....A..T...G....G.....S..A...P...A...E......E...A....K..E....E.AK..EEEK...................E..ESDE........DMG..FGLF...............................
B9HSR0_POPTR/234-319                   ......................................................................YPTLAAAPHMFIN......AY.K.N.VL.....AVAVA..T.......E.Y.S...F.......PQ............A.E...KV.K.EF.L.EDPSKF--............................................AVAAA.P.VT...A....A..A...S....G.....G..A...P...A...A......A...K....E..E....E.KK..EEPA...................E..ESDD........DMG..FSLF...............................
M3YCB9_MUSPF/19-116                    ......................................................................SPSAKDIKKILDS......VG.I.E.AD.....DDRLN..K.......V.I.S...E.......LN............G.K...NL.E.DV.I.AQGIGKLAsvpa....................................ggavAVSAA.P.GS...A....A..P...A....A.....G..A...A...P...A......A...A....E..E....K.KD..EKKEe.................sE..ESDD........DMG..FGLF...............................
W7LXA2_GIBM7/229-312                   .....................................................................f-PTLPSVLHSVVN......SY.K.K.VL.....AVAIS..T.......E.I.T...W.......PE............I.E...EL.K.DR.I.ANPDAY--............................................-ASAA.P.AA...A....A..S...G....G.....A..A...A...P...A......E...T....E..K....K.DE..SEE-...................-..EDED........EEG.fGGLF...............................
A0A1R3IP07_COCAP/234-320               ......................................................................YPTIAAAPHMFVN......SY.K.N.AL.....SLAVA..S.......D.Y.S...F.......PQ............A.E...KV.K.EF.L.KDPSKF--............................................AVAAV.A.AA...A....P..S...S....G.....A..A...Q...Q...D......K...E....E..K....R.EE..AKEE..................qE..ESDE........DLV..AGLF...............................
A0A183HKG4_9BILA/23-98                 ......................................................................SPTAKDIENVLGS......VG.L.D.VD.....MEDAN..K.......V.V.S...A.......LS............G.K...SI.D.EV.I.AAGLTKISs.........................................vpS--GS.A.AS...A....A..A...P....V.....A..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----stiptgtleaeskk.................
I7J968_BABMR/21-107                    .....................................................................g----EEIEKIIKS......VG.G.E.VD.....DKVLS..G.......F.I.N...A.......IK............D.K...QP.H.EL.I.SAGLGKLQti........................................smSSASV.S.AA...A....P..A...T....V.....H..G...G...A...T......A...E....P..E....K.KE..EEE-...................-..EEDD........DMG..FSLF...............................
A0A1D6C556_WHEAT/17-111                ......................................................................SPTKDDVRAILGS......VG.A.E.VE.....EGKLD..A.......L.F.K...E.......VE............G.K...DL.A.EL.L.AAGREKFAfap......................................sggAGAAM.G.AS...P....V..A...A....G.....D..A...A...E...E......K...K....E..K....A.QE..KKEE...................E..EEEE........DLD.mFSLF...............................
A0A2H3XT26_PHODC/17-112                .....................................................................c-PTADDLKDILGS......VG.A.E.AD.....DDKIE..L.......L.L.S...E.......VK............G.K...DI.T.EL.I.ASGREKVAsvp......................................sggGAIAV.A.AP...A....G..G...G....G.....A..A...A...P...A......A...D....E..P....K.KE..EKVEe.................kE..ESDE........DMG..FSLF...............................
M0SWA9_MUSAM/234-318                   ......................................................................YPTLAAAPHMFIN......AY.K.N.VL.....AVAIA..T.......E.Y.T...F.......PQ............A.E...KI.K.EY.L.KDPSKF--............................................AVAAT.P.VT...E....E..A...A....A.....A..P...A...A...A......P...A....E..E....K.KE..EPA-...................E..ESDD........DMG..FSLF...............................
A0A0L7REM3_9HYME/16-112                ......................................................................SPTQYDIEKILSS......VG.I.E.AD.....EEKIN..K.......V.V.S...E.......LN............G.K...SV.D.EY.I.ALGRTRLLsm.......................................pigGAAAA.T.VA...V....A..P...V....G.....G..T...T...A...P......A...E....E..K....K.EE..KKPAke...............esE..SEDE........DMG..FGLF...............................
C7YQC5_NECH7/228-309                   .....................................................................f-PTLPSVMHSLVN......SY.K.K.VL.....AVAVS..T.......E.Y.S...W.......PE............I.E...QL.K.DR.I.ANPDAY--............................................---AS.A.AP...V....A..A...A....D.....S..G...A...A...A......A...E....E..K....K.DE..SEE-...................-..EEEE........DEG.fGGLF...............................
A0A0D2TLY9_GOSRA/17-112                ......................................................................SPSADDLKDILGS......VG.A.E.AD.....DDRIE..L.......L.L.S...E.......VK............G.K...DI.T.EL.I.ATGREKLAsvp.....................................sgggAVAAA.P.TA...G....G..G...G....A.....S..A...A...P...A......A...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
U5DHQ6_AMBTC/17-117                    ......................................................................QPSVDDIKKILGS......VG.A.D.AD.....EERIE..Y.......L.L.S...E.......VK............G.K...DI.T.EL.I.ASGREKLAsvpsg.................................ggggggVAVAA.A.AP...A....S..G...G....G.....A..A...A...P...A......A...P....E..A....K.KE..EKVEe.................kE..ESDD........DMG..FSLF...............................
A0A1A8YW79_9APIC/218-300               .....................................................................i-ITEASYPHVFVE......AF.K.N.IV.....ALVID..T.......D.Y.T...F.......PL............M.K...NI.K.DM.I.ENPQAY--............................................----A.A.AP...V....T..A...A....K.....D..D...A...P...K......K...E....E..V....K.KQ..EEEE..................eE..EEDG........FMG..FGMF...............................
A0A1J8QFZ6_9HOMO/17-110                ......................................................................SPSADDVQKVLNA......VG.I.E.SD.....EDRLE..K.......L.I.S...E.......LD............G.K...DV.N.AL.I.AEGSAKLSsv.......................................psgGAVAA.S.AP...A....A..G...G....A.....A..P...A...A...A......A...E....E..V....K.EE..KKEE..................kE..ESDD........DMG..FGLF...............................
A0A1Y2GJH5_9FUNG/17-109                ......................................................................SPSASDITSLLGT......VG.I.E.AE.....SERIE..S.......L.I.S...Q.......LS............G.K...DI.N.EL.I.AEGTSKLAs.........................................vpAGGAA.G.GA...A....P..A...A....G.....G..A...G...A...A......K...E....E..K....A.EE..KKEEa.................kE..ESDD........DMG..FGLF...............................
L8GPQ3_ACACA/232-322                   ......................................................................YPTVASVPYALTS......SF.R.N.LL.....SVSLA..T.......S.Y.T...F.......PQ............A.E...KL.K.DL.L.ANPEAFAAal........................................aaAAPAGgA.AP...A....T..A...T....S.....A..A...A...P...A......A...A....A..A....K.VE..EEE-...................E..AEDM........DAG..-GLF...............................
A0A0M0JB82_9EUKA/232-325               .....................................................................l-PNDASFPHMFIK......GA.K.N.VV.....AVALE..A......gF.I.E...F.......DV............V.K...KI.K.DM.L.DNPDKYSGgg.......................................gggGGGAA.P.AP...A....A..A...K....G.....G..A...P...A...P......A...A....A..A....K.AP..EPEP...................A..EEEE........AAA..FDLF...............................
G4ZT58_PHYSP/27-112                    ......................................................................EITPEAIQHIVHA......SG.N.E.VE.....PYWPT..L.......F.A.S...L.......LS............K.E..gKI.I.EL.I.STGGAA--............................................---AG.G.AA...A....P..G...A....A.....A..G...A...A...D......A...E....A..K....E.EE..KAVE...................E..EEEV........DMG..GGM-dmf............................
A0A1Y2HST7_9FUNG/21-110                ......................................................................EITADKLATITKA......AG.V.E.VD.....SIWFS..L.......F.A.K...A.......LS............T.V...SI.T.DL.L.NNVGSGPA............................................AGSAP.A.AA...A....G..G...A....S.....S..G...A...A...A......A...E....A..A....P.AA..KEEEa.................kE..ESDE........DMG..FGLF...............................
G0QFB8_NANS0/16-102                    ......................................................................EVNEENLQEIVDA......AD.L.D.VE.....DSEVS..A.......L.V.A...A.......LE............D.V...DI.E.EA.M.ETAVAG--............................................GAAPA.G.GS...S....E..D...T....V.....D..E...E...E...A......E...E....E..E....E.EE..EDEA...................D..EEEA........AEG.lGNMF...............................
A0A135VYN5_9ARCH/235-339               .....................................................................i-PTEETIAMILAK......AN.V.-.-E.....ARSLA..L.......E.V.S...F.......FE............P.D...LL.E.DF.L.AKANSEFLalaaaisek..........................dpeaipsdvLSQVQ.T.AA...A....A..A...S....V.....A..P...T...T...E......A...S....E..K....Q.DE..PEED...................D..EEEA........VAG.lGGLF...............................
H0ERP3_GLAL7/17-111                    ......................................................................SPSEKDIKTVLES......VG.I.E.AD.....DDRLK..S.......L.I.S...E.......LK............G.K...DL.Q.EL.I.AKGSSKLAsvp......................................sggGGGGA.A.AS...G....G..A...A....A.....G..G...A...A...A......A...E....E..K....E.EE..KEEE..................kE..ESDE........DMG..FGLF...............................
A0A1A6HSN5_NEOLE/30-98                 .....................................................................t-VTEVKINALIKV......AS.V.S.VE.....PLWPG..L.......F.A.K...A.......LA............N.V...NI.G.SL.I.CNVG----............................................-----.-.--...-....-..-...-....-.....A..A...E...E...K......K...V....E..A....K.KE..ESE-...................-..ESDD........DMG..LGLF...............................
A0A0A2VU65_BEABA/21-107                ......................................................................EITADKLQSLIKA......AN.V.E.VE.....PIWTS..I.......F.A.K...A.......LE............G.K...DV.K.DL.L.VNVGSGGG............................................AAPAA.G.GA...A....P..A...A....G.....G..A...A...D...A......P...A....E..E....A.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A2DI07_TRIVA/20-103                    ......................................................................EITAEKLNTLIKA......AN.V.K.LN.....NYWVD..L.......F.A.D...Y.......FK............N.H...DV.T.EL.V.KNGAAGG-............................................AAPAA.A.AA...G....G..A...A....A.....A..E...E...A...P......K...E....E..E....K.KE..EEP-...................-..----........---..----aapldlgdmf.....................
A0A162R9D5_MUCCL/228-307               ......................................................................YPTLASVPHSVIN......GY.K.N.LL.....AVSVA..S.......D.Y.T...F.......PG............S.E...QI.K.EF.I.ANPEAF--............................................---AV.A.AP...V....A..A...E....T.....S..S...A...P...A......A...E....A..A....A.EE..SE--...................-..EEDD........DMG..FGLF...............................
A0A0E0F2E3_9ORYZ/722-807               ......................................................................YPTIAAAPHMFLN......GY.K.N.VL.....AVAVE..T.......E.Y.S...Y.......PH............A.D...KI.K.EY.L.KDPSKF--............................................AVAAP.V.AA...A....D..S...G....G.....A..A...P...A...A......S...K....E..E....E.KK..EEPE...................E..ESDG........DLG..MSLF...............................
A0A0J9EAQ8_9RHOB/16-99                 ......................................................................EVNEANLSSVVKA......SG.A.E.VN.....EAQVK..S.......L.V.A...A.......LA............D.V...NI.D.EA.V.KAAPVA--............................................-VAAA.A.AP...A....D..A...A....A.....G..G...E...E...K......K...E....E..K....K.EE..PKN-...................-..EEAA........MEG.lSSLF...............................
A0A1I8F2I1_9PLAT/38-105                .................................................................hrlrr-------------......--.-.-.--.....-GRLN..K.......L.F.A...D.......LK............G.K...SI.D.EM.I.EAGQKKLAsv........................................psG----.-.AP...A....A..G...A....A.....A..A...A...P...A......A...A....A..E....A.AK..PEA-...................-..----........---..----rkrrkkrsp......................
A0A1Y2DLM8_9PEZI/226-312               .....................................................................f-PTLPSVMHSLVN......SY.K.N.VL.....AVAIE..T.......E.Y.S...W.......PE............V.E...AL.K.DR.I.ANPDAY--............................................ASAAP.A.AG...A....A..D...T....S.....A..T...A...A...A......A...E....E..K....K.AD..SDEE...................N..SEEE........DGG.fGGLF...............................
A7TPM0_VANPO/16-106                    .....................................................................a-PSADKVSEVLKS......VG.I.E.VE.....DDKVS..A.......L.M.T...A.......LE............G.K...SV.E.EL.I.AEGIEKMAsvp......................................aagPASAG.G.AA...A....S..G...A....A.....S..G...A...A...A......E...E....E..A....A.AE..E---...................S..EEDD........DMG..FGLF...............................
W2GJS6_PHYPR/17-105                    .....................................................................t-PAVADLEKVVKS......FG.G.E.FD.....QEQAE..K.......L.V.K...E.......LE............G.K...NI.E.EV.I.EAGKAKLAt..........................................vSVGAA.P.AA...G....A..A...A....G.....G..A...A...P...A......K...E....E..E....K.AV..EE--...................-..EEEV........DMG..GGM-dmf............................
G1NA41_MELGA/17-114                    ......................................................................SPTSKDLKKILDS......VG.I.E.TD.....DERLN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGNGKLAsmpa....................................ggavAVSTG.G.VS...A....A..P...A....A.....G..A...A...P...A......A...A....E..E....K.KE..EKKEe.................sE..ESDD........DMG..FGLF...............................
S9WQI4_CAMFR/1-92                      .....................................................................m-VTEDKINALIKA......AN.V.N.VG.....PFWPG..L.......F.A.K...A.......LA............N.V...NI.G.SL.I.CNVGVSTPv..........................................pAAGAA.P.AG...G....P..V...P....S.....T..T...A...A...Q......D...E....E..K....K.VE..AKKEe.................sK..EYDD........DMG..FGLF...............................
A0EAT4_PARTE/17-112                    .....................................................................a-PTEDDITKLLKE......AG.V.E.SV.....AADVK..N.......V.V.S...T.......LK............G.K...NL.N.DV.I.KEGQKQLTslsvg..................................ggaqqSSAPA.P.QA...T....T..A...A....Q.....T..A...P...A...A......K...V....E..P....P.KK..AEEP...................-..EEDV........DMG..-GLF...............................
A0A1U8PQ91_GOSHI/17-113                ......................................................................NPSAGDLKAILGS......VA.A.E.AD.....NDKIE..M.......L.L.S...E.......VK............G.K...DI.T.EL.I.ASGREKLAsvps...................................gggggVAVAA.P.TT...G....G..G...A....G.....D..A...P...A...A......E...A....K..K....E.EK..VEEK...................E..ESDD........DMG..FSLF...............................
A0A0N0RXU2_9EURO/229-311               ......................................................................YPTLPSVMHSLIN......GY.K.K.VL.....AAAIS..T.......D.Y.S...W.......AE............I.D...EL.K.DR.I.ANPDAY--............................................AS-AA.P.VA...A....A..A...T....S.....G..G...D...A...P......A...A....A..A....P.AE..DDE-...................-..ESDE........DMG..FGLF...............................
I1JS37_SOYBN/21-102                    .....................................................................s-VTADKISTLLKT......AK.V.P.VD.....SYWPT..L.......F.A.K...L.......AE............K.K...NL.G.DL.I.ANAAGGGApv........................................avAAAPV.A.AA...A....G..G...A....A.....A..A...A...P...A......A...E....E..K....K.KN..RKK-...................-..----........---..----rvm............................
A0A024VN04_PLAFA/9-66                  .............................................................ciqyyvkms-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.-L.L.SNLSVG--............................................SAPAA.A.AQ...V....T..T...E....K.....P..S...E...D...K......K...E....A..K....K.EE..KVEE...................E..EEED........DLG..FSLF...............................
G8JV68_ERECY/229-311                   ......................................................................YPTLPAVGHNLIN......NY.K.N.LL.....AVAIA..S.......N.Y.I...Y.......PE............I.E...EL.S.DR.I.ANPEKY--............................................-ASSA.P.VA...A....A..A...A....A.....S..S...D...A...P......A...E....A..A....E.EE..EED-...................-..ESDA........DMG..FGLF...............................
B5DGC7_SALSA/231-314                   ......................................................................YPTLASIPHTIIN......GY.K.R.VL.....AVAVE..T.......D.Y.S...F.......PL............A.D...KV.K.DY.L.ADPTAF--............................................-AVAA.P.VA...V....A..E...T....A.....A..A...P...A...A......A...K....E..E....A.KE..ESE-...................E..GSDD........DMG..FGLF...............................
V9EUP6_PHYPR/27-114                    ......................................................................EITSDSIQQVVNA......SG.N.E.VE.....PYWPT..L.......F.A.S...L.......LS............K.E..gKV.L.EL.I.STGGAAAG............................................GAAAA.P.GA...A....A..G...A....A.....G..A...E...E...E......K...V....E..E....K.AK..EE--...................-..EEEA........DLG..GGM-dmf............................
M4C7I1_BRARP/234-318                   ......................................................................YPTIAAAPHMFIN......AY.K.N.VL.....AVALA..T.......E.Y.S...F.......PQ............A.E...NV.K.EF.L.KDPSKFA-............................................VAAAA.V.AP...V....S..G...E....S.....G..G...A...P...V......A...A....A..V....V.EE..AAE-...................-..ESDG........DMG..FDLF...............................
A0A1D6FKX5_MAIZE/25-119                ......................................................................SPSAEDLTAILES......VG.C.E.VD.....NERME..L.......L.L.S...Q.......LS............G.K...DI.T.EL.I.AAGREKFAsvp......................................cggGGVAV.A.AA...S....P..A...A....G.....G..A...A...P...T......A...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
Q9HL72_THEAC/10-105                    ................................................................lhaagkEVDEEKLKKVLED......VG.V.Q.VD.....EARLK..T.......L.V.S...G.......LK............D.V...NI.D.EV.L.KNASVAQV............................................ATAPA.P.AA...E....E..K...K....K.....E..E...P...K...K......K...E....E..K....K.KE..EDKE..................hE..EEEA........MSG.lSALF...............................
B9SEJ7_RICCO/21-109                    .....................................................................p-VTSEKIATLVKA......AN.V.A.VE.....SYWPS..L.......F.A.K...L.......AE............K.K...NI.D.DL.V.MNVGSGGGa.........................................apVAVSA.P.AA...G....A..G...A....A.....A..A...A...P...A......V...E....E..K....K.EE..PK--...................E..ESDD........DMG..FSLF...............................
A0A1U8L658_GOSHI/22-113                .....................................................................p-ITAEKIATLVKA......AN.V.S.VE.....SYWPS..L.......F.A.K...L.......FE............K.C...NI.E.DL.I.TNVGAAGAga.......................................pvaAAAPV.A.AG...A....G..G...G....A.....A..A...P...P...P......A...E....E..T....K.KE..EPE-...................E..ESDD........DMG..FSLF...............................
A0A0L9UA58_PHAAN/211-295               ......................................................................YPTIAAAPHMFVN......SY.K.N.VL.....AVAVA..T.......E.Y.S...F.......PQ............A.N...EV.K.EY.L.KDPSKFA-............................................VAAAV.A.AP...A....T..G...S....A.....P..A...A...A...S......K...E....E..E....K.KE..EP--...................E..ESDD........DMG..FSLF...............................
A2WLK9_ORYSI/17-113                    ......................................................................SPTAEDLTTILES......VG.C.E.ID.....NAKME..L.......L.L.S...Q.......VS............G.K...DI.T.EL.I.ACGREKFAsvps....................................ggggVAVAA.A.AP...A....A..G...G....A.....G..G...A...P...A......A...E....A..K....K.ED..KVEE..................kE..ESDD........DMG..FSLF...............................
A0A0G4NWQ8_PENCA/17-107                .....................................................................a-PSSADIKSVLSS......VG.I.D.AE.....GDRLE..K.......V.I.A...E.......LQ............G.K...DL.Q.EL.I.SEGSTKLAsv.......................................psgGAGAA.A.PA...A....A..A...A....G.....G..A...A...A...P......A...E....E..K....V.EE..KE--...................E..ESDE........DMG..FGLF...............................
A0A022R988_ERYGU/17-114                .....................................................................s-PSGDDLKNILAS......VG.A.D.AD.....QDKIE..L.......L.L.S...Q.......IK............G.K...DI.T.EL.I.ASGREKLAsvpa....................................gggaVAVSA.P.VG...G....G..G...G....G.....A..A...P...A...A......A...A....E..T....K.KE..EKVEe.................kE..ESDD........DMG..FSLF...............................
A0A2G2Z109_CAPAN/17-114                ......................................................................SPSSDDLKKILNS......VG.A.E.ID.....DVKIE..L.......L.L.S...Q.......VK............G.K...DI.N.EL.I.AAGKEKLAstscl..................................sfgcvANNAS.V.VV...D....G..G...Q....V.....I..V...V...E...E......K...K....A..E....K.KV..EKEE...................E..SDEE........DFN..FSLF...............................
A0A2H3U1X8_FUSOX/17-109                ......................................................................SPSAADVKAVLES......VG.I.E.AD.....DERLN..T.......L.I.S...E.......LE............G.K...DI.Q.EL.I.AEGSEKLAsvp......................................sggAGGAA.A.GG...A....A..A...A....G.....G..A...A...E...E......A...K....E..E....E.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A0D2HGP3_9EURO/17-113                .....................................................................d-PSEDDIKGVLSS......VG.I.D.AD.....EERLS..K.......L.L.E...E.......LK............G.K...DI.N.EL.I.AEGSTKLAsvpt....................................ggagGAAAP.A.AG...G....A..A...A....G.....G..A...A...A...A......E...E....E..K....P.AE..KEEE..................kE..ESDE........DMG..FGLF...............................
A0A137R1G9_9AGAR/21-109                ......................................................................EITSDKILAITNA......AG.V.E.LE.....PIWAS..L.......L.A.K...A.......LD............G.K...NV.K.EL.L.SNIGSGGG...........................................aPTAAT.P.AA...G....G..A...P....A.....G..G...A...A...E......A...P....K..E....E.KE..EEK-...................E..ESDE........DMV..-SLFlf.............................
RLA2_ASPFU/17-110                      ......................................................................SPSSEDVKAVLSS......VG.I.D.AD.....EERLN..K.......L.I.A...E.......LE............G.K...DL.Q.EL.I.AEGSTKLAsvp......................................sggAAAAA.P.AA...A....G..A...A....A.....G..G...A...A...A......P...A....A..E....E.KK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A1Y1VD95_9FUNG/17-107                ......................................................................SPSANDLKKIIKT......IG.A.D.VD.....DEKVD..A.......V.V.A...A.......LN............G.K...DI.D.EV.I.ADGFSKLSaa........................................pvASGSA.G.AA...A....G..G...A....G.....A..A...A...E...A......A...E....E..A....K.EE..EEE-...................E..ESDS........DMG..FGLF...............................
A0A135UZE1_9PEZI/21-108                ......................................................................EITADKLQTLIKA......AK.IeD.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.SNVGSGGG............................................AAAPA.A.GG...A....A..A...G....G.....A..T...E...A...A......A...E....E..A....P.KE..EEK-...................E..ESDE........DMG..FGLF...............................
I3J4E9_ORENI/17-113                    ......................................................................NPDAKDIKKILES......VG.I.E.TD.....DTRLD..K.......V.I.S...E.......LK............G.K...NV.N.DV.I.ATGYGKLAsmpa....................................ggavAVASS.A.AA...G....S..G...G....A.....A..A...P...A...A......A...E....E..K....K.EE..KKEE..................sE..ESDD........DMG..FGLF...............................
A0A1S3V1S5_VIGRR/17-113                ......................................................................SPSAAVIKEILGS......VG.A.E.AD.....SDRIE..L.......F.L.S...E.......IK............G.K...DI.V.EV.I.AAGREKLAsvps....................................ggggAVAVA.A.AP...G....G..G...G....G.....A..A...A...P...A......A...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
F7GPD3_CALJA/22-113                    .....................................................................t-VTEDKINALIKA......AR.V.N.VE.....PFWPG..L.......F.A.K...A.......LA............N.V...NT.G.SL.I.CNEGAGGSa..........................................pAAGAA.P.AG...G....P..A...L....S.....T..A...A...A...P......A...E....E..K....K.VE..AKKEe.................sE..ESDD........DMG..FGLF...............................
G9NNF9_HYPAI/17-109                    ......................................................................SPSAEDVKAVLSS......VG.I.E.AE.....DERLE..K.......L.I.S...E.......LS............G.K...DV.N.EL.I.AAGSEKLAsvp......................................sggAGGAA.P.AG...G....A..-...A....A.....G..G...A...A...A......A...E....A..V....E.EK..EEEK...................E..ESDE........DMG..FGLF...............................
I2JTS8_DEKBR/23-113                    .....................................................................t-PSKDDVTKVLEA......AG.A.E.ID.....EAKID..S.......L.I.E...S.......LK............D.K...KV.E.DV.I.AQGQEKLS...........................................tVSXAA.P.AA...S....A..D...G....K.....S..S...D...D...A......A...D....E..E....K.ED..AEEE...................E..EEDDd......mDMG..MDLF...............................
A0A287CUL9_ICTTR/205-285               ......................................................................YPTVVSVPHSIIN......GY.K.R.VL.....ALSVE..T.......E.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAF--............................................---VA.A.AS...V....A..A...A....T.....T..A...A...A...P......A...K....V..E....A.KE..ESG-...................-..ESDE........GMG..FGLF...............................
A7TRI9_VANPO/20-105                    ......................................................................EISSDNLLALTNA......AN.L.P.IE.....GIWAD..I.......F.A.K...A.......LE............S.Q...DL.K.QL.L.VNFSAG--............................................ASAPV.A.GV...A....G..A...V....G.....G..A...A...A...A......G...E....E..A....K.EE..EEAK...................E..ESDD........DMG..FGLF...............................
F2PTP8_TRIEC/229-310                   .....................................................................f-PTMPSVIHSLIN......TY.K.K.CV.....AIGIE..T.......E.Y.S...W.......ES............I.E...EL.K.DR.I.ANPDAY--............................................---VS.T.GP...A....V..T...E....T.....K..E...D...K...P......K...E....E..A....K.VE..EEE-...................E..ESDE.......gGFG..-DLF...............................
A0A251UPU1_HELAN/234-320               .....................................................................y-PSLAAAPHMIVN......GY.K.N.VL.....SMAVA..T.......E.Y.S...F.......KH............A.E...KA.K.EY.L.KDPSKF--............................................EAAAA.P.VS...V....G..A...S....S.....S..G...A...P...A......A...V....E..K....E.QK..EEPE...................E..SSEG........EVG.lMGLF...............................
G3B2H7_CANTC/24-114                    ......................................................................SPSAADIKAVLES......VS.I.E.VE.....DEKIE..K.......L.L.A...E.......VE............G.K...SA.E.EL.I.AEGNEKLSsv........................................ptGGAAA.A.SS...S....G..A...A....A.....A..S...G...D...A......P...A....E..E....E.AE..EEA-...................E..ESDD........DMG..FGLF...............................
A0A1S3E560_CICAR/87-174                ....................................................................yl--TVATAPHMFVN......AY.K.N.VF.....AVEVA..T.......K.Y.S...F.......PD............A.D...KV.K.EF.L.KDASKFSV............................................AAIAA.P.AA...D....S..G...T....A.....S..A...A...A...A......K...E....E..E....K.KD..ELM-...................-..----........---..----nelfedslrgagi..................
A0A0E0Q290_ORYRU/57-118                ..........................................................mvspssavfqvi-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.I.GAVGGGAA...........................................iGGGAA.A.GA...A....S..G...G....A.....A..A...E...A...P......K...A....E..E....K.KE..EEK-...................E..ESED........DLG..FSLF...............................
K0KCA6_WICCF/20-111                    .....................................................................a-PSAASVKSVLES......VG.I.E.VE.....EERIS..Q.......L.F.E...A.......VE............G.K...SV.E.EL.I.AEGNEKLAsv.......................................pvgGSGAA.A.GS...G....A..A...A....S.....G..S...T...E...A......A...A....E..E....E.KE..EEK-...................E..ESDD........DMG..FGLF...............................
V4MWJ8_EUTSA/22-112                    .....................................................................a-ITADKIATLVKS......AG.V.S.IE.....SYWPM..L.......F.A.K...M.......AE............K.R...NV.T.DL.I.MNVGAGGGgg........................................apVAAAA.P.AA...G....G..A...A....A.....A..A...A...P...A......A...E....E..K....K.KD..EPA-...................E..ESDG........DLG..FGLF...............................
A0A0Q0VR99_9EURY/16-103                ......................................................................EIDEENLKKVLEG......AG.V.T.AD.....EARLK..S.......L.L.E...S.......MK............N.V...NI.D.EV.L.KNAAAA-P............................................VAAAA.P.AP...A....A..S...E....K.....K..E...E...K...K......E...E....K..K....K.EE..KKEE...................A..ESDA........MAG.lSSLF...............................
A0A0F4ZHZ3_9PEZI/229-312               ......................................................................YPTLPSVMHSLVN......SY.K.N.VL.....AVAIS..T.......E.Y.S...W.......EG............I.E...EL.K.DR.I.ANPEAY--............................................ASAAP.A.AA...A....T..A...G....G.....A..A...E...E...K......A...E....D..K....P.AE..AEE-...................-..DSDD........DMG..FGLF...............................
G2YZN2_BOTF4/229-311                   .....................................................................f-PTLPSVMHSVVN......SY.K.K.VL.....AVAIS..T.......D.Y.S...W.......SE............I.D...EL.K.DR.I.ANPEAY--............................................---AS.A.GP...A....V..T...E....A.....A..P...A...A...V......A...E....E..A....K.KE..ESEA...................-..EESA........DEG.fGGMF...............................
RLA4_SCHPO/17-109                      ......................................................................SPSASDIESVLST......VG.I.E.AE.....AERVE..S.......L.I.S...E.......LN............G.K...NI.E.EL.I.AAGNEKLStv.......................................psaGAVAT.P.AA...G....G..A...A....G.....A..E...A...T...S......A...A....E..E....A.KE..EEAA...................E..ESDE........DMG..FGLF...............................
A0A150FUL6_GONPE/21-106                ......................................................................EITAENILTITKA......AG.L.E.VE.....AYWPS..L.......F.A.K...L.......FA............K.K...SI.E.DL.I.TNVGSG--............................................GGAPA.A.AA...A....A..P...A....A.....G..G...A...P...A......A...A....A..P....K.KE..EKKE...................P..SEEE........DMG..FSLF...............................
A0A1R3RPW4_ASPC5/17-104                ......................................................................SPSAEDIKGVLSA......VG.I.D.AD.....EERLQ..K.......L.I.S...E.......LE............G.K...DL.Q.EL.I.AEGSTKLAs..........................................vPSGGA.G.AA...A....A..P...A....A.....G..G...A...A...A......A...A....D..A....P.AE..EKE-...................-..ESDE........DMG..FGLF...............................
A0A0K9PTP6_ZOSMR/17-110                .....................................................................s-PTITDLEKILSS......VG.A.D.AD.....NEKMQ..L.......F.F.S...E.......IK............G.K...DV.T.EL.I.ASGREKLAsvl......................................sggGGGPA.V.AA...A....T..S...G....G.....G..A...A...P...A......V...E....A..K....E.EK..VEEK...................E..ESDD........DMG..FSLF...............................
A0A093Q1J4_9PASS/231-317               ......................................................................YPTIASVPHSIIN......GY.K.R.VL.....AVAVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFVA............................................AMPVV.T.EA...A....A..P...A....A.....A..A...A...A...A......P...A....K..E....A.AK..EES-...................E..ESDE........DMG..FGLF...............................
A0A1S3XMA7_TOBAC/17-110                ......................................................................SPTAEDLKAILSS......VG.A.E.AD.....NEKIE..L.......L.L.S...Q.......VK............G.K...DL.T.EL.I.AAGREMIAsvp......................................sggGGVVV.V.AS...G....G..G...G....G.....G..A..vV...E...E......K...V....E..E....K.KV..EEK-...................E..ESEE........DFG..FDLF...............................
A0A074VQP9_9PEZI/21-108                ......................................................................EITADKLQTLIAA......AK.I.E.VE.....PIWTQ..L.......F.A.K...A.......LE............G.K...DV.K.EL.L.LNVGSGSG............................................AAAAP.A.AG...G....A..A...A....G.....G..A...A...D...E......A...A....P..A....E.EK..AEEK...................E..ESDD........DMG..FGLF...............................
A0A099P603_PICKU/229-306               ......................................................................YPTVAAVSHQIVN......SY.K.N.IL.....ALSVA..T.......D.Y.T...F.......EG............S.E...QI.K.DR.I.ANPEAY--............................................---AA.A.AP...A....A..A...A....S.....S..S...S...A...A......A...E....E..A....A.PA..EEE-...................-..ESDD........DM-..----al.............................
Q5I7K5_WHEAT/21-109                    .....................................................................p-ITSEKIATVVKA......AG.I.K.VE.....AYWPA..L.......F.A.K...L.......LE............K.R...SV.D.DL.I.LSVGSGGG............................................G-APA.A.AA...A....A..P...A....A.....G..G...A...A...A......A...E....E..K....K.EE..KKEEa.................kE..ESDD........DMG..FSLF...............................
E1RJY9_METP4/16-102                    ......................................................................EINEEAVSAVLTA......AG.I.A.VD.....DSRVK..A.......L.I.A...A.......LD............G.V...DI.A.EA.I.EKSAVA--............................................AVAAA.P.AA...A....A..P...A....A.....E..A...A...P...A......Q...E....E..A....A.EE..EEKA...................D..EEGG........MAG.lGALF...............................
H1VUX6_COLHI/17-109                    .....................................................................a-PSAQDVKTVLES......VG.I.E.AD.....EERLN..T.......L.I.S...E.......LK............G.K...DI.N.EL.I.AEGSGKLAsvp......................................sggAGGAA.P.AA...G....G..X...A....P.....A..A...A...D...A......P...A....D..E....P.KE..EDK-...................E..ESDD........DMG..FGLF...............................
M2Y4X8_GALSU/230-318                   ......................................................................YPTQASIPYTIIS......SL.K.N.LF.....AVSLV..S.......E.Y.T...M.......PQ............A.V...QL.K.DL.L.DNPEALAQmv.......................................vvnA---V.P.NA...S....A..G...G....V.....S..R...T...E...E......K...Q....E..Q....A.QQ..QQEE..................eE..EEEE........---..----vlvwd..........................
A0A218W393_PUNGR/234-319               .....................................................................f-PTLAGAPHMFIN......AY.K.N.VL.....SLAVA..T.......E.Y.T...Y.......PQ............A.E...KV.K.EY.L.KDPSKFA-............................................AAAAA.P.VA...A....A..G...A....G.....G..G...A...A...A......P...A....A..K....E.EK..EEE-...................E..ESED........DMV..AGLF...............................
A9U0Z9_PHYPA/17-114                    .....................................................................a-PSAKDIESILGA......VG.A.E.AD.....PSRIS..L.......L.L.K...E.......LE............G.K...DI.L.EV.I.AAGKEKFAsvpsg.................................ggggivVASGG.G.GG...G....A..A...A....P.....A..A...E...E...K......K...E....E..S....K.KE..EEK-...................E..ESDD........DMG..FSLF...............................
A0A182P931_9DIPT/231-314               ......................................................................YPTLASVPHSIAN......GF.R.N.LL.....AIAAV..T.......E.V.E...F.......KE............A.E...TV.K.EF.I.KDPSKF--............................................-AAAA.A.SS...A....P..A...A....S.....A..A...A...P...A......A...K....A..E....E.KK..EES-...................E..SEDD........DMG..FGLF...............................
A0A1Q9BWW4_SYMMI/23-119                ......................................................................SPSADDIKSILES......VE.S.E.YD.....ESIAS..K.......L.V.S...EpfgsssrLE............G.K...TV.H.EV.V.AEGKEKLKaqpa....................................gfggGGGGG.P.AI...G....G..G...G....G.....A..A...A...P...A......A...E....A..K....K.VE..EEE-...................E..EEE-........---..----tal............................
A0A1I7VVN4_LOALO/60-159                .....................................................................h-VTANDIENILGS......VG.V.D.CE.....HDKAE..E.......V.I.K...K.......MR............G.K...TL.D.EL.I.IEGSKCLTsvsaaap..............................ciggtpvATTAT.S.LT...D....K..N...A....V.....T..A...L...P...V......A...K....E..E....K.KE..KEE-...................-..ESDE........DMG..FGLF...............................
A0A2B7Z3Z2_9EURO/21-107                ......................................................................EITADKLQTLLKA......AN.VqD.VE.....PIWSS..L.......F.A.K...A.......LE............G.K...DL.K.DI.L.LNVGSG--............................................GGAAA.P.AA...G....G..A...A....T.....G..G...A...E...A......V...A....E..E....E.EK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A0D2SI41_GOSRA/23-110                .....................................................................i-----TIATLVKA......AN.V.S.VE.....SYWPS..L.......F.A.K...L.......FE............K.C...NI.E.DL.I.TNVGAAGAga.......................................avaAAAPV.A.AG...A....G..G...G....A.....A..A...P...P...P......A...E....E..K....K.KE..EPE-...................E..ESDD........DMG..FSLF...............................
D5U264_THEAM/16-104                    .....................................................................e-LSEENIKRVLEA......AG.V.A.VD.....DVRVK..S.......L.V.A...A.......LK............N.I...DI.A.KV.L.EQALAA--............................................--PVA.A.AP...V....Q..A...A....P.....A..Q...A...P...P......K...E....E..K....P.AE..EEKK..................eE.gVSEEa......lAEG.lSALF...............................
Q6P5K5_DANRE/22-112                    .....................................................................t-VTEDKLNALIKA......AG.V.T.IE.....PFWPG..L.......F.A.K...A.......LA............S.V...DI.G.SL.I.CNVGAGGG...........................................aAPAAA.A.GA...A....A..P...A....G.....G..D...A...P...A......K...E....E..E....K.KE..EKKEe.................sE..ESDD........DMG..FGLF...............................
B5DGX0_SALSA/17-112                    .....................................................................s-PSSKDIKTILGS......VG.I.E.AE.....DERLD..K.......V.V.N...E.......LN............G.K...DI.N.EV.M.NSGLSKLAsvp......................................aggAVAAP.A.AA...G....S..A...A....A.....G..V...S...P...T......A...A....E..E....K.KE..EKEEs.................eE..GSDD........DMG..FGLF...............................
G8YNS3_PICSO/17-107                    .....................................................................a-PTAADISGLLET......VG.S.E.VD.....QTRLN..N.......L.L.K...E.......LE............G.K...DI.N.EL.I.QEGNGKLAsv........................................psAGAAA.G.GA...A....A..A...A....P.....A..E...-...E...A......A...A....E..E....K.KE..EEAK...................E..ESDD........DMG..LGLF...............................
B2ATQ3_PODAN/17-110                    .....................................................................t-PSAADVKAVLES......VG.I.E.AD.....SDRLD..K.......L.I.S...E.......LE............G.K...DV.N.EL.I.AEGSSKLAsvp.....................................sggaGGAAA.A.GG...A....A..A...A....G.....G..A...A...E...A......A...P....E..E....A.KE..EEK-...................E..ESDD........DMG..FGLF...............................
W6YB45_COCCA/21-119                    .....................................................................d-ITADKLQSLIKA......AK.VeD.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGSGGGaa........................................apAAAGG.A.AA...A....G..G...A....G.....D..A...A...P...A......A...E....E..K....K.EE..DDPTntp.............tekE..ESDE........DMG..FGLF...............................
Q69UI8_ORYSJ/21-109                    .....................................................................p-ITSEKIATLVKA......AN.I.K.VE.....AYWPG..L.......F.A.K...L.......LE............H.R...SV.D.DL.I.LSVGSGGGa..........................................aPVAAA.A.AP...A....A..G...G....G.....A..A...A...A...P......A...A....E..E....K.KE..EAK-...................E..ESDD........DMG..FSLF...............................
A0A0U1LS43_TALIS/21-110                ......................................................................EITADKLNTLIKA......AN.VpD.VE.....PIWAQ..L.......F.A.K...A.......LD............G.K...DV.K.DL.L.TNVGSGGG............................................AAAAP.A.AG...G....A..A...A....A.....G..G...E...A...A......A...E....E..K....K.EE..KAEE..................aE..ESDE........DMG..FGLF...............................
A0A218XP16_PUNGR/10-119                .......ssgdewsakqvngdleacaastfelqrelvqtalsadssggvqssfsmvtpssavfqviiggg-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.-------Gggg......................................figGGAAA.A.AS...G....G..G...A....P.....A..A...A...E...A......A...P....A..E....E.KK..EEK-...................E..ESDD........DMG..FSLF...............................
A0A1S2Y8Z9_CICAR/234-321               ......................................................................YPTLAAAPHMLVN......AY.K.N.VL.....AVAVA..T.......E.Y.S...S.......PE............A.D...KV.K.EY.L.KDPSKFAV............................................AAVAA.P.AA...A....A..S...G....A.....A..P...A...A...A......S...K....E..E....A.KK..EEPA...................E..ESDD........DMG..FSLF...............................
A0A1V4L2F9_PATFA/22-64                 .....................................................................t-VTEDKINALIKA......AG.V.N.VE.....PFWPG..L.......F.A.K...A.......LA............N.I...DI.G.SL.I.SE------............................................-----.-.--...-....-..-...-....-.....-..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----ek.............................
A0A0F4Z4N1_TALEM/229-311               ......................................................................YPTLPSVVHSVVN......GY.K.K.VL.....AVAIG..T.......E.Y.S...W.......PE............I.E...EL.K.DR.I.ANPEAY--............................................AAAAP.V.AA...A....A..P...A....A.....A..E...E...A...P......K...E....E..A....K.EE..EEE-...................-..SGDE........GFG..-GLF...............................
A0A0D2H0D6_9EURO/21-113                ......................................................................EITADKLNTLIKA......AG.VvD.VE.....PIWAT..L.......F.A.K...A.......LE............G.K...DV.K.DM.L.LNVGSGGG............................................AAAAA.P.AG...G....A..A...G....A.....G..G...A...G...A......A...E....E..A....P.KE..EEKKee...............ekE..ESDE........DMG..FGLF...............................
A0A182X1D6_ANOQN/23-112                .....................................................................a-VTDEKIATILKA......AN.V.D.IE.....PYWPG..L.......F.A.K...A.......LE............G.I...DV.K.SL.I.TSIGSGVG............................................SGGGA.P.AA...A....A..G...G....A.....G..A...A...P...A......A...A....E..K....K.EE..KKEEe.................pE..ESDD........DMG..FGLF...............................
A0A0D2QAP7_GOSRA/17-112                ......................................................................SPSADDLKNILAS......VG.A.D.AE.....EERLQ..L.......L.L.S...E.......VK............G.K...DI.T.EL.I.ASGREKLAsvp.....................................sgggVAVAA.S.AP...G....A..A...A....A.....A..A...P...A...A......A...E....T..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
B3L4A3_PLAKH/19-110                    ......................................................................NPTAKEVKNVLDA......VN.A.G.VE.....EDVLT..N.......L.M.N...S.......LN............G.K...CY.H.EL.I.SEGMKKLQn.........................................igGGGGG.A.AA...V....A..T...A....D.....T..A...D...V...K......A...E....E..K....K.EE..KKEE..................eE..EEED........DLG..FSLF...............................
A0A168PKS2_ABSGL/24-88                 .....................................................hnslrpdflcshtrggv-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...-N.R.EY.L.ENPEAF--............................................-AVAA.P.VA...A....A..G...A....D.....A..G...A...A...Q......E...A....A..P....A.EE..EE--...................-..SEDD........DMG..FGLF...............................
A0A074T1Q0_HAMHA/19-112                .....................................................................a-PTKKQVEKTLSS......VG.I.D.VE.....DDIMD..A.......F.F.K...A.......VE............G.K...TP.H.EL.I.AAGMEKLQkvp.....................................sggvAAAAA.P.AA...G....A..A...D....A.....G..A...G...A...A......A...K....K..E....E.EK..KEE-...................E..EEED........DMG..FSLF...............................
A0A0B0MDL8_GOSAR/17-119                ............akqlegeiessaastyelqrklvqaatacdssggvtssfsvvtpnsavfqvviggavg-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.---G---Af.........................................igGGGAA.A.AP...A....G..G...A....A.....A..A...A...E...A......P...A....A..E....E.KK..EEK-...................E..ESDD........DMG..FSLF...............................
A0A0L0T5V5_ALLMA/17-107                ......................................................................SPSAADVSKILAA......VG.V.D.AD.....SAQLN..K.......V.I.A...E.......LD............G.K...NV.E.EV.I.AEGMTKLAsv........................................psGGAAA.G.AA...A....G..G...A....A.....A..P...A...A...A......A...E....A..A....P.VE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A2H9NWR6_9ARCH/9-104                 ..............................................................llhkagkn-VDEASVKKVLEA......AG.I.A.PD.....DARTK..A.......L.I.A...A.......LE............G.V...NI.E.EA.I.KKAAVV-P............................................VAVAA.P.SA...G....Q..G...A....G.....E..D...K...K...K......A...P....E..K....K.EE..KKEE..................kN..EEQA........AAG.lGALF...............................
W4ZQ59_WHEAT/17-112                    ......................................................................SPSAADVKNILDS......VG.A.E.AD.....EEKLE..F.......L.L.A...E.......LK............G.K...DI.T.EV.I.ASGREKFAavp......................................sggGAIAV.G.AP...A....A..A...S....G.....G..A...A...A...P......A...A....E..S....K.KE..EKVEe.................kE..ESDE........DMG..FSLF...............................
A0A1G4JK94_9SACH/17-105                .....................................................................a-PSAENVKTVLES......VG.I.E.VE.....EDKVS..S.......L.L.S...S.......LE............G.K...SI.E.EL.V.AEGNEKLAa.........................................vpASSGA.A.AP...A....A..G...A....A.....A..G...G...E...A......E...E....A..A....P.EE..EA--...................E..ESDD........DMG..FGLF...............................
A0A0D3B7B5_BRAOL/17-113                ......................................................................SPTSADIKDILGS......VG.A.E.TE.....DAQIE..L.......L.L.K...E.......VK............G.K...DC.A.EL.I.ALGREKLAsvpc....................................ggggVAMAS.A.PS...A....G..G...G....G.....G..A...A...P...A......E...E....A..K....R.EE..KKEE..................kE..ESDD........DMG..FSLF...............................
W5JPX9_ANODA/23-101                    .....................................................................a-VTDEKISTILKA......AG.V.D.IE.....PYWPG..L.......F.A.K...A.......LE............G.I...DV.K.SL.I.TSIGSG--............................................----V.G.SG...A....G..G...A....A.....P..A...A...A...E......K...K....E..E....K.KE..EEP-...................E..ESDD........DMG..FG--...............................
A9P894_POPTR/17-113                    .....................................................................c-PTAEDLKHILGS......VG.A.D.AD.....DDRIE..L.......L.L.S...S.......VK............G.K...DI.T.EL.I.ASGREKLAsvps....................................gggvAVAAG.G.AP...A....A..A...S....G.....G..A...A...P...A......A...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
A0A0D3F5X5_9ORYZ/402-497               ......................................................................NPSAEDLTTILES......VG.A.E.VD.....HGKME..L.......L.L.S...Q.......LA............G.K...DI.T.EI.I.ASGREKFAsvp......................................cggGGVAV.A.AA...A....P..A...A....G.....D..G...A...A...P......Q...S....E..A....K.KE..EKVEe.................kE..ESDD........DMG..FSLF...............................
J9FK46_9SPIT/60-140                    ...................................................................lqg----EKLSKVLKA......SG.N.E.VE.....AYWPA..M.......F.A.K...A.......LQ............G.Q...NI.E.EL.L.SNLA----............................................-SAPV.G.GA...A....V..A...A....V.....D..A...P...A...A......K...V....E..K....V.EE..KKVE...................E..AADV........DMG..-GLF...............................
A0A0D3CLR0_BRAOL/233-320               .....................................................................f-PTLAAAPHMFIN......AY.K.N.AL.....AISVA..T.......E.Y.T...F.......PQ............A.E...KV.K.EF.L.KDPSKFAV............................................AVAAV.S.AD...A....G..G...G....A.....S..A...G...A...A......K...V....E..E....K.KE..VVE-...................E..SDEE........DYG.gFDMF...............................
V4M9T3_EUTSA/209-296                   ......................................................................YPTIAAAPHMFIN......AY.K.N.AL.....AISVA..T.......E.Y.T...F.......PQ............A.E...KV.K.EF.L.KDPSKFAV............................................AVAAV.S.AD...A....S..G...G....A.....G..A...G...A...A......K...V....E..E....K.KQ..EVE-...................E..SDEE........DYG.gFGLF...............................
D7LEE5_ARALL/234-316                   ......................................................................YPTVAAAPHMFLN......AY.K.N.VL.....AVALA..T.......E.Y.S...F.......PQ............A.E...NV.K.EF.L.KDPTKF--............................................-AVAA.A.AP...V....L..G...E....S.....C..G...A...V...V......A...V....A..V....E.EE..AAE-...................-..ESDE........DMG..FDLF...............................
A0A1Y3ACG0_9EURY/16-113                ......................................................................EINEDNVTGVLEA......AG.V.D.VE.....ESRVK..A.......L.V.A...A.......LE............D.V...DI.E.EA.I.ETAAAA--............................................--PAA.G.AS...A....G..G...A....A.....D..A...D...A...A......D...E....A..D....D.DE..EEEAdeaed........adeaddD..----........---..----eedgdggeglgelf.................
F4R3M9_MELLP/229-309                   ......................................................................YPTLASVTHSLVN......SY.K.N.LI.....SIALV..T.......D.Y.M...F.......EG............A.Q...KA.K.DY.L.ENPEAF--............................................AAAAA.P.AA...A....A..A...-....-.....-..-...-...P...A......A...A....E..A....V.KE..AEPE...................E..EEDD........DMG..LDLF...............................
A0A1S3TZJ4_VIGRR/21-111                .....................................................................a-VTADNITTLLKT......AK.V.Q.VE.....SYWPT..L.......F.A.K...L.......AE............K.K...NL.G.DL.I.ANAAGGGApv........................................avAAAPV.A.AA...G....G..G...A....A.....A..A...A...P...A......A...E....E..K....K.KE..EPE-...................E..ESDD........DMG..FGLF...............................
A0A2A2L4J1_9BILA/17-112                .....................................................................a-PTHDDIHKILEG......GG.L.E.YN.....EESAK..R.......V.V.K...L.......LS............G.K...SL.A.DL.I.ADGSKHLVavsg....................................ggggAAAAP.S.AA...A....P..A...A....A.....A..E...A...P...K......D...E....G..K....K.KK..EEAK...................E..ESDD........DMG..FGLF...............................
A0A196SNE7_BLAHN/234-318               ......................................................................YPTLASLPHSINN......AF.R.K.LV.....AIVIAegM.......N.Y.S...F.......EK............A.E...PF.K.AF.L.ADPSAF--............................................AV---.A.AA...P....A..A...A....D.....A..A...A...P...A......A...E....E..K....K.EE..EEE-...................E..EEDV........DMS.gGGLF...............................
A0A179FY22_METCM/229-312               .....................................................................f-PTMPSVMHSVVN......SY.K.N.VL.....AVAVE..T.......D.F.S...W.......PE............I.E...EL.K.DR.I.ANPDAY--............................................AAAAP.A.AA...A....A..S...G....G.....A..A...A...A...P......A...E....E..E....K.KD..ESE-...................E..EDEE........GFG..-GLF...............................
I3EDG3_NEMP3/17-100                    .....................................................................k-PEASEIAKVIEI......AG.G.N.AD.....AAKIQ..A.......L.L.K...S.......FE............G.K...NS.D.EL.I.AQGASM--............................................LQSAA.P.VA...A....A..G...A....S.....S..A...A...A...A......E...T....K..V....V.EE..ESE-...................E..ESSG........DMD.lF---g..............................
A0A182WVR6_ANOQN/231-313               ......................................................................YPTLASVPHSIAN......GF.R.N.LL.....AIAAV..T.......E.V.E...F.......KE............A.E...TV.K.EF.I.KDPSKF--............................................--AAA.T.AT...T....A..S...A....A.....A..P...A...A...K......A...E....E..K....K.VE..SES-...................E..DEDE........DMG..FGLF...............................
RL12_METJA/16-101                      ......................................................................EITEDAIKAVLSA......AG.V.E.VD.....DARVK..A.......L.V.A...G.......LE............G.V...DI.E.EA.I.ANAA-M--............................................PVAAA.P.AA...A....A..P...A....A.....A..A...E...E...K......K...E....E..E....K.KE..EKKE...................E..DTAA........VAG.lAALF...............................
A0A1Y1WDH5_9FUNG/21-106                ......................................................................EITADKLEAITKA......AG.V.S.VE.....PIYFS..L.......F.A.K...A.......FD............G.V...NV.A.DL.L.TNVGSAAA............................................AAPAA.G.GA...A....A..G...G....A.....A..E...E...A...A......E...E....E..K....P.AE..EEE-...................-..ESDD........DMG..FGLF...............................
W9YCK1_9EURO/17-112                    .....................................................................d-PSDSDIKGVLSS......VG.I.D.AD.....EERLS..K.......L.I.S...E.......LK............G.K...DI.S.EL.I.AEGSTKLAsvpt....................................ggagGAAAP.A.AG...G....A..A...A....G.....G..A...A...A...A......A...E....E..E....P.AK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A1E7GB07_9EURY/16-101                .....................................................................a-ITEEAITAVLKA......AG.I.E.VN.....ESRAK..A.......L.V.A...A.......LD............G.V...DI.E.EA.I.SKAA-F--............................................AAPAA.A.AP...A....A..A...A....P.....A..A...A...A...A......P...V....E..E....E.EE..EEDT...................S..EEDG........MAG.lGALF...............................
E7Q766_YEASB/229-311                   ......................................................................YPTLPSVGHTLIN......NY.K.D.LL.....AVAIA..A.......S.Y.H...Y.......PE............I.E...DL.V.DR.I.ENPEKY--............................................-AAAA.P.AA...T....S..A...A....S.....G..D...A...A...P......A...E....E..A....A.AE..EEE-...................-..ESDD........DMG..FGLF...............................
A0A2K5KHQ3_CERAT/17-114                .....................................................................s-PSVKDIKKILDS......VG.I.E.AD.....DDRLN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGIGKLAsvpa....................................ggavAVSAA.P.GS...A....A..P...A....A.....S..S...A...P...A......A...A....E..E....K.KD..EKKEe.................sE..ESDD........DMG..FGLF...............................
A3LPG9_PICST/20-106                    ......................................................................EITSEKLLAITKA......AG.A.D.VE.....AVWAD..V.......Y.A.K...A.......LE............G.K...NL.K.EL.L.FSFAASAP............................................AAGAS.A.GA...A....A..S...S....G.....A..A...A...E...E......A...A....E..E....A.VE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A078JAM1_BRANA/234-317               ......................................................................YPTIAAAPHMFIN......AY.K.N.VL.....AVALA..T.......E.Y.S...F.......PQ............A.E...NV.K.EF.L.KDPSKF--............................................AVAAA.A.AP...V....S..G...E....S.....G..G...A...P...V......A...A....A..V....V.EE..AAE-...................-..ESDG........DMG..FDLF...............................
A0A1V6Y2X6_PENNA/17-108                .....................................................................a-PSTADIKDVLSS......VG.I.D.AE.....GDRLE..K.......V.I.A...E.......LQ............G.K...DL.Q.EL.I.AEGSTKLAsv........................................psGGGAA.A.AP...A....A..A...A....A.....G..G...A...E...A......A...A....E..E....K.KE..EKVE...................E..ESDE........DMG..FGLF...............................
M7ZWX9_TRIUA/13-119                    ..............aewsakqhkgeleasaatpydlqrqlvsaacaedksggvqssftmvspksaifqvv-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.IGGASAGPi.........................................ggGGAAG.G.AA...A....S..G...G....A.....A..A...E...A...P......K...A....E..E....K.KE..EEK-...................E..ESED........DLG..FSLF...............................
A0A0D0AC10_9HOMO/21-111                ......................................................................EITSDKIVSLTSA......AD.I.E.VE.....PIWAT..L.......L.A.K...A.......LE............G.K...DV.R.EL.L.LNVGAGGGap.......................................avgAAPGA.G.GA...A....P..A...A....A.....A..E...E...A...P......K...E....E..E....K.KE..EK--...................E..ESDD........DMG..FGLF...............................
L9KWE4_TUPCH/13-90                     ................................................................alilhd-------------......NA.V.T.LT.....EDKTK..A.......F.I.K...A.......AG............V.N...LI.C.EA.G.AGGPAL--............................................AADAA.P.AE...G....P..A...P....T.....A..A...A...A...P......A...E....V..K....T.VE..AKN-...................E..ESDD........DMG..FGLF...............................
A0A1Y2FGH4_9ASCO/17-109                .....................................................................s-PKAADITALLET......VG.I.E.AD.....DSRIS..A.......L.L.A...E.......VE............G.K...DI.N.EL.I.TEGTSKLGsvp.....................................sggaSSGSA.P.AA...S....A..G...G....A.....A..A...A...E...A......P...A....E..E....K.AE..EK--...................E..ESDD........DMG..FGLF...............................
G0S079_CHATD/17-111                    ......................................................................SPSAADIKAVLES......VG.I.E.AD.....NERLE..K.......L.L.S...E.......LQ............G.K...DI.N.QL.I.AEGSSKLAsvps....................................ggaaVAAAA.G.GA...A....A..G...G....A.....A..A...E...A...P......K...E....E..E....K.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A0A1N974_9FUNG/20-106                ......................................................................EITADKLQTLVSA......AG.V.E.VE.....PIWFS..L.......Y.A.K...A.......LA............G.Q...DL.K.AL.L.MNVGAPGA...........................................gPA-VA.G.AA...A....A..G...G....A.....A..D...A...A...P......A...E....E..E....K.KE..EEK-...................E..ESDD........DMG..FGLF...............................
L5KN85_PTEAL/17-114                    ......................................................................SPSAKDIKKILDS......VG.I.E.AD.....DDRLN..K.......V.I.S...E.......LS............G.K...NI.E.DV.I.AQGIGKLArvpa....................................ggavAVTAA.P.GS...A....A..P...A....A.....G..S...A...P...A......A...A....E..E....K.KD..EKKEe.................sE..ESDD........DMG..FGLF...............................
A0A1D6FPC0_MAIZE/40-121                ......................................................................SPTADDVKSILES......VG.A.E.AD.....EEKLE..F.......L.L.T...E.......LK............D.K...DI.T.EV.I.AAGRERLSsvp......................................sggGAIDM.G.AP...A....A..V...A....G.....G..G...A...A...P......A...E....E..A....K.KE..EK--...................-..----........---..----nl.............................
A0A1J6IH17_NICAT/22-111                .....................................................................p-INAEKIGTLIKA......AN.L.K.VE.....SYWPS..L.......F.A.K...L.......CQ............K.M...NV.D.EL.V.MNVGVGGTa..........................................aATAAA.P.AP...T....T..G...Q....D.....A..A...A...A...P......S...A....N..D....K.KK..EEVK...................E..ESDD........ELM..FSLF...............................
R0FYN6_9BRAS/17-113                    ......................................................................SPTSGDIKTILGS......VG.A.E.TE.....DSQIE..L.......L.L.K...E.......VK............G.K...DL.A.EL.I.AAGREKLAsvps....................................ggggVAMAS.A.PS...A....G..G...G....G.....G..G...A...P...A......A...E....S..K....K.EE..KKEE..................kE..ESDD........DMG..FSLF...............................
RLA03_ARATH/233-320                    ......................................................................YPTLAAAPHMFIN......AY.K.N.AL.....AIAVA..T.......D.Y.T...F.......PQ............A.E...KV.K.EF.L.KDPSKFV-............................................-VAAA.A.VS...A....D..A...G....G.....G..S...A...Q...A......G...A....A..A....K.VE..EKKEe.................sD..EEDY........EGG..FGLF...............................
L5KF91_PTEAL/141-216                   .....................................................................n-PAVASVPHLIIS......GY.K.R.VL.....VLSVE..T.......D.Y.T...F.......PL............P.K...KV.K.AF.L.ADPSAFVA............................................AAPEA.A.AT...T....A..A...P....A.....A..A...A...A...T......A...E....V..E....A.KE..ELE-...................-..----........---..----e..............................
A0A1A8VZC5_PLAMA/32-118                .....................................................................s-ITSENIVKLIKK......SN.N.T.VL.....PYLPM..L.......F.E.K...T.......LK............G.K...DI.E.GL.L.SNLSIGG-............................................GAPSS.G.TQ...A....T..A...D....K.....P..S...E...D...K......K...E....S..K....K.EE..KVEE...................E..EEED........DLG..FSLF...............................
A0A1E4TFQ6_9ASCO/20-108                ......................................................................EITADKLQTLIRT......AG.IeS.VE.....PIWTQ..L.......F.A.K...A.......LE............G.K...DI.K.EL.L.FNVGSAAP............................................AAGAA.A.GG...A....A..A...A....G.....G..A...A...S...E......D...A....P..A....E.EK..EEEK...................E..ESDD........DMG..FGLF...............................
D8LP25_ECTSI/194-276                   .....................................................................f-PTLASLPHSIAN......AF.R.A.LV.....GVVIE..Gc.....dT.Y.S...F.......DQ............A.D...TI.K.AI.L.ADPSAF--............................................-----.A.AS...S....G..G...G....G.....G..G...D...A...P......A...A....A..A....P.VE..EEE-...................-..EEEI........DMG..GGM-smf............................
A0A2I3FRW1_NOMLE/161-230               .................................................................adwls-------------......--.-.N.FL.....ALSVE..M.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAF--............................................--VAA.A.TT...A....A..P...A....V.....A..A...A...P...A......K...V....E..A....K.EE..SE--...................-..ESNK........DMG..FGLF...............................
A0A166DPC9_9EURY/16-100                .....................................................................d-INEANVKSIIEA......AG.L.D.AD.....DSRIK..A.......L.I.A...A.......LE............D.V...DI.E.EA.I.ATSA----............................................-IAAA.P.AA...A....P..A...A....A.....E..A...V...V...E......E...E....E..P....E.EE..EEEE..................aS..EEEA........AAG.lGALF...............................
I1C401_RHIO9/20-105                    ......................................................................EISADKLQTLVAA......AG.I.E.VE.....PIWFS..L.......Y.A.K...A.......LE............G.Q...DL.K.AL.L.LNVGAPGA............................................GA-AA.P.AG...A....A..G...A....A.....A..T...S...D...A......P...A....E..E....A.KE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A0D2VSS8_GOSRA/186-272               ......................................................................YPTLAAAPHMFIN......GY.K.N.IL.....AVAVA..T.......E.Y.S...F.......PQ............A.D...KV.K.EY.L.ADPSKFAV............................................AAAPV.A.AA...G....G..G...A....A.....P..A...A...A...P......A...E....E..E....K.KP..EPE-...................E..ESDD........DMG..FSLF...............................
A0A1Y1YV42_9FUNG/20-105                ......................................................................EITADKLTALTKA......AG.V.E.VE.....PVWAS..L.......F.A.K...A.......LA............G.K...NL.G.DL.L.MNVGSA--............................................GAAPA.A.AG...G....A..A...A....A.....G..A...A...D...A......A...P....A..E....E.VK..EEAK...................E..ESDD........DMG..FGLF...............................
D7FZX8_ECTSI/66-150                    ....................................................................vl--TAENISAVVAA......TK.N.E.VP.....AYYPT..L.......F.A.A...M.......LE............K.S...EG.C.AM.F.CKMSAG--............................................-GGGG.G.GG...G....G..G...G....G.....A..A...A...P...A......A...E....E..K....K.VE..EEE-...................-..EEEI........DMG..GGM-dmf............................
A0A0L0N2X0_9HYPO/21-97                 ......................................................................EITADKLQTLIKA......AN.IqD.VE.....PIWTS..I.......F.A.K...A.......LE............G.K...DI.K.DL.L.VNVGSG--............................................GGAAA.P.AA...S....G..A...A....A.....A..G...G...D...A......D...A....L..A....A.EE..KEE-...................-..----........---..----gal............................
M0C479_9EURY/30-119                    ......................................................................EITEESVTDVLEA......AG.V.D.SE.....ESRVK..A.......L.V.A...A.......LE............D.V...DI.E.DA.I.AEGAIG-A............................................PAPAA.P.AA...E....A..D...E....A.....E..E...E...A...E......A...P....E..E....E.AE..EPEE...................E..EEEDv......sGEG.lGELF...............................
A0A147K0F9_9EURY/16-99                 .....................................................................k-VDEDGILNVLRA......AG.A.Q.VD.....EARVK..A.......L.V.S...A.......LE............G.I...NI.D.EA.I.KGAA----............................................-IPMA.A.TP...A....P..A...A....P.....K..A...E...E...K......K...K....E..E....K.KV..EEKK...................E..EEEA........LAG.lGALF...............................
A0A1U7Z0P0_NELNU/17-113                .....................................................................a-PSADDLKDILGS......VG.A.E.AD.....DDRIE..L.......L.L.S...E.......VK............G.K...DI.T.EL.I.ASGREKLAsvp.....................................sgggAAIAV.A.AG...G....G..V...A....A.....A..A...A...P...A......A...A....E..P....K.KE..EKVEe.................kE..ESDD........DMG..FSLF...............................
G9MJN9_HYPVG/21-107                    ......................................................................EITADKLQTLIAA......AK.V.E.VE.....PIWTS..I.......F.A.K...A.......LE............G.K...EI.K.DL.L.VNVGSGGG............................................AAAAA.P.GA...A....A..A...A....G.....G..A...A...E...A......A...V....E..E....E.KV..EEK-...................E..ESDE........DMG..FGLF...............................
A0A0M9G6H9_9TRYP/16-106                .....................................................................a-PSKKDVEAVLKA......AG.V.S.VD.....SSRVD..A.......V.F.A...E.......LE............G.K...NL.E.EV.M.AEGRSKLVgs........................................gsAAPAA.G.GA...A....A..P...A....A.....G..G...A...A...A......A...A....D..A....K.KD..EPE-...................E..EADD........DMG..FGLF...............................
W7JSZ3_PLAFO/231-315                   .....................................................................v-ITEASYPHVFVE......AF.K.N.IV.....ALIID..S.......D.Y.T...F.......PL............M.E...NI.K.KM.V.ENPEAF--............................................AAVAA.P.AS...A....A..K...A....D.....E..P...K...K...E......E...A....K..K....V.EE..EEE-...................E..EEDG........FMG..FGMF...............................
N1JC20_BLUG1/21-109                    ......................................................................EITADKLQTLIKA......AG.IvD.VE.....PIWSS..L.......F.A.K...A.......LE............G.K...DV.K.EL.L.LNVGSGG-............................................GAAAA.P.TS...G....G..V...S....A.....G..A...A...V...E......E...D....K..K....E.EE..KEEE..................kE..ESDE........DMG..FGLF...............................
A0A0H1B6I4_9EURO/17-71                 ......................................................................SPSAEDIKSVLSA......VG.I.D.SD.....DERLE..K.......L.L.A...E.......LK............G.K...DL.S.EL.I.AEGSAKLA............................................SVPSG.G.A-...-....-..-...-....-.....-..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----a..............................
L9VME7_9EURY/16-113                    .....................................................................e-LNEDNLTNVLDA......AG.V.D.VE.....ESRVK..A.......L.V.A...A.......LE............D.V...DI.D.EA.V.SEAAVA--............................................PAAGA.A.AG...G....A..A...A....G.....E..A...A...G...D......D...E....D..E....E.VE..ETSDvpdt...........tdddE..DEDD........DAG.gE---glgelf.........................
S7QDW7_MYOBR/36-121                    ......................................................................YPTIASVPHSIIN......GY.K.R.VL.....ALSVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAF--............................................VAAAP.V.AA...A....T..T...A....A.....P..A...A...P...A......A...P....A..K....V.EA..KEES...................E..ESDE........DMG..FGLF...............................
A0A1S4B492_TOBAC/22-114                .....................................................................p-INAEKICTLIKA......AN.L.K.VE.....SYWPS..L.......F.A.K...L.......CQ............K.M...NV.D.EL.V.MNVGVGGTaa.......................................staAVAAA.P.TP...T....T..G...H....D.....A..V...A...A...P......S...A....S..D....K.KK..EEVK...................E..ESDD........ELM..FSLF...............................
A9P8R9_POPTR/21-109                    .....................................................................a-ITAEKIAELVKA......AN.V.Q.IE.....SFWPS..L.......F.A.K...L.......LE............K.R...NI.E.DL.I.LNVGSGGG............................................AAVAV.A.AP...A....G..G...A....P.....A..A...A...A...P......V...V....E..E....K.KK..EEVK...................E..ESED.......eDMG..FSLF...............................
G0W5B5_NAUDC/16-105                    .....................................................................t-PNADNVKAVLSS......VG.I.D.IE.....EDKVS..S.......L.I.S...S.......LE............G.K...SV.D.EL.I.VAGNEKLAa.........................................vpAAGPA.S.GS...A....P..A...A....G.....A..S...G...D...A......T...E....E..A....K.EE..EEE-...................E..ESDA........DMG..FGLF...............................
A0A0B7NHQ5_9FUNG/17-102                .....................................................................d-PTAADVKALMAS......VG.V.E.AE.....EERLN..S.......L.I.S...A.......LE............G.K...NV.D.EL.T.AEGLEKMAsv.......................................ptgGAAAA.V.GG...A....S..A...A....A.....S..S...D...A...P......A...A....E..Q....A.AE..EK--...................E..ESDD........---..----vs.............................
E9DE71_COCPS/229-311                   .....................................................................f-PTLPSVMHSLVN......GY.K.K.AL.....AIAVE..T.......D.Y.S...W.......SE............I.E...EL.K.DR.I.ANPDAY--............................................AVAAP.T.GP...A....E..T...K....G.....E..E...K...A...A......A...K....E..-....-.-E..EEE-...................E..ESEE........DGG.fGGLF...............................
A0A1V8UUC9_9PEZI/17-112                ......................................................................SPSASDIKEVLSS......VG.I.E.AE.....EERLN..S.......L.L.S...E.......LE............G.K...DI.N.EL.I.QEGSQKLAsvps....................................ggagGAPAA.G.GA...G....A..A...A....G.....G..E...A...A...A......E...E....A..P....A.AK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A0L0V2H7_9BASI/17-112                ......................................................................SPSAEDVKGLLSS......VG.V.D.AE.....EERLE..K.......L.I.S...E.......LK............G.K...SI.A.DL.I.AEGSTKLAsvpsg..................................gggggGGAAA.P.AA...A....G..G...A....A.....A..A...E...A...P......K...E....E..A....K.AE..EKE-...................-..ESDD........DMG..FGLF...............................
G3QN05_GORGO/18-88                     ...................................................................dde-------------......--.-.-.--.....-----..V.......T.V.T...A.......LA............N.V...NI.G.SL.I.CNVGAGGPa..........................................pAAGAA.P.AG...G....P..A...P....S.....T..A...A...A...P......A...E....E..K....K.VE..AKKEe.................sE..ESDD........DMG..FGLF...............................
A0A0A2IJH7_PENEN/229-311               ......................................................................YPTLPSVIHSLIN......GY.K.K.VL.....AAAIS..T.......D.Y.S...W.......AE............I.E...DL.K.DR.I.ANPDAY--............................................AS-AA.P.VA...A....A..A...T....S.....G..G...D...A...P......A...A....A..A....P.AE..DEE-...................-..ESDE........DMG..FGLF...............................
A0A1B8C4V5_9PEZI/229-311               .....................................................................f-PTLPSVMHSVVN......SY.K.N.VL.....AVAVS..T.......E.Y.S...W.......TE............I.E...DL.K.ER.I.ANPEKF--............................................--ASA.A.VA...T....T..S...D....A.....P..A...A...A...A......A...E....E..K....K.EE..SEA-...................-..EESG........DEG.fGGLF...............................
A0A0B2UJS3_9MICR/16-102                .....................................................................d-VDAKSLEMLFRS......ID.A.P.IE.....SETLD..L.......F.L.S...K.......VS............G.K...SM.D.EL.M.ASGSELMKs..........................................fAVSSA.P.AS...A....K..A...E....E.....K..K...D...A...P......A...-....-..A....A.AT..QEQ-...................-..DDDA........DFD.iF---gaf............................
Q7S796_NEUCR/21-108                    ......................................................................EITADKIQTIIKA......AK.IeD.VE.....PIWAS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.SNVGSGGA............................................AAAPA.A.AG...A....A..A...A....G.....G..A...A...E...E......A...K....A..E....E.KV..EEK-...................E..ESDE........DMG..FGLF...............................
A0A085MBM8_9BILA/17-112                .....................................................................k-PDVSAIKKILDS......VG.I.D.CD.....DKKAE..M.......V.V.E...A.......CS............G.H...KV.D.DL.I.HEGLKKLAsvps....................................ghaaPAAAA.P.VS...A....A..P...P....A.....A..E...K...E...A......A...P....K..A....P.AK..KEES...................E..EEDE........DMG..FSLF...............................
A0A1G4AWP6_9PEZI/17-110                ......................................................................SPSAKDVKAVLES......VG.I.E.AD.....DERLN..K.......L.I.S...E.......LE............G.K...DI.N.EL.I.AEGSSKLAsvp......................................sggAGGAA.A.AS...G....G..A...A....A.....G..G...A...A...E......D...A....P..K....E.EK..EEEK...................E..ESDE........DMG..FGLF...............................
Q5CRL2_CRYPI/32-121                    .....................................................................p-VTSENIKKIISA......AG.G.S.VE.....PYFPG..L.......F.A.Q...A.......LS............T.T...NV.S.DI.V.AGCGAASVa.........................................vpVAGGA.G.AG...A....A..Q...D....S.....G..A...S...A...A......A...D....D..K....K.KK..EEE-...................E..EEEG........DLG..FSLF...............................
M7TCF8_9EURY/16-100                    .....................................................................k-ITEENVKKVLTA......AG.A.K.PD.....TARIK..A.......L.V.A...S.......LD............G.V...NI.E.EA.I.KTAAVP--............................................-VVAA.A.AP...V....Q..A...A....E.....A..P...A...E...E......K...K....E..E....K.KK..EEV-...................S..EEEA........AAG.lSALF...............................
A0A100IL88_ASPNG/17-109                .....................................................................t-PSAEDIKSVLSA......VG.I.D.AE.....EERLQ..K.......L.L.A...E.......LE............G.K...DL.Q.EL.I.SEGSQKLAsv.......................................psgGAGGA.A.AA...A....P..A...A....G.....G..A...A...A...E......A...P....A..E....E.KK..EEAA...................E..ESDE........DMG..FGLF...............................
A0A1L9TCF4_9EURO/229-311               ......................................................................YPTIPSVIHSLVN......GY.K.K.AL.....AVAVE..T.......E.Y.S...W.......PE............I.E...EL.K.DR.I.ANPDAY--............................................-ASAA.P.AA...A....A..A...G....G.....A..A...P...A...A......A...E....A..A....P.AE..EA--...................D..ESDE........DMG..FGLF...............................
A0A0L0SVI2_ALLMA/21-74                 .....................................................................a-ITADNLSALTAA......AG.I.E.VE.....AIWAK..I.......F.A.Q...A.......LA............S.T...DV.M.GL.L.SKIGSGTS............................................-----.-.--...-....-..-...-....-.....-..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----ssrnstv........................
C5M7W4_CANTT/17-109                    ......................................................................SPSASDISALLEQ......VG.A.E.VE.....SSKLD..L.......L.L.K...E.......LE............G.K...DL.Q.EL.I.AEGNTKFAsvp......................................sggAAAAS.S.GS...A....A..A...A....G.....G..A...A...A...E......A...E....E..E....K.EE..EAK-...................E..ESDD........DMG..FGLF...............................
A0A218V367_9PASE/231-317               ......................................................................YPTIASVPHSIIN......GY.K.R.VL.....AVAVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFVA............................................AMPVV.A.EA...A....A..P...A....A.....A..A...A...A...A......P...A....K..E....A.VK..EES-...................E..ESDE........DMG..FGLF...............................
D7M357_ARALL/20-84                     ...................................................................iei------------T......AN.V.N.VE.....SYWPS..L.......F.A.K...L.......CE............K.K...NI.D.DL.I.MNVGAGGCgc.......................................gslGPDTA.S.AP...A....V..S...Q....S.....A..S...S...P...P......R...E....E..E....-.--..----...................-..----........---..----...............................
L8HHW3_ACACA/30-120                    .....................................................................n-VTGDKLAQVVKA......AN.V.D.VP.....PFYVK..L.......Y.A.R...V.......LA............N.R...NL.D.DL.L.FQTVAVAPsa.......................................apaAGAAA.P.AE...A....A..A...A....G.....G..D...K...P...A......G...K....P..A....K.VE..EEE-...................E..AEDM........DAG..-GLF...............................
J3KX68_ORYBR/175-270                   ......................................................................NPTAEDLTAILES......VG.C.E.ID.....SEKME..L.......L.L.S...Q.......VS............G.R...DI.T.EL.I.ASGREKFAsvp.....................................sgggAAVAV.A.AP...A....S..G...G....A.....G..G...A...P...A......A...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
A0A0A1NW39_9FUNG/17-107                ......................................................................NPSNEDIKKLLAS......VG.I.E.TD.....AARLD..A.......L.L.K...S.......LE............G.K...TI.A.EV.I.AEGTPKLAsi.......................................savPVAAA.G.AA...A....A..G...G....A.....A..A...E...E...A......P...A....E..E....K.AE..EK--...................E..ESDE........DMG..FGLF...............................
V6TW26_GIAIN/17-107                    .....................................................................e-PVVGDIEKIIAA......VG.G.T.TD.....ADLAK..T.......V.V.E...K.......VGs..........gG.L...SI.E.DL.M.ALGKKRMAs.........................................mpAVGAA.P.AA...A....P..V...A....A.....A..A...D...T...A......A...P....A..A....K.KE..ES--...................-..DDDE........IVG.aGGMF...............................
U6GIL0_EIMAC/19-112                    .....................................................................a-PTAKDVSKTIQA......VG.G.D.VD.....EEVLS..A.......L.I.N...A.......MQ............G.K...TA.H.EV.I.AAGMEKLQkvp.....................................tggvAAAAP.A.AA...A....A..P...A....A.....G..G...G...A...A......A...K....E..Q....K.KE..EPE-...................E..EEDG........DMG..LSLF...............................
A0A1C7N3E0_9FUNG/17-108                .....................................................................h-PTADDLKKVMGS......VG.V.E.VD.....ESRVS..A.......L.L.K...A.......ME............G.K...TA.A.EA.I.AEGSSKLAsvs......................................agpVAAAG.G.AA...A....A..G...A....A.....G..A...D...A...P......A...E....E..A....K.AE..EK--...................E..ESDD........DMG..FGLF...............................
J4CCW5_THEOR/19-109                    ......................................................................SPSKSDVKEVLSS......VG.S.E.VD.....EDALD..A.......F.F.A...A.......VS............G.K...SV.H.ET.I.TAGLEKLQkv........................................paGGVVV.A.SS...T....S..Q...A....A.....A..S...S...A...K......Q...E....E..A....K.KE..EEP-...................E..EEED........DMG..FSLF...............................
A0A1Q6DTC4_9EURY/16-99                 .....................................................................d-ITEESVKNVLDS......AG.V.E.VD.....ESRVK..A.......L.I.S...A.......LD............G.V...DI.E.EA.I.ESAE----............................................-IAPT.T.AP...A....T..E...T....A.....E..E...E...E...E......E...E....E..E....E.EE..TGEE...................E..EEAA........AEG.lGALF...............................
Q5B161_EMENI/21-108                    ......................................................................EITADKLQTLLTA......AK.VqE.VE.....PIWTS..I.......F.A.K...A.......LE............G.K...DI.K.DL.L.TNVGSAGA............................................AAPAG.G.AA...P....A..A...G....G.....D..A...A...A...P......A...A....E..E....K.KE..EEK-...................E..ESDE........DMG..FGLF...............................
C5DQ37_ZYGRC/20-107                    ......................................................................EISSDKLLTLTSA......AN.V.P.VE.....AIWGD..I.......Y.S.K...A.......LE............G.Q...DL.K.EL.L.VNFSVGPA............................................AAGGA.A.AA...G....G..A...A....A.....A..E...G...A...E......A...A....E..E....K.KE..EEAK...................E..ESDD........DMG..FGLF...............................
A0A061HIZ5_BLUGR/17-109                ......................................................................SPSESDIKNVLGS......IG.I.E.AD.....SERLT..K.......I.I.S...E.......LK............D.K...DI.N.EL.I.AEGSAKLAsvp......................................sggAGSAV.A.AT...G....A..V...S....G.....D..A...A...P...E......A...K....E..E....E.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A1I8CDQ7_9BILA/17-107                .....................................................................a-PSSKNVEDILGS......VG.A.S.VD.....AAALK..K.......V.L.A...S.......LE............G.K...NV.A.EL.I.VEGSKKLAs.........................................vpSGGAA.P.SA...A....A..A...P....S.....A..A...A...A...A......P...A....A..A....K.KE..EKKE...................E..SEDE........DMG..FGLF...............................
A0A0E0F294_9ORYZ/228-313               ......................................................................YPTIAAAPHMFLN......GY.K.N.VL.....AVAVE..T.......E.Y.S...Y.......PH............A.D...KI.E.EY.L.KDPSKF--............................................AVAAA.V.AA...A....D..S...G....A.....A..A...P...A...A......S...K....E..E....E.KK..EEPE...................E..ESDG........---..----asymvgr........................
A0A1E4RRL4_9ASCO/229-310               ......................................................................YPTLPSVGHSVVN......HY.K.N.VL.....ALSIA..T.......D.Y.T...F.......EG............S.E...AI.K.DR.L.ANPEAY--............................................--AAA.A.PA...A....A..A...A....G.....S..S...D...A...A......A...E....A..A....P.AE..EAE-...................-..ESDD........DMG..FGLF...............................
H9B912_EIMTE/32-121                    ......................................................................EISAENIEKLVSA......AG.A.S.VE.....SYMPG..L.......F.A.R...A.......LK............G.H...NI.T.DL.L.AGAGTVAAa..........................................pAAAPA.A.AP...A....A..A...A....D.....N..A...A...D...K......G...G....K..P....A.KQ..EEPE...................E..EEDA........DMG..FSLF...............................
A0A151GML1_9HYPO/229-311               .....................................................................f-PTLPSVMHSLVN......SY.K.N.LL.....AVAVE..T.......E.I.T...W.......PE............I.E...QL.K.DR.I.ANPDAY--............................................AS-AA.P.VA...A....A..T...S....G.....G..A...A...E...A......K...P....K..E....E.EK..EE--...................-..EEED........DEG..FG--gll............................
A0A178AEL0_9PLEO/23-114                .....................................................................s-ITPEKLQAILKA......AG.IeD.VE.....PIWTT..L.......F.A.K...A.......LE............G.K...DV.K.DI.L.TKVAAGPA............................................VGEAA.T.AS...K....P..N...E....K.....G..D...E...V...A......D...G....G..Q....G.EK..GGEDa.................dD.gSDED........DLG..LGLF...............................
A0A0M3I7Q6_ASCLU/17-116                .....................................................................h-VTTADIENILGS......VG.V.D.CD.....HDKAS..K.......V.V.D...S.......MH............G.K...SV.D.EL.I.AQGSQYLCsvggtg................................ggiaapVAAGA.P.AG...G....A..P...A....A.....G..A...A...E...P......E...K....K..E....E.KK..EEKE...................E..ESDE........DMG..FGLF...............................
A0A0Q3MBG8_AMAAE/78-175                ......................................................................SPTSKDLKKILDS......VG.I.E.TD.....DERMN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGNGKLAsmpa....................................ggavAVSAG.G.GS...A....A..P...A....A.....A..A...A...P...A......A...P....E..E....K.KE..EKKEe.................sE..ESDD........DMG..FGLF...............................
A0A0D2MTN5_9CHLO/21-105                .....................................................................d-ITADAITSIVKA......AG.I.E.VE.....PYWPA..L.......F.A.K...L.......FA............N.K...SI.G.DL.I.TNVGAGG-............................................GAPAA.A.AP...A....A..G...G....A.....A..P...E...A...K......K...A....E..A....K.KE..EPS-...................-..EEDE........DMG..FSLF...............................
D8S0E7_SELML/33-119                    ...................................elqkqmrdlalqsagagavsvdfalitpsagvlqv-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.I.VGGGAGGAa.........................................faSGGGA.P.AA...G....G..A...A....A.....A..A...P...A...P......A...E....E..E....K.KE..EKEA...................-..SEDE........DMG..FSLF...............................
A0A1I8IGI2_9PLAT/24-113                ......................................................................EVTGDKISAILKA......AG.V.T.VE.....PFWPN..M.......F.A.R...A.......LS............G.V...KV.K.DL.L.SNVGSSVGa.........................................apAAGAA.A.PE...A....A..A...A....A.....A..E...P...A...A......A...K....G..K....A.KE..PEPE...................S..ESDD........DMG..FDL-...............................
A0A0C9MD30_9FUNG/17-106                ......................................................................SPSAEDIKSLLTT......VG.V.E.VD.....ESRVS..A.......L.I.K...A.......ME............G.K...TA.A.EA.I.AEGSTKLAs.........................................vsSGPVS.A.SA...G....G..A...A....A.....A..S...G...D...A......P...A....E..E....A.KE..EEK-...................E..ESDD........DMG..FGLF...............................
G2YND2_BOTF4/17-110                    ......................................................................SPSAKDITTVLES......VG.I.E.ID.....QERLD..T.......L.I.K...E.......LD............G.K...DI.N.EL.I.AEGSSKLAsv.......................................psgGAGAA.P.AA...G....G..A...A....A.....A..G...G...A...A......A...E....E..K....V.EE..KAEE..................kE..ESDE........DMG..FGLF...............................
R1BXG8_EMIHU/66-128                    ....................................................mvtpkvslftacigtamv-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.-------Vag........................................ggGGGGG.G.GG...G....G..G...G....G.....A..A...A...P...A......A...E....A..K....A.PE..PEP-...................E..EEEE........EMG..FDLF...............................
A0A1U7ZST4_NELNU/234-318               ...................................................................ypm---LAAAPHMFVN......AY.K.N.VL.....AVAVA..T.......D.Y.S...F.......PQ............A.E...KV.K.EY.L.KDPSKF--............................................AVTAA.P.VV...A....A..E...S....A.....A..P...A...S...A......K...E....E..E....K.KE..EPA-...................E..ESDE........DMG..FSLF...............................
B0CUH7_LACBS/17-111                    .....................................................................d-PSAADIKKLLGV......AG.V.E.AD.....ESRLE..T.......L.I.S...E.......LK............G.K...SI.A.DL.I.AEGSSKLAsvp.....................................sgggGGAVA.A.AP...A....A..G...G....A.....A..A...A...P...A......A...E....E..K....K.PE..KEEE...................K..ESDD........DMG..FGLF...............................
A0A1D6FKZ1_MAIZE/25-119                ......................................................................SPSADDLTAILES......VG.C.E.VD.....NEKME..L.......L.L.S...Q.......LS............G.K...DI.T.EL.I.AAGREKFAsvp......................................cggGGVAV.A.AA...A....P..A...A....G.....G..A...A...S...A......A...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
A0A067NRR6_PLEOS/17-111                ......................................................................SPSAADITKLLGA......VG.I.D.AD.....EDRLS..K.......L.L.S...E.......LE............G.K...DV.A.SL.I.AEGSSKLAsvps....................................ggggGAAAA.P.AA...G....G..A...A....A.....A..A...D...A...P......K...E....E..E....K.KE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A1J9REG0_9PEZI/229-312               ......................................................................YPTLPSVMHSVVN......GY.K.K.VL.....SVAVE..T.......D.Y.S...W.......EA............I.E...EL.K.DR.I.ANPDKY--............................................AS-AA.P.AA...A....A..G...G....A.....A..A...P...A...A......A...A....E..E....K.KE..EPE-...................E..SEDE........DMG..FGLF...............................
A0A0P7BLS0_9HYPO/229-311               .....................................................................f-PTLPSVMHSVVN......SY.K.N.VL.....AVAVA..T.......E.V.S...W.......PE............I.E...QL.K.DR.I.ANPDAY--............................................AS---.A.AP...T....A..S...A....G.....G..A...D...A...A......A...E....E..K....E.EE..KEEE...................E..DSDE.......sGFG..-GLF...............................
C5KMM7_PERM5/17-108                    ......................................................................EPTVEEVKHILSA......VD.A.E.VD.....DEMLA..K.......F.F.A...Q.......VQ............G.K...NV.Q.EM.I.VTGLSKLGsva......................................ssgARPAA.A.AG...A....V..A...G....D.....E..A...A...A...A......E...E....E..A....K.PV..EE--...................E..EEEE........EMD..FDLF...............................
A0A1E3QGY1_9ASCO/20-105                ......................................................................EISSEKLNTLVVA......AG.V.E.IE.....SIWAD..L.......F.A.K...A.......LD............G.K...NL.K.DY.F.FNIQAGS-............................................ASGAA.A.SG...A....V..A...A....S.....G..S...A...E...A......A...A....E..E....V.AE..EAK-...................E..ESDD........DMG..FGLF...............................
A0A0R3T310_HYMNN/22-117                .....................................................................d-VTADRLNTILKA......AN.C.NfVE.....GYLCS..L.......F.A.S...A.......LN............G.V...NV.K.DI.I.AASSSCAVaaa......................................patAPAPA.P.AA...G....G..A...P....A.....G..G...A...A...P......V...P....E..K....K.EE..KKEE..................sE..SEDE........DMG..FDLF...............................
A0A0C7N2Z3_9SACH/19-105                .....................................................................d-ITADSLTTLTKA......AG.A.S.VD.....NVWAE..T.......F.A.K...A.......LE............G.K...NI.K.EI.L.SGFHAAGS............................................GPAAT.G.GA...A....S..A...A....A.....G..G...E...A...A......A...E....E..D....A.PE..EAA-...................E..ESDD........DMG..FGLF...............................
A0A0D7B7R6_9AGAR/20-107                ......................................................................EITSEKIVSITSA......AG.V.E.LE.....PIWAS..L.......L.A.K...A.......LE............G.K...NV.K.DL.L.SNVGSGGG...........................................aAAAAA.P.AA...G....G..A...A....A.....A..A...D...A...P......K...E....E..E....K.KE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A087S8N5_9ARCH/16-104                ......................................................................EVNEANVSSVVKA......SG.A.E.VN.....EAQVK..A.......L.V.A...A.......LA............D.V...NI.D.EA.V.KAAPVAVA...........................................aAAAPA.A.EG...G....D..A...A....A.....G..G...E...A...K......K...E....E..K....P.KE..EGK-...................T..EEAA........MEG.lSSLF...............................
W5MX37_LEPOC/17-113                    ......................................................................NPTSKDIKNILQS......VG.I.E.AD.....DERLS..K.......V.I.S...E.......LN............G.K...DV.N.EV.M.NAGLSKLAsvpa....................................ggavAAAPA.A.AA...A....G..G...A....P.....G..A...A...P...V......A...E....E..K....K.EE..KKEE..................sE..ESDE........DMG..FGLF...............................
H2AWZ4_KAZAF/20-106                    ......................................................................EITSEKLLTLTNA......AN.I.P.IE.....GIWAD..I.......F.A.K...A.......LE............G.Q...DL.K.AL.L.VNFSAGT-............................................AAPAA.A.GA...A....A..G...A....S.....G..A...A...A...G......E...A....A..E....E.KE..EEAK...................E..ESDE........DMG..FGLF...............................
K3ZAW7_SETIT/17-111                    ......................................................................SPTADDVKSILES......VG.A.E.TD.....EEKLD..F.......L.L.T...E.......LK............D.K...DI.T.EV.I.AAGREKFAsvp......................................sggGAIAM.G.AP...V....A..A...A....G.....G..A...A...P...A......E...E....E..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
A0A0F2M121_SPOSC/229-311               .....................................................................f-PTLPSVLHSLVN......SY.K.N.VL.....AIAIE..T.......E.I.S...W.......PE............I.E...QL.K.DR.I.ANPEAY--............................................-AAAA.P.VA...A....A..E...E....T.....K..A...E...A...A......A...E....E..K....E.EE..AE--...................-..ESDS........DGG..FG--gll............................
A0A0D9ZZX9_9ORYZ/17-112                ......................................................................SPSADDIKNILES......VG.V.E.AN.....DERLE..F.......L.L.S...E.......LE............G.K...DI.T.EV.I.AAGREKFAsvp.....................................sgggGGIAV.A.AP...T....A..A...G....G.....G..A...A...P...A......E...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
A0A137PF35_CONC2/17-108                ....................................................................aa--SAEDIKTLLTS......VG.V.E.VE.....EERLT..A.......L.L.A...Q.......TE............G.K...DL.N.EL.V.AAGASKLAsvp......................................sggAAAGA.A.SS...G....A..A...A....G.....G..A...A...E...A......A...A....A..A....P.AE..EEE-...................-..EEDD........DMG..FGLF...............................
S7MGA9_MYOBR/17-114                    ......................................................................SPSAKDIKKILDS......VG.I.E.AD.....DDRLN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGIGKLAsvpa....................................ggavAVSAA.P.GS...A....A..P...A....A.....G..S...A...P...A......A...A....E..E....K.KD..EKKEe.................sE..ESDD........DMG..FGLF...............................
A0A166C8D7_DAUCA/86-182                .....................................................................c-PTAEDLKNILGS......VG.A.D.AD.....DDRIE..L.......L.L.S...E.......VK............G.K...DI.T.EL.I.ASGREKLAsvps....................................ggggVAVAA.A.AS...G....G..A...G....G.....A..A...A...P...A......A...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
A0A183KFV1_9TREM/17-112                .....................................................................k-PTENDIKTVLNS......VG.I.E.HD.....SERLE..K.......L.L.S...S.......IS............G.K...DI.P.QL.I.AEGSTKLSsip.....................................ssgaVVSSA.P.AA...A....A..S...S....K.....T..E...A...P...Q......E...V....K..P....A.KV..EVKE...................E.sESDE........DMG..FGLF...............................
A0A1U7LWC9_9ASCO/21-108                .....................................................................p-INHENLQTLVKA......AN.V.E.VE.....TIWIS..L.......F.V.K...A.......LE............G.K...DV.K.QL.L.SSIGSGGA............................................AAPAA.G.EA...A....A..S...S....A.....Q..E...P...Q...E......K...K....E..A....E.KK..KEEE...................E..ESDE........DVS..----lsml...........................
F6VQ14_HORSE/22-113                    .....................................................................t-VTEDKINALIKA......AG.V.N.VE.....PFWPG..L.......F.A.K...A.......LA............N.V...SI.G.SL.I.CNVGAGGPp..........................................pPAGAA.P.AG...G....P..A...P....S.....T..A...A...A...P......A...E....E..K....K.VE..AKKEe.................sE..ESDD........DMG..FGLF...............................
A0A1G4M880_LACFM/229-310               ......................................................................YPTLPSVGHSIVN......SY.K.D.LM.....AVAIA..A.......N.Y.I...Y.......PE............I.E...EL.L.DR.I.ENPDKY--............................................-ASAA.P.AA...A....A..A...A....S.....S..D...A...P...A......E...E....A..A....E.EE..-E--...................E..ESDD........DMG..FGLF...............................
D4AQF6_ARTBC/17-112                    ......................................................................SPSASDISDVLSS......VG.I.D.AD.....NERVE..K.......L.L.A...E.......LE............G.K...DI.Q.EL.I.AEGSTKLAsvps....................................ggagGAAAA.P.AA...G....G..A...A....G.....G..D...A...A...A......P...A....E..E....A.KK..EEPE...................E..DSDE........DMG..FGLF...............................
A0A096MLS9_PAPAN/15-111                .....................................................................s-PSNKDIKKILNS......VG.I.E.ID.....NDQLS..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQSVGKLAsvpa....................................sgavAVSAA.P.GS...K....A..A...A....A.....D..S...T...P...A......A...A....E..E....K.HE..KTEE..................sE..ESDK........DRG..FGLF...............................
D7DR74_METV3/238-336                   .....................................................................i-PTAETIETIVQK......AF.S.-.-N.....AKAVS..V.......E.S.A...F.......LT............S.E...TS.D.AI.I.GKANAQMLavakla................................gddaldEELQS.M.VS...G....S..E...A....V.....S..E...A...P...A......A...E....E..A....P.AE..EEKK...................E..EAPA........SVG..MGL-lf.............................
A0A1S2Z7B4_CICAR/21-111                .....................................................................a-ITAEKINTILKA......AG.V.T.VE.....SYWPS..L.......F.A.K...L.......AQ............N.K...SI.D.DL.V.LNVGAAGGaa........................................vaVSALA.A.AA...A....G..G...A....A.....A..A...A...A...A......A...A....E..A....K.KE..EAK-...................E..ESDD........DMG..FSLF...............................
A0A1G4IT97_9SACH/17-109                .....................................................................a-PSAADIKSVIES......VG.V.E.AD.....EARIN..S.......L.L.T...S.......LE............G.K..gSI.E.EI.V.ALGETKLAsv.......................................ptgGAAAA.S.AG...G....A..A...A....G.....G..A...T...E...E......A...A....E..E....E.KE..EEK-...................E..ESDD........DMG..FGLF...............................
V4M5E8_EUTSA/22-112                    .....................................................................a-ITSEKIATLVKA......AG.V.E.IE.....SYWPM..L.......F.A.K...M.......AE............K.R...NV.T.DL.I.MNVGAGGGgg.......................................gapVAAAA.P.AA...A....G..G...A....A.....A..A...A...P...A......K...E....E..K....K.DE..PA--...................E..ESDG........DLG..FGLF...............................
Q0CTP9_ASPTN/21-107                    ......................................................................EISAEKIQTLIGA......AK.VpE.IE.....PIWTS..I.......F.A.K...A.......LE............G.K...DI.K.DL.L.TNIGSAG-............................................PAVAA.P.AG...G....A..A...A....A.....P..A...E...A...A......A...A....E..E....K.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A2G5VTM5_9PELO/22-110                .....................................................................a-ITAEKISSLLKA......AN.V.E.FE.....PFWPG..L.......F.A.K...A.......LE............G.V...DV.K.NL.I.TSVSSGAGs..........................................gPAPAA.A.AA...A....P..A...A....G.....G..A...A...P...A......A...E....T..K....K.KE..EPK-...................E..ESDD........DMG..FGLF...............................
A0A0D2N962_9CHLO/233-312               ......................................................................YPTLASIPHSVVN......GY.K.N.VL.....AIAVE..T.......D.Y.S...F.......PL............A.D...KV.K.AY.L.ADPSAF--............................................AS-AA.P.AA...S....G..E...P....A.....A..A...A...P...A......K...K....E..E....P.SE..----...................-..EEEE........DMG..FSLF...............................
C1G5J1_PARBD/17-112                    ......................................................................SPSADDIKTVLGA......VG.I.D.AD.....SERLQ..N.......L.I.A...E.......LK............G.K...NL.D.EL.I.AEGSTKLAsvps....................................ggagATPAA.G.GA...A....S..A...A....A.....G..G...A...P...A......A...E....K..E....E.EK..EEEK...................E..ESDE........DMG..FGLF...............................
W2T216_NECAM/231-304                   .....................................................................y-PTMVSVAHSLAR......GV.Q.N.ML.....GIAAV..T.......D.V.S...F.......KE............A.A...QL.K.EY.L.ADPSKF--............................................AA--A.A.AP...A....A..T...A....A.....A..P...A...A...A......A...E....T..K....K.EE..----...................-..----........---..----lileec.........................
A0A183FF76_HELBK/17-109                .....................................................................s-PKLDDIKNILGA......VG.V.D.TD.....AEAAK..M.......V.I.S...R.......LQ............G.K...SI.E.EV.I.AEGSSGLVais......................................ggaP-AAS.A.PA...A....A..A...A....P.....A..A...A...A...A......Q...E....A..K....P.AK..KEEK...................E..ESDE........DMG..FGLF...............................
X6MF38_RETFI/17-128                    .....................................................................k-PSKEDITKILDS......VG.I.K.PD.....EGKLN..A.......L.F.E...D.......LEk..........sG.K...NV.D.EA.I.QQGLDKLAavpagknattl......................mitktnknkggAAVAV.A.TG...A....A..P...A....G.....G..A...A...P...A......A...E....A..K....K.DD..EEEE...................E.kESED........GMC..FNL-...............................
A0A0P1B0G7_9STRA/231-311               .....................................................................i-PTLASIPHSIAN......AF.K.D.LV.....AIAVE..C.......EsF.S...F.......EK............A.E...PY.K.AY.L.ADPSAF--............................................---AV.A.AP...A....G..G...A....A.....A..P...E...A...K......K...E....E..A....V.EE..----...................-..EEEV........DMG..GGM-dmf............................
A0A0N4TX79_BRUPA/21-117                .....................................................................a-ITGDKISTILKA......AH.V.D.VE.....PFWPG..L.......F.A.K...A.......LE............G.V...DV.K.SL.I.TNISSSVGsgggg..................................aaagvAAPSA.T.AA...A....A..A...P....A.....A..A...A...E...E......K...E....D..K....K.KE..EPK-...................E..ESDD........DMG..FGLF...............................
A0A093J7C0_EURHL/17-114                ......................................................................SPTSKDLKKILDS......VG.I.E.TD.....DERMN..K.......V.I.S...E.......LS............G.K...NI.E.DV.I.AQGNGKLAsmpa....................................ggavAVSAG.G.GS...A....A..P...A....A.....A..A...A...P...A......A...A....E..E....K.KE..EKKEe.................sE..ESDD........DMG..FGLF...............................
A0A0N5D0F2_THECL/231-316               .....................................................................h-PTLVSVPHSIAN......AL.K.N.LL.....AIAVE..A.......N.I.D...M.......KE............A.Q...KI.K.EF.L.ADPSKF--............................................ATATA.P.KA...T....P..V...V....P.....S..A...Q...P...E......A...P....A..K....K.EE..AKKE...................E..SSDE........DMG..FGLF...............................
E3NNU7_CAERE/17-106                    ....................................................................dl--KADDLKKILSS......VG.I.D.SD.....VENIN..N.......V.V.A...S.......LQ............G.K...NM.E.EI.F.AEGMTRIAs..........................................vPSEGA.P.AA...S....S..A...A....P.....A..A...A...A...A......D...T....K..A....A.KK..EEPK...................E..ESDD........DMG..FGLF...............................
B8P0N4_POSPM/17-112                    .....................................................................s-PSAGDVKKVLGA......VG.I.E.AD.....DERLE..K.......L.I.S...E.......LE............G.K...DI.N.EL.I.AEGSSKLSsvps....................................ggavA-VSA.G.GA...A....G..G...A....P.....A..A...A...A...A......E...E....K..K....E.EK..KEEE..................kE..ESDD........DMG..FGLF...............................
A0A1J4JHT4_9EUKA/17-104                .....................................................................a-PNKAKITSILES......VG.I.T.VD.....AQALD..A.......L.L.A...K.......LD............G.K...DI.A.EL.I.KEGSSKLA............................................--VVG.G.GA...A....A..P...A....A.....G..G...A...A...P......A...E....E..K....K.EE..KKE-...................-..EEE-........---..----vvelaggfddlf...................
Q8H3F5_ORYSJ/17-107                    ......................................................................SPTKDDVRAILGA......VG.A.D.VD.....EDKLG..Y.......L.F.D...Q.......VA............G.K...DL.S.EI.L.AAGSEMLAf..........................................gGVGAA.P.AA...A....A..T...A....G.....G..G...A...A...A......A...G....E..K....E.KE..EEKV..................eE..EEED........DIV..FSLF...............................
B8LU13_TALSN/21-110                    ......................................................................EITADKLNTLIKT......AN.VpE.VE.....PIWAQ..L.......F.A.R...A.......LE............G.K...DV.K.EL.L.TNVGSGGG............................................AAAAA.P.AA...G....G..A...A....A.....G..G...D...A...A......A...E....E..K....K.EE..KEEE..................kE..ESDE........DMG..FGLF...............................
A0A0B5HW48_ARCG5/16-101                .....................................................................g-ITEDAVAKVLKA......AG.I.E.SD.....ASRVK..A.......L.I.A...S.......LK............E.V...NI.D.EA.I.EKAAVA--............................................QAVQV.Q.PA...A....H..A...G....G.....K..A...E...A...K......K...E....E..V....K.EE..QGK-...................T..EEEA........AEG.lGSLF...............................
RL10_PYRHO/233-341                     ......................................................................YPTPETIEAIIQK......AF.L.-.-N.....AKTVA..I.......E.A.G...Y.......IT............K.E...TI.Q.DI.I.GRAFRAMLllaqqlped.........................vldektkellSAQAQ.V.AV...A....T..Q...P....S.....E..E...E...K...K......E...E....E..K....T.EE..EEKEe................eaS..EEEA........LAG.lSALF...............................
#=GR RL10_PYRHO/233-341          SS    ......................................................................---TTTHHHHHHH......HH.H.-.-H.....HHHHH..H.......H.T.T...-.......--............T.T...TH.H.HH.H.HHHHHHHHHHHTT--XX.........................XXXXXXXXXXXXXXX.X.XX...X....X..X...X....X.....X..X...X...X...X......X...X....X..X....X.XX..XXXXX................XXX..XXXX........XXX.XXXXX...............................
A0A0N5A9D7_9BILA/17-113                ......................................................................SPSAKDIENILGS......VG.L.D.VD.....MEEAN..K.......V.I.K...A.......LS............G.K...SV.D.EV.I.TAGKEKIAtvps...................................gasvaAPVAA.A.DA...A....A..P...A....A.....A..A...A...K...A......K...E....P..E....K.KK..EEEK...................E..ESDD........DMG..FGLF...............................
A0A1X2IEN1_9FUNG/228-308               ......................................................................YPTLASVPHSLIN......GY.K.N.LL.....AVSVA..S.......D.Y.T...F.......AG............S.E...KI.K.EY.L.ENPEAF--............................................-AVAA.P.VA...A....A..G...A....A.....E..A...A...P...-......-...Q....E..A....A.AE..EEE-...................-..SEDD........DMG..FGLF...............................
F1RYZ0_PIG/17-114                      ......................................................................SPSAKDIKKILDS......VG.I.E.AD.....DDRLN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGIGKLAsvps....................................ggavAVAAA.P.GS...A....A..P...A....A.....G..S...A...P...A......A...A....E..E....K.KE..EKKEe.................sE..ESDD........DMG..FGLF...............................
A0A0D3HR33_9ORYZ/795-880               ......................................................................YPTXAAAPHMFLN......GY.K.N.VL.....AVAVE..T.......E.Y.S...Y.......PH............A.X...KI.K.EY.L.KDPSKF--............................................AVAAP.V.AA...A....D..S...G....A.....A..A...V...A...A......S...K....E..E....E.KK..EEPE...................E..ESDV........---..----knylgls........................
A0A2G5U6B9_9PELO/17-109                ......................................................................NPQADDIKNILSA......VG.V.D.AN.....AESVN..L.......V.V.S...G.......LE............G.K...NI.E.EL.I.AAGSTKFAtis......................................ggvGAASS.A.AP...A....A..G...G....A.....A..P...A...A...D......N...K....P..A....K.KE..EPK-...................E..ESDD........DMG..FGLF...............................
A0A1R2B392_9CILI/17-111                .....................................................................s-PSVKDLESIIKA......AG.G.D.FD.....ANKAN..T.......L.V.E...A.......LK............D.K...SI.H.EL.V.ASGKAKLGgi.......................................slgAGGAS.S.AA...A....G..E...T....K.....A..A...P...A...E......T...K....E..E....K.KE..TKQ-...................E..DEDA........GMG.eGGL-glf............................
A0A0K8LH41_9EURO/17-109                ......................................................................SPSAEDVKTVLSS......VG.I.D.AD.....EERLN..K.......L.I.A...E.......LE............G.K...DL.Q.EL.I.AEGSTKLAsvp......................................sggAAAAA.P.AA...G....G..A...A....A.....G..G...A...A...A......A...P....A..E....E.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A162U7I4_PHYB8/17-107                .....................................................................k-PSTEDIKTLLGS......VG.V.E.AE.....TQRLA..S.......L.L.K...A.......LE............G.K...TV.A.EV.I.AEGSSKLAsvs......................................tggA--AA.A.AG...G....A..A...A....G.....A..A...S...E...E......A...A....A..E....E.AV..EEK-...................E..ESDD........DMG..FGLF...............................
G1LBT5_AILME/14-100                    ......................................................lilhddkvtvmegein-------------......--.-.-.--.....--ALT..K.......A.A.E...A.......LA............D.V...NI.G.SL.I.CKRGAGGPa..........................................pAVAAA.P.TG...G....S..A...P....S.....T..T...A...A...T......A...E....E..K....E.LE..AKEEh.................sE..ESDD........DTG..FGLF...............................
A0A1C7N841_9FUNG/17-107                ......................................................................SPSAADLKSLLAT......VG.A.E.AD.....EERVN..S.......L.I.S...A.......LE............G.K...NT.E.EL.I.AEGLEKMSsvp......................................tggAVAAA.G.AS...G....A..A...A....A.....S..D...A...P...A......A...E....A..A....A.EE..-K--...................E..ESDD........DMG..FGLF...............................
V4SWS1_9ROSI/48-143                    ......................................................................SPSADDIKGILGS......VG.A.D.CE.....DNRLE..L.......L.L.S...E.......VK............G.K...DI.T.EL.I.ASGREKLAsvp.....................................sgggVAVAA.A.PS...A....G..G...A....G.....A..A...P...A...A......A...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
A0A2A2LXZ0_9BILA/22-111                .....................................................................a-ITGDKIAALLKA......AN.V.D.VE.....PFWPG..L.......F.A.K...A.......LE............G.V...NV.K.DL.I.TSVSSGGGg..........................................gAAAPA.A.AA...A....P..A...A....A.....A..E...A...P...K......D...E....G..K....K.KK..EEVK...................E..ESDD........DMG..FGLF...............................
A0A0V0X2Y4_9BILA/231-319               ......................................................................YPTAASAPHMIAN......AF.K.N.LL.....SIAAV..T.......D.I.T...F.......KE............A.E...KL.K.EY.L.ADPSKFAV............................................AAAPA.A.AA...A....D..S...S....K.....A..E...K...E...D......S...S....S..K....K.KE..EKVE...................E..ESDE........EEG.mGGLF...............................
W5LAT6_ASTMX/17-115                    ......................................................................SPSAKDIKNILGS......VG.I.E.AS.....DERLN..K.......V.V.S...E.......LN............G.K...DI.N.EV.M.NAGLSKLAsvpag..................................gavavSAAAP.G.GG...G....A..P...A....A.....G..E...A...P...A......A...E....E..K....K.EE..KKEE..................sE..ESDE........DMG..FGLF...............................
A9UW12_MONBE/229-309                   .....................................................................r-PNPASVPHMVIN......GY.K.N.VL.....AIACV..T.......E.I.T...F.......PL............A.E...KA.K.AY.L.ANPEAF--............................................AVAAA.P.AA...A....A..A...P....A.....A..A...A...A...A......A...P....E..P....E.SE..----...................-..DDEE........MDG..FSLF...............................
A0A024WY34_PLAFA/19-108                ......................................................................NPSTKEVKNVLGA......VN.A.D.VE.....DEVLN..N.......F.I.D...S.......LK............G.K...SC.H.EL.I.TDGLKKLQni........................................ggGVAAA.P.AG...A....A..A...V....E.....T..A...E...A...K......K...E....D..K....K.EE..KKEE..................eE..EEED........DLG..F---...............................
Q201W9_ACYPI/231-313                   .....................................................................y-PTIVSAPHMLIN......GF.K.N.LV.....AVAAE..T.......E.I.E...F.......KE............A.T...TF.K.EY.L.KDPSKF--............................................-AVAV.A.AP...V....E..S...A....A.....P..A...K...E...A......K...K....E..E....K.VE..SEE-...................-..EEDD........DMG..FGLF...............................
A0A1R3I165_9ROSI/234-320               ......................................................................YPTLAAAPHMFIN......AY.K.N.VL.....SVAIA..T.......E.Y.S...F.......PQ............A.D...KV.K.EY.L.ADPSKFAV............................................AAAPV.A.AA...G....G..A...A....P.....A..A...A...A...A......P...A....E..E....K.KP..EPE-...................E..ESDD........DMG..FSLF...............................
A0A0C4E8M8_MAGP6/21-108                ......................................................................EITADKIQTIIKA......AG.VpD.VE.....PIWAQ..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.SNVGSGGG............................................AAPAA.G.GA...A....A..G...G....G.....A..A...A...E...E......A...K....E..E....E.KE..EEK-...................E..ESDE........DMG..FGLF...............................
F7EED9_MONDO/22-115                    .....................................................................t-VTEDKINALIKA......AG.V.N.VE.....PFWPG..L.......F.A.K...A.......LN............N.V...NI.G.SL.I.CNVGVGGPa.........................................paAGGAA.P.AG...G....A..A...P....A.....S..T...A...A...P......A...E....E..K....K.KE..EAKKe................esE..ESDD........DMG..FGLF...............................
A0A196S8A5_BLAHN/27-96                 .....................................................................t-VNTENIDKLLKA......TN.N.T.VE.....PYWPM..L.......F.A.K...Y.......LG............E.K...DI.C.EL.L.MKPSCG--............................................-----.-.AA...A....-..-...-....-.....-..-...-...-...-......P...A....E..X....K.EE..EE--...................E..EEDV........DMS.gGGLF...............................
S9U7X0_9TRYP/224-312                   .....................................................................i-PTSATIAPMLVD......GF.K.N.LL.....GVSIA..T.......G.Y.E...F.......EEf..........dG.K...TI.R.EA.A.INGTLAG-............................................PAASG.A.AP...A....A..A...A....G.....G..S...A...A...P......A...A....A..A....K.VE..EPE-...................E..EEDD........DFG.mGGLF...............................
U5HIN6_USTV1/229-310                   ......................................................................YPTIASVTHSLVN......SY.K.N.LL.....AIALA..T.......D.V.T...F.......EG............A.E...KV.K.EY.L.ANPEAF--............................................---AA.A.AP...A....A..T...E....S.....A..A...A...P...A......K...A....E..E....K.EP..EKE-...................E..ESDD........DMG..FGLF...............................
A0A059JID4_9EURO/21-109                ......................................................................EITSDKLQTLIKA......AG.VtD.VE.....PIWTS..L.......F.A.K...A.......LD............G.K...NL.K.DI.L.VNVGSGGGa..........................................pAAGGA.P.AA...G....G..A...A....A.....A..E...A...A...P......A...E....E..E....K.AE..EAE-...................-..ESDE........DMG..FGLF...............................
A0A2K5HSA0_COLAP/141-226               ......................................................................YPTVASVPHSIIS......GY.K.R.VL.....ALSVE..I.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFV-............................................AAAPV.T.TA...A....T..T...A....P.....A..A...A...A...A......P...T....K..V....E.AN..EEL-...................E..ESDK........DMG..FGLF...............................
A0A2H9LLC3_9ARCH/16-105                ......................................................................EIDEQNLTQVLTA......AG.I.N.VD.....AVRAK..A.......L.V.A...S.......LA............E.V...KI.D.EA.I.KSAPTMMA............................................APVAA.P.AA...V....A..P...V....A.....E..A...K...P...K......E...D....E..K....K.KK..EDEK..................qK..EEAA........LEG.lGALF...............................
A0A0B2V1V8_TOXCA/779-875               ......................................................................SPTAKDIERILGS......VG.L.D.VD.....MEDAN..K.......V.V.S...A.......LS............G.K...SI.D.EV.I.TAGRSKIEsvpc...................................gggagQGAAA.P.AA...A....A..P...A....A.....A..A...A...A...P......E...P....E..K....K.KE..EPKE...................E..SDDE........DMG..FGLF...............................
M0NHP0_9EURY/16-111                    ......................................................................EINEDNVTGVLEA......AG.V.D.VE.....ESRVK..A.......L.V.A...A.......LE............D.V...DI.E.EA.I.ETAAAAPA............................................AGAAA.G.GS...A....D..A...A....E.....A..D...E...A...D......D...E....A..D....E.ED..AAEEa.................aD..DDDE........DEG.dG---geglgelf.......................
F0YNB0_AURAN/231-314                   ......................................................................YPTMASVPHSVAN......AF.K.S.LI.....AIAVE..Sg.....dA.F.S...F.......AK............A.G...PF.K.AF.L.ADPSAF--............................................---AC.A.AC...A....G..D...A....G.....G..D...A...V...A......I...E....E..K....K.EE..EE--...................-..EEEV........DMG..GGM-dmf............................
E9ADB9_LEIMA/238-323                   .....................................................................i-PTPSTIGPMLVD......AF.K.N.LL.....AVSVA..T.......S.Y.E...F.......EEh..........nG.K...EL.R.EA.A.INGL----............................................LAGSC.S.AA...A....E..P...A....A.....A..A...P...A...A......P...S....A..A....A.KE..EPE-...................E..SDED........DFG.mGGLF...............................
W2RM11_9EURO/17-112                    ......................................................................SPSADDVKGVLSS......AG.I.D.AD.....DERLS..K.......L.I.E...E.......LE............G.K...DI.N.EL.I.SAGTEKLAsvps....................................ggagGAAAG.G.AA...A....P..A...A....G.....G..A...A...A...A......E...E....E..A....P.AK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A0C2N4Z5_THEKT/17-109                ......................................................................NPTVLDLEMIILA......GE.G.Q.FD.....KNQAE..L.......V.V.T...R.......LK............G.K...DI.E.DL.I.QQGKLKISsi........................................apAAAMS.A.AP...V....Q..G...T....K.....A..A...A...V...D......V...M....P..E....K.KQ..ESES...................E..SSDE........GGG.lGSLF...............................
B4N4U1_DROWI/231-316                   ......................................................................YPTIASAPHSIAN......GF.K.N.LL.....AIAAT..T.......E.V.E...F.......KE............A.T...TI.K.EY.I.KDPSKF--............................................AAAAS.T.TA...A....P..A...A....G.....G..A...G...D...K......K...E....E..A....K.KV..ESES...................E..EEDD........DMG..FGLF...............................
J9IP67_9SPIT/32-113                    ......................................................................EITSEKLAKVIKA......SG.N.E.VE.....AYWPA..M.......F.A.K...A.......LK............G.Q...DI.E.DL.L.SNLASA--............................................PVGGA.A.VA...E....V..A...A....T.....A..V...A...A...P......K...V....E..E....K.KV..EEA-...................-..-ADV........DMG..-GLF...............................
A0A182SL32_9DIPT/17-112                .....................................................................a-PTNSDIEKILSS......VG.I.E.AD.....STRVT..K.......V.V.N...E.......LK............G.K...SV.E.EL.I.ASGREKLSsmp.....................................agggAAAAA.P.AA...A....A..G...G....G.....G..A...A...A...P......A...A....E..K....K.EE..KKEE..................sE..SEDE........DLG..FGLF...............................
E3LY25_CAERE/22-110                    .....................................................................a-ITGEKISTLLKA......AN.V.E.FE.....PYWPG..L.......F.A.K...A.......LE............G.V...DV.K.NL.I.TSVSSGAGs..........................................gPAPAA.A.AA...A....P..A...A....G.....G..A...A...P...A......A...E....T..K....K.KE..EPK-...................E..ESDD........DMG..FGLF...............................
K3WB98_PYTUL/29-111                    ......................................................................EVTAENIASALSA......SG.N.D.VA.....AYVPQ..L.......F.A.D...L.......IG...........rG.L...VI.D.KF.L.AGPSAG--............................................--GAA.P.AA...G....A..A...G....A.....G..A...A...A...A......P...V....A..E....E.KE..EEE-...................-..EADL........GAG..MDMF...............................
A0A2I4DJA5_9ROSI/221-308               ......................................................................YPTLAAAPHMFIN......AY.K.N.VL.....AIAVA..T.......E.Y.S...F.......PQ............A.E...KV.K.EF.L.EDPSKFAF............................................AAAPA.A.AS...D....S..G...A....A.....P..A...A...A...A......A...K....E..E....E.KK..EEPA...................E..ESDD........DMG..FSLF...............................
A0A0E0LQM6_ORYPU/21-109                .....................................................................p-ITSEKIATLVKA......AN.I.K.VE.....AYWPG..L.......F.A.K...L.......LE............H.R...SV.D.DL.I.LSVGSGGGa..........................................aPVAAA.A.AP...A....A..G...G....G.....A..A...A...A...P......A...A....E..E....K.KE..EAK-...................E..ESDD........DMG..FSLF...............................
K1VVH0_TRIAC/20-108                    ......................................................................EITADKLIALTSA......AK.L.E.ID.....QIYAS..L.......L.A.K...A.......LE............G.K...DI.K.EM.L.TNVGGGGAp..........................................aAGAPA.A.GG...A....A..A...A....A.....G..G...D...A...P......A...A....E..E....K.KE..EAK-...................E..ESDD........DMG..FGLF...............................
A0A151U3E9_CAJCA/17-115                ......................................................................SPSAADIKEILGC......VG.A.D.AN.....DDRIE..Q.......L.L.S...E.......IK............G.R...DI.V.EV.I.AAGREKLAsvp.....................................agggGAVAV.A.AA...P....G..G...A....A.....A..D...G...P...A......A...E....A..K....K.EE..KEEE..................kE..ESDD........VSG..----llpldlf........................
A0A1E5RSW8_9ASCO/20-104                ......................................................................EITAENILNIAKA......AG.V.E.XE.....SVWAD..I.......Y.A.K...A.......LE............G.K...DV.K.EI.L.AGFNSIG-............................................ASAAA.P.AA...T....A..A...A....G.....S..S...E...A...A......A...E....E..K....E.AS..EAE-...................-..ESDD........DMG..FGLF...............................
H2Q9Q0_PANTR/22-113                    .....................................................................t-VTEDKINALIKA......AG.V.N.VE.....PFWPG..L.......F.A.K...A.......LA............N.V...NI.G.SL.I.CNVGAGGPa..........................................pAAGAA.P.AG...G....P..A...P....S.....T..A...A...A...P......A...E....E..K....K.VE..AKKEe.................sE..ESDD........DMG..FGLF...............................
A0A081CIF0_PSEA2/17-111                ......................................................................SPSAADIKALLET......VG.V.E.AE.....QERLD..K.......L.I.E...E.......LN............G.K...DI.N.TL.I.AEGQEKLAsvpa....................................ggaaPAAAA.G.GA...A....A..A...A....G.....G..A...A...A...A......K...E....E..E....K.KE..EEK-...................E..ESDD........DMG..FGLF...............................
M5BUF3_THACB/17-61                     .....................................................................s-PVADDIKKVLSA......AG.V.D.VD.....EERLN..K.......L.L.S...E.......LE............G.K...DV.N.AV.S.Q-------............................................-----.-.--...-....-..-...-....-.....-..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----emrch..........................
A0A219APW8_9EURY/16-101                ......................................................................EINEENVTKILEA......AG.V.D.VD.....ESRVK..A.......L.I.A...A.......LE............D.V...DI.D.EA.I.ETSAIA--............................................-AAPA.A.AA...A....A..P...A....A.....E..A...E...E...E......E...E....E..E....E.EE..SEEE...................A..EEEA........AAG.lGALF...............................
A0A1E5RBV8_9ASCO/17-108                ......................................................................SPSAEDIKSVIES......VG.V.E.VE.....SAKVD..A.......L.L.S...A.......LE............G.K...TI.E.EL.I.AEGNAKFAt.........................................vpAAGAA.V.SS...G....S..G...A....A.....S..S...G...A...A......A...E....E..A....E.EE..KEEE..................kE..ESDE........DMG..FGLF...............................
Q6BKG1_DEBHA/229-309                   ......................................................................YPTLPSVGHSVVN......HY.K.N.VL.....ALSIA..T.......D.Y.T...F.......EG............S.E...AI.K.DR.L.ANPDAY--............................................---AA.A.AP...A....A..A...A....S.....S..S...A...A...A......E...E....A..P....A.EE..EE--...................E..ESDG........DMG..MGLF...............................
C0NFV7_AJECG/97-190                    ......................................................................SPSASDIKSVLSS......VG.I.D.AD.....SERLE..K.......L.L.A...E.......LE............G.K...NI.T.EL.I.AEGTTKLAsv.......................................psgGAASA.P.AA...G....G..A...A....A.....G..G...A...A...A......A...A....E..K....A.EE..KEEE..................kE..ESDE........DMG..FGLF...............................
W4JZI6_9HOMO/17-110                    ......................................................................SPSASDVKKVLGA......VG.I.E.AD.....DERLE..K.......L.I.S...E.......LE............G.K...DI.N.QL.I.AEGNGKLAsvp.....................................sggaVAAAA.P.AA...G....G..A...A....P.....A..A...A...A...E......K...E....E..E....K.KE..EEK-...................E..ESDD........DMG..FGLF...............................
F0XM60_GROCL/21-106                    ......................................................................EITADKLQTLIKA......AT.V.E.VE.....PIWTQ..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.SNVGSG--............................................GGGAA.P.AA...A....A..G...A....S.....G..A...A...A...A......E...E....V..V....E.EK..EEEK...................E..ESDD........DMG..FGLF...............................
S9W308_CAMFR/1-73                      .....................................................................v-------------......--.-.-.--.....-----..-.......-.I.S...E.......LN............G.K...NI.E.DV.I.AQGIGKLAsvpa....................................ggavAVPAA.P.GS...A....A..P...A....A.....G..S...A...P...A......V...A....E..E....K.KE..EKKEe.................sE..ESDD........DMG..FGLF...............................
A0A1M2V838_TRAPU/229-312               ......................................................................YPTVVSVIHSLVN......SY.K.N.LI.....AVALA..T.......E.Y.T...F.......EG............A.E...KA.K.EY.L.ANPEAF--............................................AVAAA.P.AA...A....E..A...G....P.....S..A...E...A...A......A...A....A..P....E.EE..KE--...................-..ESDD........DM-..----vldigc.........................
E3GXB7_METFV/16-106                    ......................................................................EINEENVKKVLEA......AG.A.E.VD.....EARVK..A.......L.V.A...A.......LE............E.V...DI.D.EA.I.EKAA----............................................-VAPA.P.AG...E....V..K...E....E.....K..E...E...E...E......E...E....K..E....E.KE..EEEEee..............eeeE..---Eke...eeaAAG.lGALF...............................
A0A093UZA2_TALMA/229-312               ......................................................................YPTLASVMHSLVN......SY.K.K.VL.....AVAIE..T.......E.F.S...W.......PE............I.E...EL.K.DR.I.ANPEAY--............................................ASAAP.V.AA...A....A..S...S....S.....E..A...A...P...A......A...A....E..E....K.EE..SEE-...................E..SGDE........GFG..-GLF...............................
A0A1S3XWE6_TOBAC/22-111                .....................................................................p-ITAEKIATVVKA......AN.I.S.VE.....SYWPS..L.......F.A.K...L.......FE............K.R...DV.E.DL.I.LNVGIGGGg.........................................aaVAVAA.P.VA...G....G..G...A....A.....A..A...A...P...A......A...E....E..K....K.EE..KKE-...................E..SDDE........DLG..LSLF...............................
A0A194XQ09_9HELO/229-313               .....................................................................f-PTLPSVMHSVVN......SY.K.K.VL.....AVAVE..T.......E.Y.G...W.......PE............I.E...EL.K.DR.I.ANPDAY--............................................A---S.S.AP...A....A..A...T....G.....G..D...A...P...A......A...A....E..E....K.EE..ENEE...................-..EAEEs......gDEG.fGGLF...............................
A0A1Q3AN60_CEPFO/201-285               ...................................................................yqt---LAAAPHMFIN......AY.K.N.VL.....AIVVA..T.......E.Y.S...F.......PQ............A.D...KV.K.EY.L.KDPSKF--............................................AVAAA.P.AA...S....E..S...V....A.....A..P...A...A...A......K...E....E..E....K.KD..EPA-...................E..ESDE........DMG..FSLF...............................
A0A139IIM3_9PEZI/17-112                .....................................................................s-PSAGDIKGVLSA......VG.V.E.AD.....EERLE..K.......L.L.S...E.......LE............G.K...DI.N.EL.I.SEGSTKLAsvps...................................ggaggASAAG.G.AA...A....A..A...G....G.....D..A...A...A...P......A...A....E..E....A.KE..EEK-...................E..ESDE........DMG..FGLF...............................
U4LIW1_PYROM/21-111                    ......................................................................EITADKLNTLIKA......AG.VaD.VE.....PIWAS..L.......F.A.K...A.......LE............G.K...DL.K.EM.L.LNVGSGGAa..........................................pAAAAG.A.AS...S....G..A...A....A.....G..G...A...A...E......A...V....E..E....K.KE..EKEE...................E..ESDE........DMG..FGLF...............................
A0A1V4C3G4_9EURY/16-113                ......................................................................EINEENVTAVLEA......AG.V.D.VE.....ESRVK..A.......L.V.A...A.......LE............D.V...DI.E.DA.I.ETAAAAPAag........................................gaAAGGA.G.GS...A....D..E...A....E.....E..E...D...E...S......E...D....E..A....D.EA..EAEE...................E..EEDE........DEG..----esgeglgelf.....................
A0A1G4MBX8_LACFM/17-105                .....................................................................a-PSAENVKTVLES......VG.I.E.VE.....EEKVS..S.......L.L.S...A.......LE............G.K...SV.E.EL.I.AEGNEKLSa..........................................vPAASG.A.AP...A....A..G...A....A.....G..A...A...A...E......A...E....E..E....A.PE..EAE-...................E..ESDD........DMG..FGLF...............................
A2EXW1_TRIVA/20-103                    ......................................................................EITAEKLNTLIKA......AN.V.Q.LE.....NYWVD..L.......F.A.D...Y.......FK............N.H...DV.T.EL.V.KNGAAGG-............................................AAPAA.A.AA...G....G..A...A....A.....A..E...E...A...P......K...E....E..E....K.KE..EEP-...................-..----........---..----aapldlgdmf.....................
A0A1L9PI79_ASPVE/17-107                ......................................................................SPSASDIKEVLSS......VG.V.D.AD.....SERLE..K.......L.I.A...E.......LQ............G.K...DI.N.EL.I.AEGTTKLAs.........................................vpS-GGA.G.AA...A....A..P...A....A.....G..G...A...A...A......A...E....A..P....A.AE..KEEE..................kE..ESDE........DMG..FGLF...............................
A0A200R5J5_9MAGN/21-108                .....................................................................s-ISAEKIATLVKS......AN.V.D.VE.....PFWPS..L.......F.A.K...L.......LQ............K.I...NV.E.DGnV.GSGGGAAA............................................VAVAA.P.SG...G....G..A...A....A.....A..T...A...A...P......A...A....E..E....K.KE..EPK-...................E..ESHD........DMG..FSLF...............................
A0A0A0KEV8_CUCSA/38-133                .....................................................................t-PSAQDITTILSS......VG.A.E.AE.....VEKIE..L.......L.I.A...E.......LK............G.K...DI.T.EL.I.AYAREKMAslp......................................tgaVVAAA.V.AA...V....P..S...T....V.....D..T...A...A...P......V...G....A..E....A.KK..EEKDd.................aM..DSDE........DIC..FSLF...............................
G3AVC0_SPAPN/229-311                   ......................................................................YPTLPSVGHSLIN......NY.K.N.VL.....ALSIA..T.......D.Y.T...Y.......EG............S.E...AV.K.DR.L.ANPEAY--............................................AAAPA.A.AA...S....A..G...-....A.....E..E...S...G...A......A...E....E..A....A.AE..EA--...................E..ESDD........DMG..FGLF...............................
A0A0E0J9Y5_ORYNI/17-105                ......................................................................SPTKDDVRAILGV......VG.A.D.VD.....EDKLG..Y.......L.F.D...Q.......VA............G.K...DL.S.EI.L.AAGSEMLAf..........................................gGVGAA.P.AA...A....A..T...A....G.....G..G...A...A...A......A...G....E..K....E.KE..EEKV...................-..EEED........DIV..FSLF...............................
A0A2I0QJN0_9EURY/16-99                 .....................................................................a-INEENLTKVLTG......AN.V.K.VN.....DAMVK..A.......V.V.T...S.......LE............G.V...NI.E.DV.L.KNASAQ--............................................-AVAQ.P.AQ...A....Q..H...A....G.....K..K...E...E...K......K...E....E..E....K.EE..NAA-...................-..EEDA........AAG.lSSLF...............................
R7S7G9_TRAVS/31-118                    ......................................................................EITADKITALTNA......AN.I.E.VE.....PIWAS..L.......L.A.K...A.......LE............G.K...NV.K.DL.L.SNVGAGGAg..........................................pATAAA.P.AA...G....G..A...A....A.....E..A...E...A...P......K...E....E..K....K.EE..EK--...................E..ESDD........DMG..FGLF...............................
C1N665_MICPC/20-107                    ......................................................................EVTADKMDTIVKA......AG.V.T.VE.....PYWGM..L.......F.G.K...F.......LA............T.K...SV.D.EL.V.ANVGAGGGg..........................................gG-GGG.G.GG...G....G..G...G....G.....G..G...G...G...E......A...A....A..A....A.PE..PEE-...................E..EEEE........AMD..FDLF...............................
A0A1Y1XUG0_9FUNG/17-108                .....................................................................t-PSSADVEKLLSS......VG.I.E.AD.....SERLN..K.......L.I.S...E.......LE............G.K...NI.E.EL.I.AEGKEKLAsv.......................................psgGAAAA.P.AG...A....A..A...A....G.....G..A...E...A...A......P...A....A..A....K.EE..EAK-...................E..ESDD........DMG..FGLF...............................
I1CTB0_RHIO9/17-107                    .....................................................................t-PSNEDIKKLLSS......VG.A.E.AD.....AARLD..S.......L.L.K...A.......LE............G.K...TV.A.EV.I.AEGSTKLAsv.......................................sagPVAAA.G.AA...G....G..G...A....A.....V..Q...D...A...P......A...A....E..E....K.AE..EK--...................E..ESDD........DMG..FGLF...............................
A0A287DFY5_ICTTR/225-299               ..................................................................ptva-------------......--.S.R.VL.....ALSVE..T.......E.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFVA............................................AA--P.V.AA...A....T..T...A....A.....P..A...A...A...V......A...P....A..K....V.EA..KEES...................E..ESDE........DMG..FGLF...............................
C3Z9A6_BRAFL/17-114                    ......................................................................NPSAGDIKKILGS......VG.I.D.AE.....DERLN..K.......V.I.G...E.......LK............G.K...DI.E.EV.M.AAGRGKLSsmps....................................gggvAAAAG.G.GG...A....A..A...G....G.....G..A...A...P...A......A...E....E..K....K.EE..KKEEs.................eE..ESDD........DMG..FGLF...............................
A0A135TLR7_9PEZI/229-313               .....................................................................f-PTLPSVIHSFFN......GY.K.K.VL.....AVAIE..T.......D.I.S...W.......PE............I.E...EL.K.DR.I.ANPDAY--............................................-AAAA.P.AA...G....A..A...S....G.....G..A...A...E...T......K...A....E..E....K.EE..EKE-...................E..ESDE........DGG.fGGLF...............................
G7DUM9_MIXOS/1-64                      .....................................................................m-------------......--.-.-.--.....-----..-.......-.-.Q...A.......LE............G.K...DV.K.DM.L.SNVGAGGA............................................AAPAA.A.GA...A....P..A...A....A.....G..G...A...A...A......E...E....E..K....K.EE..KKEEe.................kE..ESDD........DMG..FGLF...............................
E9HEV2_DAPPU/24-114                    .....................................................................a-ITAEKIQTILKA......AD.V.K.VE.....PYWPG..L.......F.A.K...A.......LD............G.L...NL.K.SM.I.TNVGSGVG............................................AAPAA.G.AA...A....A..A...P....A.....A..A...A...P...A......A...K....E..E....K.KE..EKKKe................esE..EEDD........DMG..FGLF...............................
A0A183C080_GLOPA/68-160                ....................................................................pi--LAEKLQAMVEV......AG.V.S.VE.....PFWAG..L.......Y.A.K...G.......LQ............G.V...DV.K.AL.I.YNIGSGVGsa........................................paAAAVV.T.AS...S....A..G...G....G.....A..A...A...P...A......A..vN....E..E....K.KN..EESK...................E..ELDD........DMG..FGLF...............................
Q5JH09_THEKO/16-105                    ......................................................................EITEENLKAVLEA......AG.V.T.PD.....EARIK..A.......L.V.A...A.......LE............G.V...NI.D.EV.I.EKAAMPVA...........................................aPVAVA.A.AP...A....A..E...G....G.....A..A...E...A...A......Q...E....E..E....E.EE..EEEA...................S..EEEA........LAG.lGALF...............................
E7KM36_YEASL/17-109                    .....................................................................a-PSAADIKAVVES......VG.A.E.VD.....EARIN..E.......L.L.S...S.......LE............X.K..gSL.E.EI.I.AEGQKKFAtv.......................................ptgGASSA.A.AG...A....A..G...A....A.....A..G...G...D...A......A...E....E..E....K.EE..EAK-...................E..ESDD........DMG..FGLF...............................
A0A0C2W484_9HOMO/17-114                ......................................................................SPSKKDITKLLKT......VG.V.D.AD.....DERLD..K.......L.L.S...E.......LE............G.K...NI.D.QL.I.SEGSSKLSsvpsg..................................gggggGGGAA.A.AS...G....G..G...G....G.....G..A...P...A...A......E...A....V..E....E.KK..EEAK...................E..ESDD........DMG..FGLF...............................
A0A0A1SRQ6_9HYPO/21-108                ......................................................................EITADKLQTLIKA......AG.V.E.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.EL.L.TNVGSGGA............................................AAPAA.A.AG...G....A..A...A....A.....G..G...A...A...T......E...A....A..A....E.EK..VEEK...................E..ESDE........DMG..FGLF...............................
A0A1U8NXW5_GOSHI/22-113                .....................................................................p-ITAEKIAALVKA......AN.V.S.VE.....SYWPS..L.......F.A.K...L.......FE............K.C...DI.E.NL.I.TNVGAAAGga........................................pvAAAAP.V.AA...A....G..G...G....G.....A..A...A...P...A......P...A....E..E....K.KK..EEPE...................E..ESDD........DMG..FSLF...............................
RLA2_PLAF7/19-111                      ......................................................................NPSTKEVKNVLGA......VN.A.D.VE.....DEVLN..N.......F.I.D...S.......LK............G.K...SC.H.EL.I.TDGLKKLQni........................................ggGVAAA.P.AG...A....A..A...V....E.....T..A...E...A...K......K...E....D..K....K.EE..KKEE..................eE..EEED........DLG..FSLF...............................
A0A1S3Z2P9_TOBAC/21-111                .....................................................................p-ITAEKISSIVKA......AN.V.T.VE.....PYWPL..L.......F.A.K...L.......AE............K.R...NL.S.DL.I.MNVGAGGGg.........................................gaVAVAA.P.TG...G....A..A...A....G.....G..A...A...A...A......P...A....A..E....E.KK..EEPK...................E..ESDD........DMG..FSLF...............................
A0A162V479_PHYB8/20-105                ......................................................................EITSDKLQTLVKA......AG.I.E.VE.....PVWFS..L.......Y.A.K...A.......LA............G.Q...DL.K.AL.L.LNVGAPGA............................................GGAAA.A.TG...A....A..G...A....A.....A..S...T...E...A......A...V....E..E....A.VE..EK--...................E..ESDD........DMG..FGLF...............................
A0A0V0R719_PSEPJ/17-106                .....................................................................t-PSAADVKKVLGA......VE.A.E.VD.....DSTLN..T.......V.I.E...S.......LK............G.K...PL.N.EI.I.AAGLSKVPs..........................................lG-GGR.A.AA...A....A..P...A....Q.....Q..Q...Q...A...A......K...Q....E..A....P.VE..EKKE...................E..EEEM........DLG.gGGLF...............................
E0SP24_IGNAA/16-108                    .....................................................................d-ISEDNLRRVLEA......AG.I.A.VD.....DIRLK..A.......L.V.A...A.......VK............E.I...NI.D.DV.L.KSAFAL-Pt.........................................tpV--AV.P.AT...G....T..Q...A....P.....A..A...P...A...K......E...E....A..K....A.EE..KEEKke...............gvS..EEEL........AEG.lSALF...............................
A0A1S4C2S4_TOBAC/22-113                .....................................................................p-VTAEKIGTLVKA......AN.L.K.VE.....SYWPS..L.......F.A.K...L.......CQ............K.M...NV.D.DL.V.MNVGAGGAta.......................................atvAVAAP.P.PP...N....T..G...D....D.....I..A...T...A...P......S...A....S..D....K.KK..EEK-...................E..ESDD........ELM..FSLF...............................
D7LJ06_ARALL/17-113                    .....................................................................s-PSSGDIKTILGS......VG.A.E.SE.....DAQIE..L.......L.L.K...E.......VK............G.K...DL.A.EV.I.ASGREKLAsvps...................................gggggV-AVA.S.AP...S....G..G...G....G.....G..G...A...P...G......A...E....S..K....K.EE..KKEE..................kE..ESDD........DMG..FSLF...............................
A0A1A9WHA0_9MUSC/231-310               ......................................................................YPTIASVPHSIAN......GF.K.N.LL.....AIAAT..T.......D.V.E...F.......KE............A.A...TI.K.EY.I.KDPSKF--............................................TV---.-.-S...A....A..-...P....V.....I..E...A...A...P......V...E....E..K....K.EE..KEES...................E..EEDE........DMG..FGLF...............................
A0A1I8AJV9_9BILA/231-312               ......................................................................YPTLASAPHIIAN......GF.K.K.LM.....AIAAE..T.......D.V.S...F.......KE............A.E...RV.K.EY.L.ADPSKF--............................................AVAAA.P.AA...A....A..P...A....A.....A..A...P...A...A......A...A....P..A....K.EE..S---...................-..ESDS........DIG..LGLF...............................
A7AP88_BABBO/32-117                    .....................................................................d-ISAENITKLIKA......VD.I.N.VQ.....PFRPM..L.......F.A.K...A.......LQ............G.K...NI.A.EL.F.AGVGSSA-............................................AAAPV.A.AA...G....G..A...P....A.....A..A...E...D...K......A...E....A..K....K.PE..AEP-...................E..EEED........DMG..FSLF...............................
U3JYW6_FICAL/231-317                   ......................................................................YPTIASVPHSIIN......GY.K.R.VL.....AVAVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFVA............................................AMPVV.A.EA...A....A..P...A....A.....A..A...A...A...A......P...A....K..E....A.AK..EES-...................E..ESDE........DMG..FGLF...............................
G3XRX2_ASPNA/229-311                   ......................................................................YPTIPAVMHSLVN......SY.K.K.VL.....AVAVE..T.......E.Y.S...W.......PE............I.E...EL.K.DR.I.ANPDAY--............................................ASAAP.A.AA...A....A..P...A....A.....G..G...A...P...-......A...A....E..A....P.KE..EEE-...................-..ESDE........DMG..FGLF...............................
A9A571_NITMS/16-104                    ......................................................................EVNEANVSSVVKA......SG.A.E.VN.....EAQVK..A.......L.V.A...A.......LA............D.V...NI.D.EA.V.KAAPVAVA...........................................aAAAPA.A.DG...G....D..A...A....A.....G..G...E...A...K......K...E....E..K....P.KE..EGKT...................-..EEAA........MEG.lSSLF...............................
A0A0P0N1D1_9CREN/16-106                ......................................................................EINEENLKKILEA......AG.V.E.VD.....EARVK..A.......V.V.A...A.......LK............N.I...NI.D.EV.V.KSATAMPV............................................APAAA.P.AA...A....P..A...A....A.....E..E...K...K...E......E...E....E..E....K.AE..EKKE...................E..VSEEq......lAAG.lESLF...............................
M3Z077_MUSPF/22-113                    .....................................................................t-VTEDKINALLKA......AG.V.N.VE.....PFWPG..L.......I.A.K...A.......LA............N.V...NI.G.SL.I.SNVGAGGPt..........................................pAGGAT.P.AG...G....P..A...P....S.....T..T...A...A...P......A...E....E..K....K.ME..AKKEe.................sE..ESDD........DMG..FGLF...............................
A8MAF5_CALMQ/16-107                    .....................................................................p-ITEDNVTKILQS......AG.I.Q.VD.....EVKVK..A.......L.V.S...A.......VK............E.V...NI.D.EA.I.KTAAALPVaa........................................psAAPQA.A.AP...Q....A..A...E....A.....K..P...A...E...A......K...A....E..E....K.KA..EEKK...................-..EEE-........---..----tleslaslf......................
W2SSC6_NECAM/17-110                    .....................................................................s-PKLEDLKNILGA......VG.V.D.TD.....VETAK..L.......V.I.S...R.......LQ............G.K...SI.E.EV.I.AEGSSGLVsis......................................ggaGPAPA.A.GG...A....A..P...A....A.....A..A...A...P...A......E...E....A..K....P.AK..KEEK...................E..ESDD........DMG..FGLF...............................
A0A0F8AUE9_LARCR/342-424               ......................................................................YPTLASVPHSVIN......GY.K.R.VL.....AVAVE..T.......D.Y.S...F.......PL............A.D...KV.K.AF.L.ADPSAF--............................................AAVAA.P.AA...A....A..E...T....A.....A..A...P...A...A......K...E....E..V....K.EE..SE--...................-..ESDD........DMG..FGLF...............................
A0A022RSL9_ERYGU/154-241               ......................................................................YPTLAAAPHMFIN......AY.K.N.VL.....AVAVA..T.......D.Y.S...F.......PL............A.D...KV.K.EY.L.ADPSKFAV............................................AVAAP.V.AA...G....S..G...A....A.....P..V...A...A...A......A...K....E..E....E.KK..EEPA...................D..ESDD........DLG..FSLF...............................
A0A1U8AM89_NELNU/21-111                .....................................................................p-VTAEKISTIVKS......SN.V.S.VE.....SYWPS..L.......F.A.K...L.......AE............K.R...NI.E.DL.I.MNAGSGGGga........................................pvAVSAQ.A.GG...G....G..A...A....A.....A..S...A...A...P......A...A....E..E....K.KE..EPK-...................E..ESDE........DMG..FSLF...............................
A0A139AQU1_GONPR/25-120                .....................................................................p-VTADKIIKLVEA......AG.I.E.ME.....GIWAK..L.......F.A.K...A.......LE............G.R...DL.A.AH.F.TNFSEAPTasv.....................................svaaPVAAA.P.AA...D....A..P...A...dD.....K..K...G...G...K......K...E....E..K....K.KE..EKKE...................E..EEDD........DMG..FGLF...............................
A0A1F7ZU57_9EURO/229-312               .....................................................................f-PTLPAVIHNLIN......SY.K.K.VL.....AVAVS..T.......E.I.S...W.......PE............I.E...QL.K.DR.I.ANPDAY--............................................AAAAP.A.AG...A....A..A...A....T.....G..G...A...A...P......A...E....E..K....K.EE..EE--...................E..ESDD........DMG..FGLF...............................
E7Q1V7_YEASB/20-106                    ......................................................................EISSEKLLTLTNA......AN.V.P.VE.....NIWAD..I.......F.A.K...A.......LD............G.Q...NL.K.DL.L.VNFSAG--............................................AAAPA.G.VA...G....G..V...A....G.....G..X...A...G...G......E...A....E..A....E.KE..EEEA..................kE..ESDD........DMG..FGLF...............................
A0A0A1MWW4_9FUNG/17-107                ......................................................................NPSNEDIKKLLAS......VG.I.E.TD.....AARLD..A.......L.L.K...S.......LE............G.K...TI.A.EV.I.AEGTPKLAsi.......................................sagP---V.A.AA...G....G..A...A....A.....G..G...A...A...A......E...E....A..P....A.EE..KAEE..................kE..ESDD........DMG..FGLF...............................
A0A1D6LEZ8_MAIZE/126-209               ......................................................................YPTLAAVPHMFIN......GY.K.N.VL.....AVAVE..T.......D.Y.S...Y.......PH............A.D...KI.K.EY.L.KDPSKF--............................................-AVAA.P.VA...A....G..D...S....G.....A..A...A...A...P......K...E....E..E....K.AA..EPE-...................E..ESDE........EMG..FSLF...............................
A3GHH7_PICST/17-109                    ......................................................................SPSAADVSALLET......VG.V.E.AE.....ESRVA..S.......L.L.A...E.......LE............G.K...DV.N.EL.I.ALGNTKLAsvp......................................sggAAVAS.S.GA...A....A..S...S....G.....A..A...V...E...E......A...E....E..E....K.AE..EAK-...................E..ESDD........DMG..FGLF...............................
M7UXI7_BOTF1/38-126                    .....................................................................d-ITADKLQTLIKA......AG.IeD.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGSGGG............................................AAPAA.A.GA...A....A..G...G....-.....D..A...A...A...P......A...E....E..K....K.EE..KEEA..................kE..ESDE........DMG..FGLF...............................
A0A0D2FI72_9EURO/21-112                ......................................................................EITADKLNTLIKA......AG.IaD.VE.....PIWAT..L.......F.A.K...A.......LE............G.K...DV.K.DM.L.LNVGSGGG............................................AAAAA.P.AA...G....G..A...A....A.....G..G...A...A...A......A...E....E..A....P.KE..EEKEe................ekE..ESDE........DMG..FGLF...............................
T0S7C6_9STRA/17-106                    ......................................................................EVTAADVKNVLTK......AG.V.E.ID.....AARLA..K.......L.F.E...D.......VA............D.K...SI.D.EI.I.AAGSKKLAs..........................................fGGAAP.A.AA...A....A..P...A....A.....G..A...A...A...A......A...P....A..A....K.EE..KKE-...................-..EEEA........DLG..GGM-dmf............................
W6YZ41_COCCA/229-313                   ......................................................................YPTLPSVMHSVVN......SY.K.K.VL.....AVAVE..T.......D.Y.E...W.......DE............I.S...EL.K.DR.I.ANPDKY--............................................AS-AA.P.SG...G....A..A...T....S.....S..N...A...P...A......A...K....E..E....A.KE..EEKE...................E..SEDE........DMG..FGLF...............................
A0A1Y1IT36_KLENI/21-111                .....................................................................p-ITADKLSTIVKA......AG.I.T.VE.....SYWPG..L.......F.A.K...L.......LE............K.R...SV.E.DL.I.TNAGSGGGg.........................................ggAVATG.G.GG...G....A..A...A....G.....G..A...A...E...E......K...K....E..E....K.KE..EKEE...................E..EEDE........DMG..FSLF...............................
A0A1I7S124_BURXY/295-383               .....................................................................a-ISADKLQKLVAA......AG.V.Q.IE.....PFWPG..L.......Y.A.K...A.......LE............G.V...DV.N.EL.I.SNISSGAG............................................SAPAA.A.AP...A....G..A...A....P.....A..E...E...K...K......D...E....G..K....K.KK..EEVK...................E..ESEE.......eDMG..FGLF...............................
Q6FYB0_CANGA/17-108                    .....................................................................s-PAAADIKKVIES......VG.I.E.AD.....EARIN..E.......L.L.S...A.......LE............G.K...SL.D.EL.I.AEGQQKFAsv........................................pvGGAAA.G.GA...S....A..A...A....G.....G..A...A...A...G......E...A....A..E....E.KE..EEAA...................E..ESDD........DMG..FGLF...............................
A0A1J4MPM3_9CRYT/32-121                .....................................................................p-ITSENIKKIISA......AG.G.S.VE.....PYFPG..L.......F.A.Q...A.......LS............T.T...NV.S.DI.V.ASCGAASVa.........................................vpAAGGA.G.AC...A....A..Q...D....S.....G..A...S...A...A......V...D....D..K....K.KK..EEE-...................E..EEEG........DLG..FSLF...............................
M4EZX0_BRARP/17-112                    .....................................................................c-PTSADIKVILNS......VG.C.E.TE.....DSQIE..L.......L.L.K...E.......VN............G.K...DV.A.EL.I.AVGREKLAsvps....................................ggggVAMAS.A.PS...A....G..G...G....G.....G..A...A...P...A......E...A....K..K....E.EK..KEEK...................E..ESDD........DMG..FSLF...............................
A0A1D6C207_WHEAT/21-108                .....................................................................p-ITSEKIATVVKA......AG.I.K.VE.....AYWPA..L.......F.A.K...L.......LE............K.R...SV.D.DL.I.LSVGSGGG............................................G-APA.A.AA...A....A..P...A....A.....G..G...A...A...A......A...E....E..K....K.EE..KKEEa.................kE..ESDD........DMG..FSL-...............................
C0NGD9_AJECG/21-109                    ......................................................................EITADKLQTLLKA......AN.VqD.VE.....PIWST..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNIGSGGG............................................AAAAV.A.SG...A....G..P...V....A.....A..E...T...G...G......A...E....E..K....V.EK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A093YJ89_9PEZI/54-141                .....................................................................d-ITAEKLQTLIAA......AK.VvD.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGSGGG............................................APAAG.G.AA...A....G..G...A....A.....A..A...T...E...D......A...P....A..E....E.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A2K5JRF0_COLAP/198-280               .....................................................................y-PAVASVPHSTIN......GY.K.Q.VL.....ALSVE..T.......D.C.T...F.......LL............A.E...KV.K.AF.L.ADPSAF--............................................VAAAP.G.AT...A....T..T...A....A.....P..A...A...A...P......A...K....A..E....A.KE..GLE-...................-..----........---..----elyenmrcgl.....................
E9DTT9_METAQ/229-312                   .....................................................................f-PTLPSVMHSVVN......SY.K.N.IL.....AVAVE..T.......E.I.S...W.......PE............I.E...DL.K.DR.I.ANPEAY--............................................AAAAP.A.AA...A....A..S...G....G.....A..A...A...A...P......A...E....E..E....K.KE..ESE-...................D..EDEE........GFG..-G--ll.............................
M1CWA9_SOLTU/194-278                   ......................................................................YPTLAAAPHMIVN......GY.K.N.VL.....CVALE..T.......E.Y.T...Y.......PQ............A.Q...QV.K.EY.L.KDPSKF--............................................AIAIA.S.VA...E....S..A...T....S.....Q..G...I...V...E......T...E....D..T....K.KE..EEA-...................E..SEED........DAM..FGLF...............................
A0A095D1X4_CRYGR/20-108                ......................................................................EITGDKIVTLTQA......AK.V.E.VE.....PIWAT..L.......L.A.K...A.......LD............G.K...DI.K.DL.L.TNVGGGGA...........................................pAAGAA.P.AA...G....A..A...A....G.....G..A...A...E...A......A...P....A..E....E.KK..EEAK...................E..ESDD........DMG..FGLF...............................
A0A068RSE0_9FUNG/228-306               ......................................................................YPTAAAVPHSIIN......GY.K.N.LL.....AVSVA..S.......D.Y.T...F.......EG............S.E...KI.K.EF.L.ENPDAF--............................................VVAAA.P.AA...A....G..-...-....-.....-..-...E...E...K......K...E....E..A....K.EE..EPE-...................-..ESDE........DMG..FGLF...............................
RLA0L_HUMAN/231-316                    ......................................................................YPTVASVPHSIIN......GY.K.R.VL.....ALSVE..T.......D.Y.T...F.......PL............A.E...NV.K.AF.L.ADPSAFVA............................................AAPVA.A.DT...T....A..A...P....A.....A..A...A...A...P......A...K....V..E....A.KE..E--S...................E..ESDE........DMG..FGLF...............................
A0A0G2HQ33_9EURO/229-309               .....................................................................f-PTLPSVMHSVVN......SY.K.N.MI.....AIALE..T.......E.Y.G...W.......SE............I.D...GL.K.DR.I.ANPDAY--............................................---AA.A.AP...V....A..A...A....T.....K..G...E...E...A......K...E....D..T....K.KA..ESEA...................E..ESEE........DEG..G---m..............................
A0A182JXU0_9DIPT/17-112                .....................................................................a-PSNSDIEKILSS......VG.I.E.AD.....STRVT..K.......V.V.N...E.......LK............G.K...SV.E.EL.I.ASGREKLSsmp.....................................agggAAAAA.P.AA...A....G..G...A....A.....G..A...A...A...P......A...A....E..K....K.EE..KKEE..................sE..SEDD........DMG..FGLF...............................
A0A1Z5JP38_FISSO/231-316               ......................................................................YPTKASVPHTIVN......AY.K.A.ML.....AITLQ..L.......EnY.T...F.......DK............A.D...MV.K.EY.L.KDPSKFA-............................................-GSGG.G.GG...G....G..A...A....P.....A..A...A...A...A......A...A....A..E....P.EE..EEA-...................E..APAV........D--..----mfgggg.........................
W4KC26_9HOMO/21-109                    ......................................................................EISSDKIVALTSA......AG.V.E.LE.....PIWAT..L.......L.A.K...A.......LE............G.K...NV.K.DL.L.SNVGSGGG...........................................aAVSAA.P.AA...A....A..A...G....G.....A..P...A...A...E......A...K....E..E....E.KK..EEEK...................E..ESDD........DMG..FGLF...............................
W6LEY0_9TRYP/19-106                    ....................................................................kt--DAASLRAVAAA......AG.V.E.VS.....QGMAT..A.......F.S.K...A.......LD............T.V...SI.A.EV.L.SNMSLAGG............................................AASAG.A.AN...V....S..G...A....A.....A..P...A...A...A......K...E....A..V....K.EE..KPVE...................E..EEDD........EMG..FNLF...............................
A0A0L8GF80_OCTBM/203-291               ......................................................................YPTLASIPHLLVN......GF.K.N.LV.....AISLE..T.......D.I.E...F.......EE............A.K...EI.K.EL.L.SDPEKMAA............................................ALAAS.A.AT...T....A..A...A....A.....P..S...T...P...A......A...E....E..K....K.EE..KVES..................eE..ESDE........DMG..LGLF...............................
A0A1S3ZEB9_TOBAC/234-320               ......................................................................YPTLAAAPHMFTN......AY.K.N.VL.....AIAVE..T.......D.Y.S...F.......PL............A.D...KV.K.EY.L.EDPSKFT-............................................AVAAA.P.VA...A....A..G...S....G.....A..A...P...A...A......A...K....E..E....E.KK..DEPA...................E..ESDD........DMG..FSLF...............................
J3JU33_DENPD/231-314                   ......................................................................YPTIASAPHSIAN......GF.K.N.LL.....AIAAV..T.......D.V.D...F.......KE............A.S...TI.K.EF.I.KDPSKF--............................................AAVAA.P.VA...A....A..P...A....A.....A..A...P...E...A......K...K....E..E....K.KE..ESE-...................-..SEDD........DMG..FSLF...............................
A0A167FL90_9ASCO/229-311               ......................................................................YPTLPAVGHSIVN......HY.K.N.IL.....ALSIA..T.......D.Y.T...F.......EG............S.E...AI.K.DR.I.ANPEAY--............................................-AAAA.P.AA...A....A..-...S....G.....S..A...S...A...A......A...E....E..A....A.AE..EEP-...................E..ESDE........DMG..MGLF...............................
A0A1E4SZI0_9ASCO/17-109                ......................................................................SPSASDISTLLES......VG.V.E.IE.....QTKLD..L.......L.L.S...S.......LE............G.K...SV.D.EL.I.AEGATKLAsvp......................................aggASSGA.A.AS...S....G..A...A....A.....S..G...A...A...A......A...E....E..E....E.VV..EEK-...................E..ESDD........DMG..FGLF...............................
A0A091KU98_9GRUI/17-92                 ......................................................................SPTSKDLKKILDS......VG.I.E.TD.....DERMN..K.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGNGKLAs.........................................mpAGGAV.A.VS...A....G..G...G....S.....A..A...P...A...A......A...A....A..P....A.--..----...................-..----........---..----age............................
E6ZJZ5_SPORE/21-109                    ......................................................................EISSEKIVQLTTA......AG.C.P.VE.....PIWAS..L.......L.A.K...A.......LE............G.K...DV.K.EL.L.TNVGGGGA...........................................aVAIAA.P.AG...G....A..A...A....A.....G..G...A...A...A......E...K....E..E....E.KK..EEEK...................E..ESDD........DMG..FGLF...............................
A0A179UL05_BLAGS/17-111                ......................................................................SPSAEDIKSVLSA......VG.I.D.AD.....DERLE..K.......L.L.S...E.......LK............G.K...DL.S.EL.I.AEGTAKLAsvp......................................sggAAGGA.P.AA...G....G..A...A....A.....A..G...G...E...A......A...A....E..K....A.EE..KEEE..................kE..ESDE........DMG..FGLF...............................
A0A1R1X2Z8_9FUNG/17-108                .....................................................................d-VTVDNLNAIITS......VG.I.D.FD.....SERAS..K.......V.I.S...E.......LS............G.K...SV.E.EL.I.AEGSSKLAs.........................................vpSGGAA.P.AA...G....A..A...A....G.....G..A...A...A...A......E...A....A..P....V.KE..EVAE..................eE..ESDD........DIG..FGLF...............................
A0A158NC71_ATTCE/17-113                ......................................................................SPSQNDIEKILSS......VG.I.E.TD.....AEKLK..K.......V.I.N...E.......LN............G.K...SM.D.EL.I.AKGREKLSsm.......................................pvgGAVPA.G.AP...A....A..P...A....G.....G..A...A...A...P......A...E....E..K....K.EE..KKPAke...............esE..SEDD........DMG..FGLF...............................
J3KKX6_COCIM/17-110                    ......................................................................SPSASDIKGVLSS......VG.I.D.AD.....EERLE..K.......L.I.S...E.......LK............G.K...DL.Q.EL.I.AEGTTKLAsvps....................................ggaaAAPAA.G.AG...G....A..A...A....G.....E..A...A...P...A......A...E....E..E....K.KE..EE--...................E..ESDE........DMG..FGLF...............................
A0A154PNH0_9HYME/342-439               ......................................................................SPSQNDIEKILSS......VG.I.E.SD.....GEKLR..K.......V.I.S...Q.......LN............G.K...SI.D.EL.I.AQGHEKLSsm.......................................lvgGAVAA.G.AA...A....A..P...A....A.....G..A...A...A...A......P...A....E..E....K.KE..EKKPak..............eesE..SEDE........DMG..FGLF...............................
I2JXV1_DEKBR/229-312                   ......................................................................YPTVSAVSTHXIN......AY.Q.D.IV.....NLSLG..S.......D.Y.T...F.......EG............T.E...EL.K.DR.L.EHPEKY--............................................---AA.A.AP...A....P..S...E....E.....K..K...E...D...Q......E...E....E..K....K.DE..DEEE..................eE..DSDE........DMG..MGLF...............................
G1Q5B0_MYOLU/20-104                    .....................................................................a-VTEDKINALIKA......AG.V.N.AE.....PFWPG..L.......F.A.K...A.......LA............N.V...NI.G.SL.I.CNVGAG--............................................GPWSC.P.LH...R....C..P...S....C.....C..P...S...R...G......E...E....S..G....S.KE..EEF-...................D..ESND........DMG..FGLF...............................
V4ZKD7_9ARCH/16-110                    ......................................................................EISEDNITGVLDA......AG.V.D.VE.....ESRVK..A.......L.V.A...A.......LE............D.V...DI.E.EA.I.ETAAAAPA............................................AGAAA.G.GA...A....E..E...A....D.....A..D...E...A...D......E...E....D..E....A.DE..EEAE..................aD..DDDD........DDG..----dggeglgelf.....................
C5L4D5_PERM5/234-317                   .....................................................................i-PNEATLPYAINN......AF.R.N.VA.....ALCSD..V.......D.F.T...F.......PE............I.E...QL.K.EF.L.KDPSKF--............................................ASAAP.A.AG...A....T..A...A....G.....E..V...K...A...E......A...A....A..A....P.AE..EE--...................E..EEDV........EMD..FDLF...............................
T1J5D9_STRMM/21-104                    ......................................................................SPSAEDIEKILSS......VG.I.E.SE.....KDKVQ..K.......I.V.G...E.......LS............G.K...NV.Q.QL.I.DEGRMKLAtvp......................................sggAVSAA.P.AA...A....G..G...A....P.....A..A...S...A...A......P...A....E..K....K.KE..EEKK...................-..----........---..----gr.............................
N1QLX2_SPHMS/17-111                    ......................................................................SPSAEDIKGVLSA......IG.I.D.AD.....EERLS..K.......L.L.S...E.......LE............G.K...DI.N.EL.I.AEGSQKLAsvps....................................ggaaAAGGA.P.AA...A....S..A...G....G.....A..A...A...E...A......A...P....E..A....A.KE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A136J450_9PEZI/17-110                ......................................................................SPSAADVKAVLES......VG.I.E.AD.....EDRLD..T.......L.I.S...E.......LE............G.K...DI.N.EL.I.SEGASKLAsvp......................................sggGGGAP.A.AG...G....A..A...A....G.....G..A...A...E...A......A...P....A..E....E.KK..EEAA...................E..ESDD........DMG..FGLF...............................
A0A182RZI1_ANOFN/231-314               ......................................................................YPTLASVPHSIAN......GF.R.N.LL.....AIAAV..T.......E.V.E...F.......KE............A.E...TV.K.EF.I.KDPSKF--............................................AA-AS.S.AA...A....P..A...A....A.....A..A...A...P...A......A...K....A..E....E.KK..EES-...................E..SEDD........DMG..FGLF...............................
F7B9V8_MONDO/231-316                   ......................................................................YPTVASVPHSIIN......GY.K.R.VL.....AVAVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFAV............................................AAPAA.A.AP...A....A..A...A....P.....A..A...A...A...P......A...K....V..E....A.KE..ES--...................E..ESDE........DMG..FGLF...............................
I1NLK6_ORYGL/57-118                    ..........................................................mvspssavfqvi-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.I.GAVGGGAA...........................................iGGAAA.G.GA...A....A..G...G....A.....A..S...E...A...P......K...S....E..E....K.KE..EEK-...................E..ESED........DLG..FSLF...............................
F0TCS7_METLA/16-99                     ......................................................................EISEENVKKVLEA......AG.A.E.VD.....EARVK..A.......L.I.A...A.......LE............D.V...DI.E.EA.M.EKTA----............................................VAAAA.P.VA...A....A..A...A....P.....A..A...A...E...E......E...E....E..E....E.EE..EEEK...................-..EEEA........AAG.lGALF...............................
Q4N920_THEPA/240-320                   ......................................................................YPTSLSVDHALLE......GF.K.N.CI.....SLVLD..S.......E.F.T...F.......PQ............M.S...TL.K.QF.L.ENPDAF--............................................---SG.T.AS...G....T..V...T....S.....Q..A...V...E...E......K...K....E..E....K.EE..EEE-...................-..EEDE........DMG..FSLF...............................
F7VKW3_SORMK/229-311                   .....................................................................f-PTLPSVMHSVVN......AY.K.K.VL.....AVAVE..T.......E.I.S...W.......PE............I.E...EL.K.DR.I.ANPDAY--............................................-ASAA.P.AA...S....S..E...A....A.....P..A...A...G...K......A...E....E..K....E.EE..KE--...................-..SDED........DGG.fGGLF...............................
A0A183F257_HELBK/231-312               .....................................................................y-PTIVSVAHSLAR......GV.Q.N.ML.....GVAAV..T.......D.V.N...F.......KE............A.A...QL.K.EF.L.ADPSKF--............................................A--AA.A.AP...A....A..A...A....A.....P..A...A...A...A......A...E....T..K....K.EE..VKE-...................E..SEDE........DLG..FGL-...............................
A0A1Y2GK74_9FUNG/19-105                ......................................................................EITSDKLQTILKA......AN.V.Q.VD.....SIWTS..L.......F.A.K...A.......LE............G.K...DV.A.AM.L.SNVGAAG-............................................-AAPA.A.GG...A....A..P...A....G.....-..G...A...A...A......A...E....E..K....K.EE..KKEEp.................kE..ESDD........DMG..FGLF...............................
A0A182Q3T5_9DIPT/17-112                .....................................................................t-PSNSDIEKILSS......VG.I.E.AD.....STRVT..K.......V.V.N...E.......LK............D.K...SI.E.EL.I.ASGREKLSsmp.....................................agggAAAAA.P.AA...A....G..G...A....A.....G..A...A...A...P......A...A....E..K....K.EE..KKEE..................sE..SEDD........DMG..FGLF...............................
A0A2I4GQ42_9ROSI/234-320               .....................................................................y-PTLTAAPHAFIN......AY.K.N.AL.....GVAVA..T.......E.Y.S...F.......PQ............A.E...QV.K.EY.L.KDPSKFAA............................................MLAPV.A.VA...D....S..G...A....A.....P..S...A...T...A......K...V....E..E....K.KE..EPE-...................E..ESDD........DMV..LGLF...............................
A0A091E3U1_FUKDA/22-113                .....................................................................t-VTEDKINALIKA......AG.V.N.VE.....PFWPG..L.......F.A.K...A.......LA............N.V...SI.G.SL.I.CNVGAGGPa..........................................pAAGAA.P.AG...G....P..A...P....S.....T..A...A...A...P......A...E....E..K....K.VE..AKKEe.................sE..ESDD........DMG..FGLF...............................
B5XDP1_SALSA/231-314                   ......................................................................YPTLASVPHTIIN......GY.K.R.VL.....AVAVE..T.......D.Y.S...F.......PL............A.D...KV.K.AY.L.ADPTAF--............................................AV-AA.P.VA...A....A..E...T....A.....A..A...P...A...A......A...K....E..E....A.KE..ESE-...................E..GSDD........DMG..FGLF...............................
A0A0D2JGV7_9CHLO/17-106                ......................................................................NPGADDVKKILGA......VG.V.E.AD.....ADSVS..R.......L.L.K...E.......LE............G.K...DL.A.EL.V.AAGREKLQs..........................................vPSGAA.A.AA...A....P..A...A....G.....G..A...A...P...A......A...K....K..E....E.AK..KEEP...................S..EEDE........DMG..FSLF...............................
A0A1I7T851_9PELO/17-107                ......................................................................SPSAQDVLKVLEA......GG.L.D.CD.....MENAN..S.......V.V.N...A.......LK............G.K...TI.A.EV.I.AEGKVKLSs.........................................vpSGGSA.P.AA...S....A..P...A....A.....G..A...A...A...P......K...A....E..E....K.KK..EEPK...................E..ESDD........DMG..FGLF...............................
H3B2A6_LATCH/22-111                    .....................................................................t-VTEDKINALIKA......AG.V.N.VE.....PFWPS..L.......F.A.K...A.......LS............S.I...DI.G.SL.I.CNVGAGGP...........................................vAAGSA.P.AG...G....A..P...A....A.....S..A...A...P...A......E...E....K..K....E.EE..KKEE..................sE..ESDD........DMG..FGLF...............................
RLA24_ARATH/17-110                     ......................................................................NPSADNIKDIIGA......VG.A.D.VD.....GESIE..L.......L.L.K...E.......VS............G.K...DI.A.EL.I.ASGREKLAsvp......................................sggGVAVS.A.AP...S....S..G...G....G.....G..A...A...A...P......A...E....K..K....E.AK..KEEK...................E..ESDD........DMG..FSLF...............................
L0AWH6_THEEQ/19-109                    ......................................................................SPSKKDIEAILGS......VG.S.E.VD.....EEALD..G.......F.L.S...A.......IA............G.K...TV.H.EA.I.SSGLSKLQtv........................................ptGG-VA.V.AA...A....A..A...G....A.....P..A...A...D...K......A...D....A..G....K.KE..EPEA...................E..EEED........DMG..FSLF...............................
A2DHM5_TRIVA/200-283                   .....................................................................y-PCAASAPHLIGG......AF.K.D.IA.....AIAIA..I.......E.H.N...M.......KQ............I.E...DL.Q.KL.L.SDPEALAA............................................AA-KA.A.AA...S....A..P...A....G.....G..A...A...P...A......A...Q....E..E....P.VQ..EEA-...................-..----........---..----aapldlgdmf.....................
L8H6U1_ACACA/17-116                    .....................................................................s-PSGSDIKKILES......VG.V.E.AE.....DEKIE..L.......L.V.G...E.......LS............G.K...DV.F.EV.I.EEGKKKLGavp......................................vgaAAPAA.A.AA...A....P..A...A....G.....G..A...A...P...A......A...K....A..E....E.KK..KEE-...................E..EDDDvfg.dgggDGG..MGLF...............................
S9VTD5_SCHCR/83-168                    ......................................................................EITSDKLLALTKA......GN.V.E.VE.....PIWAS..I.......F.A.K...A.......LE............G.K...DL.K.EL.L.LNIGSG--............................................AAAGP.V.AA...G....A..P...A....A.....A..G...E...A...P......A...E....E..K....K.EE..PKVE...................E..ESDE........DMG..FGLF...............................
B4FI88_MAIZE/17-111                    ......................................................................SPSAEDLTGILES......VG.C.E.VD.....NERME..L.......L.L.S...Q.......LS............G.K...DI.T.EL.I.AAGREKFAsvp......................................cggGGVAV.A.AG...A....P..A...A....G.....G..A...A...P...A......A...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
A0A0E0IXV6_ORYNI/327-412               ......................................................................YPTIAAAPHMFLN......GY.K.N.VL.....AVAVE..T.......E.Y.S...Y.......PH............A.D...KI.K.EY.L.KDPSKF--............................................AVAAP.V.AA...A....D..S...G....A.....A..A...V...A...A......S...K....E..E....E.KK..EEPE...................E..ESDV........---..----knylgls........................
RLA2_SCHPO/17-109                      ......................................................................SPSASDIESVLST......VG.I.E.AE.....SERIE..T.......L.I.N...E.......LN............G.K...DI.D.EL.I.AAGNEKLAtv........................................ptGGAAS.A.AP...A....A..A...A....G.....G..A...A...P...A......A...E....E..A....A.KE..EAKE..................eE..ESDE........DMG..FGLF...............................
A0A0N0PCL6_PAPMA/67-161                .....................................................................s-PAAADVEKILSS......VG.I.E.AD.....SEKLK..K.......V.I.S...E.......LN............G.K...SV.D.EL.V.AQGREKLSsmp.....................................vgggVAVAA.G.AP...A....A..A...A....P.....A..A...E...E...K......K...E....E..K....E.AK..KEES...................E..SDDE........DMG..FGLF...............................
H3BGD3_LATCH/231-311                   ......................................................................YPTVASVPHSVIN......GY.K.R.VL.....AVCVE..T.......D.Y.S...F.......PL............A.D...KV.K.AF.L.ADPSSF--............................................-VVAA.P.VA...E....T..E...A....A.....A..P...A...A...A......K...E....E..E....K.KE..ESE-...................-..ESDE........DMG..FG--...............................
W6UYY1_ECHGR/64-168                    .....................................................................r-PQESDIKNILSS......VG.I.E.CE.....QARAK..L.......A.I.D...Q.......LH............G.K...NV.H.DL.I.NAGKEKMStvsfgaap............................vavatpagG-APT.T.AA...A....A..E...A....P.....K..G...G...D...K......A...P....A..P....A.KE..EKKEe.................sE..ESDA........DMG..FSLF...............................
G3IA30_CRIGR/22-113                    ....................................................................kv--MEDKFNALFKA......AG.V.N.VE.....PFWPG..L.......F.A.K...A.......LA............N.V...NI.G.SL.I.CNVGAGGPa..........................................pAAGAA.P.AG...G....P..A...P....S.....T..S...A...A...P......A...E....E..K....K.VE..AKKEe.................sE..ESDD........DMG..FGLF...............................
R0GL02_9BRAS/77-173                    ......................................................................NPSVDDLKKIFES......VG.A.E.ID.....QEKID..L.......F.F.S...L.......IK............D.R...DV.T.EL.I.AVGREKMAalss....................................ggpaVAVAS.G.GG...G....G..A...A....P.....A..A...E...P...K......A...A....E..S....K.KK..EEEK...................E..ESED........DGG.mMSLF...............................
A0A0D9X433_9ORYZ/234-319               ......................................................................YPTIAAAPHMFLN......GY.K.N.VL.....AVAVE..T.......E.Y.S...Y.......PH............A.D...KI.K.EY.L.KDPSKF--............................................AVAAP.V.AA...A....A..A...G....G.....S..A...A...P...A......A...K....E..E....E.KK..EEPE...................E..ESDG........DLG..MSLF...............................
G1TRW6_RABIT/17-88                     .....................................................................l-PSAKDIKKILDS......MG.I.E.AD.....DDRLN..K.......V.I.S...E.......LN............G.K...KI.E.DV.I.AQGIGKLAs.........................................vpAGMAV.A.VS...A....T..A...G....S.....V..A...P...A...A......-...-....-..-....-.--..----...................-..----........---..----rsap...........................
A0A1B8E1V6_9PEZI/21-108                .....................................................................d-ITAEKLQTLITA......AK.VlD.VE.....PIWTS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.LNVGSGGG............................................APATG.G.AG...A....G..G...A....A.....A..A...T...E...D......A...P....A..E....E.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A2H9LAG7_9ARCH/16-97                 .....................................................................p-VEEAGVKKVLEA......AG.V.Q.AD.....TSKIK..A.......L.V.A...S.......LK............D.V...NI.D.EA.I.KKASIV--............................................QV---.A.AP...A....A..A...A....-.....S..A...A...P...A......K...E....E..K....K.VD..EKKT...................-..EEEA........ASG.lSALF...............................
A0A287AJ36_PIG/21-103                  ...................................................................tvp---EYKINALIKS......AN.V.N.VE.....PFWPG..L.......F.A.N...A.......LA............S.V...NI.E.SL.I.CKVGAG--............................................GH-AL.S.CP...S....T..T...A....A.....P..A...E...E...K......K...V....D..A....E.KE..ESE-...................-..ESDD........GMG..FGLF...............................
G3BEH3_CANTC/265-349                   ......................................................................EITSDNLVSIAKA......AK.A.D.VD.....SVWAD..V.......F.A.K...A.......LE............G.K...DL.K.DL.L.FSLAAA--............................................APASG.S.AP...A....A..A...A....G.....G..A...A...E...E......A...V....A..E....V.EE..EAP-...................E..ESDD........DMG..FGLF...............................
W1NDZ0_AMBTC/21-111                    .....................................................................a-ITPEKIAAVVKA......AN.I.Q.VD.....SFWPG..L.......F.Y.K...L.......VQ............K.R...NI.D.DL.I.VSAGSGGGg.........................................apVAVAA.P.AP...A....A..A...A....G.....G..A...A...A...A......P...A....A..E....E.KK..EEPK...................E..ESDD........DMG..FSLF...............................
W5I301_WHEAT/33-119                    ...................................dlqrqlvsaacaedksggvqssftmvspksaifqv-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.V.IGGASAGPi.........................................ggGAAAG.G.AA...A....S..G...G....A.....A..A...E...A...P......K...G....E..E....K.KE..EEK-...................E..ESED........DLG..FSLF...............................
A0A1V6TGX7_9EURO/21-106                ......................................................................EVTADKLQTLIGA......AK.VpE.IE.....PIWTS..I.......F.A.K...A.......LE............G.K...DI.K.EL.L.TNVGSAG-............................................PAAPA.G.AA...A....G..G...A....A.....A..P...A...D...A......P...E....E..K....K.EE..E--K...................E..ESDE........DMG..FGLF...............................
A0A1S3W2Q3_ERIEU/22-109                .....................................................................t-VTEDKINALIKA......AG.V.T.VE.....PFXPG..L.......F.A.K...A.......LA............G.G...SI.G.GL.I.CNVGAGGP...........................................aPAPGA.A.TA...G....S..A...A....L.....A..A...S...A...A......L...A....X..E....K.KV..EAKK...................-..ESDD........DMG..FGLF...............................
A0A1E4SLM7_9ASCO/17-106                ......................................................................SPSAADIKTVLES......VS.I.E.VE.....EEKIT..Q.......L.L.A...E.......VE............G.K...DV.E.EL.I.AEGNTKLAsv........................................ptGAAAS.S.SG...A....A..A...A....S.....S..G...D...A...P......A...E....E..A....A.AE..EEE-...................-..ESDD........DMG..MGLF...............................
A0A061GYX7_THECC/7-79                  ...................................................................eqk-------------......--.-.-.--.....-LMPS..L.......F.A.K...L.......LE............G.K...SI.D.GL.V.MNVNFGGG...........................................vALVAV.V.TS...V....D..V...G....F.....N..A...Ai.iA...S......T...V....E..K....K.KE..DEK-...................E..ESDD........DMG..FSLF...............................
A0A1L9SJX0_9EURO/21-107                ......................................................................EVTADKLQTILTA......AK.IqE.VE.....PIWTT..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.TNVGSG--............................................GAPAA.A.AA...A....G..G...V....A.....A..E...A...A...P......A...E....A..A....E.EK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A074X240_9PEZI/17-109                ......................................................................QPSAEDIKSVLSS......VG.V.D.AE.....GDRLE..K.......L.I.S...E.......LS............G.K...NI.Q.EL.I.SEGSAKLAsvp......................................sggAGAAA.A.GG...A....P..A...A....G.....A..A...A...E...A......A...P....A..E....E.KA..EE-K...................E..ESDD........DMG..FGLF...............................
Q16VR0_AEDAE/47-88                     .....................................................................a-VTDEKISTILKA......AN.V.-.-E.....PYWRA..L.......F.A.K...A.......LE............G.I...NV.K.DL.I.TNIG----............................................-----.-.--...-....-..-...-....-.....-..-...-...-...-......-...-....-..-....-.--..----...................-..----........---..----s..............................
A0A1B8GQN4_9PEZI/17-109                ......................................................................SPSAADVSAVLSS......VG.I.E.AD.....SDRLD..A.......L.I.A...E.......LK............G.K...DI.N.TL.I.SEGAAKLAsvp......................................sggGGGAA.A.AG...G....A..A...A....G.....G..A...A...E...A......A...P....V..E....E.KE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A250XP39_9CHLO/233-313               ......................................................................YPTLASIPHSVIN......GY.K.N.VL.....AVALA..T.......E.Y.S...F.......PA............A.D...KV.K.AI.L.ADPSAF--............................................AAAAA.P.AA...A....A..-...-....A.....A..E...A...P...A......A...A....K..K....E.EV..K---...................E..ESEE........DMG..FSLF...............................
A5DAS4_PICGU/229-309                   ......................................................................YPTLPSVGHSVVN......HY.K.N.VL.....ALSIA..T.......D.Y.T...F.......EG............S.E...AI.K.DR.L.ANPEAY--............................................-AAAA.P.AA...A....A..A...S....E.....E..A...A...P...A......A...A....E..E....E.AE..E---...................-..SEDD........DMG..FGLF...............................
L8HCT7_ACACA/27-121                    .....................................................................s-VDADKLQTVLSA......AG.V.D.VP.....AFYTK..L.......Y.A.K...A.......VT............DvK...KL.D.DI.V.SASTTVSA...........................................gGAAPA.A.GS...A....P..A...A....A.....A..A...P...A...A......A...K....E..E....A.KK..EE--...................E..EDDDvfg.dgggDGG..MGLF...............................
E3MRJ2_CAERE/17-106                    .....................................................................d-PKADDLKKILSS......VG.I.D.SD.....VENIN..N.......V.V.A...S.......LQ............G.K...NM.E.EI.F.AEGMTRIAs.........................................vpSGRAP.A.AS...S....A..A...P....A.....A..A...A...A...D......T...K....A..A....K.KE..EPK-...................E..ESDD........DMG..FGLF...............................
A0A1L9WXS0_ASPAC/229-311               .....................................................................f-PTLPSVVHSVVN......SY.K.K.VL.....AVAIE..T.......E.I.S...W.......PE............I.E...EL.K.DR.I.ANPDAY--............................................AS-AA.P.AA...A....A..A...P....A.....G..G...D...A...P......A...A....E..A....P.AE..EAE-...................-..ESDE........DMG..FGLF...............................
V5FLF3_BYSSN/17-107                    .....................................................................a-PSAEDVKAVLSS......VG.I.D.AD.....EERLN..K.......L.I.A...E.......LE............G.K...DI.Q.EL.I.AEGTTKLAs..........................................vPSGGA.G.AA...A....A..P...A....A.....A..G...G...A...A......A...E....E..K....K.EE..KEEE..................kE..ESDE........DMG..FGLF...............................
A0A0U1M965_TALIS/17-110                ......................................................................SPSAADIKGVLES......VG.I.D.AD.....EDRLN..T.......L.L.S...E.......LE............G.K...DI.Q.EL.I.AEGTSKLAsvp......................................sggAGGAA.P.AA...G....G..A...A....A.....G..G...A...A...E......A...A....P..E....K.EA..EKEE...................E..ESDE........DMG..FGLF...............................
H2MY80_ORYLA/22-112                    .....................................................................t-VTADKLNALIKA......AG.V.T.VE.....PFWPT..L.......F.A.K...A.......LS............S.I...DI.G.SL.I.CNVGAGGA...........................................aPAGAP.A.AG...A....A..A...A....A.....A..D...A...P...A......K...E....E..E....K.KE..EKKEe.................sE..ESDD........DMG..FGLF...............................
A0A0L0NDZ0_9HYPO/17-109                ......................................................................SPSAKDVKAVLSS......VG.I.E.AD.....DERLN..Q.......L.I.S...E.......LK............G.K...DV.N.EL.I.AAGSEKLAsv.......................................psgGAGGA.P.AA...G....G..A...A....A.....G..G...A...A...A......E...A....P..A....E.EK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A074TDT9_HAMHA/232-313               .....................................................................f-PTTASAPHSILE......AF.K.F.CT.....SLVLE..S.......D.Y.S...F.......PQ............M.Q...RI.K.DI.L.ENPEAF--............................................---AA.V.AA...A....A..A...P....A.....E..G...P...A...A......A...A....E..A....P.KE..EEP-...................E..EEED........DMG..FSLF...............................
A0A0E0LFA5_ORYPU/61-118                .............................................................ssavfqvii-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.GAVGGGAAi..........................................gGGAAA.G.AT...A....G..G...A....A.....A..E...A...P...K......A...E....E..K....K.EE..-EK-...................E..ESED........DLG..FSLF...............................
H0GT96_SACCK/17-110                    .....................................................................a-PSAADIKAVVES......VG.A.E.VD.....DARIN..E.......L.L.S...S.......LE............G.K..gSL.E.EI.I.AEGQNKFAsvp......................................vggASAAG.A.AG...A....S..A...A....A.....A..G...G...D...A......A...E....E..E....K.EE..EA-K...................E..ESDD........DMG..FGLF...............................
A0A066XRG7_COLSU/21-109                ......................................................................EITADKLQTLIKA......AK.IeD.VE.....PIWSS..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.SNVGSGGG...........................................aAAPAA.G.GA...A....A..A...G....G.....A..A...E...A...A......A...E....E..A....P.KE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A1R3J2Q2_9ROSI/17-112                .....................................................................c-PSAGDLKDILGS......VG.A.E.AD.....DDRIE..L.......L.L.S...E.......VK............G.K...DI.T.EL.I.ASGREKLAsvp.....................................sgggAVAAA.A.PT...A....A..G...G....G.....G..A...A...P...A......A...E....A..K....K.EE..KVEE..................kE..ESDD........DMG..FSLF...............................
F6VR08_CALJA/231-317                   ......................................................................YPTVASVPHSIIN......GY.K.R.VL.....ALSVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFAA............................................AA-PV.A.AA...T....T..A...A....P.....A..A...A...A...A......A...P....A..K....V.EA..KEES...................E..ESDE........DMG..FGLF...............................
A0A1J7IM32_LUPAN/21-109                .....................................................................a-ITAEKISTVLKA......AQ.V.N.VE.....SYWPS..L.......F.A.K...L.......AQ............K.R...NI.D.DL.I.LNSGGGGA............................................AAVAV.A.AP...A....A..A...A....V.....G..A...A...A...A......A...P....A..V....Q.EK..KDEA..................kE..ESDD........DMG..FSLF...............................
A0A0N4W4T8_HAEPC/17-111                .....................................................................s-PKLEDIKNILGA......VG.V.D.TD.....AEAAK..L.......V.I.S...R.......LQ............G.K...NI.E.EV.I.AEGSAGLVsvs......................................ggaPAAAA.P.AA...G....G..A...A...pA.....A..A...A...P...K......E...E....A..K....P.AK..KEEK...................E..ESDD........DMG..FGLF...............................
A0A150J3R7_9EURY/16-102                ......................................................................EINEANLKNVLKA......AG.V.E.FD.....EARIK..A.......L.V.S...S.......LE............G.V...DI.E.EA.I.SSASMP--............................................-VAHA.P.AA...A....P..A...A....G.....A..P...E...Q...K......H...S....D..S....K.KE..EKK-...................E..EAEAs......aLEG.lGALF...............................
I1IXG5_BRADI/17-112                    ......................................................................SPSAEDLTTILES......VG.C.E.ID.....NEKME..L.......M.L.S...Q.......VK............G.K...DI.A.EL.L.AAGREKFAsvps....................................ggggVAVAA.A.AP...A....S..G...G....G.....G..A...A...P...A......A...E....K..K....E.EK..VVEK...................E..ESDD........DMG..FSLF...............................
A0A158PCV1_ANGCA/231-312               ......................................................................YPTLASVPHLLAK......GV.Q.N.ML.....GIAAA..T.......D.V.N...F.......KE............A.A...QL.K.EF.L.ADPSKF--............................................T--AV.S.AP...A....S..A...A....V.....A..P...A...A...V......S...V....E..P....T.KE..EAK-...................E..ESDE........DLG..FG--f..............................
A0A026WSS2_OOCBI/17-112                ......................................................................SPSQNDIEKILSS......VG.I.E.TD.....AEKLK..K.......V.I.S...E.......LN............G.K...SI.D.EL.I.AQGKEKLSsm........................................pvGGAAA.A.AA...A....A..P...A....S.....G..A...A...A...P......V...E....E..K....K.EE..KKPAke...............esE..SEDD........DMG..FGLF...............................
A0A0D0CNL4_9AGAR/17-111                ......................................................................SPSKKDIKKVLSA......VG.I.E.SD.....DERLD..K.......L.L.S...E.......LE............D.K...DI.N.TL.I.AEGSSKLSsvps....................................gggaAAAGG.A.AP...A....A..A...G....G.....A..A...E...A...P......K...E....E..E....K.KE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A2G3AJI4_CAPAN/17-111                ......................................................................SPSAKDLKNILGC......VG.A.E.AD.....DDRIQ..L.......L.L.S...Q.......VE............G.K...DI.T.EL.I.AAGREKLAsvp.....................................agggGAVAV.A.AP...A....G..G...T....A.....A..V...A...S...A......E...E....K..K....E.EK..KEEK...................E..ESDD........DIG.kF---if.............................
A0A1D6LEZ6_MAIZE/132-215               ......................................................................YPTLAAVPHMFIN......GY.K.N.VL.....AVAVE..T.......D.Y.S...Y.......PH............A.D...KI.K.EY.L.KDPSKF--............................................-AVAA.P.VA...A....G..D...S....G.....A..A...A...A...P......K...E....E..E....K.AA..EPE-...................E..ESDE........EMG..FSLF...............................
K1QWX2_CRAGI/231-313                   ......................................................................YPTAASAPHSIAN......GF.K.R.LL.....AIAVE..T.......D.Y.T...F.......PA............A.E...KT.K.EY.L.KDPSKF--............................................AV-AA.A.PA...A....A..A...S....S.....A..P...A...A...K......K...E....E..K....K.PE..PES-...................-..ESDD........DMG..FGLF...............................
A0A2I4E645_9ROSI/34-131                ......................................................................SPSTENLKDILGS......VG.A.K.VV.....DDKIE..M.......L.L.S...E.......VK............G.K...DI.T.EL.I.ASGREKLAyvpssg................................ggsiaiATIGG.G.DG...A....A..A...A....A.....T..A...A...E...P......N...K....E..E....K.VE..EK--...................E..ESDD........DMG..FSLF...............................
A0A1A6HUS9_NEOLE/43-80                 ...........................................................atgplcttlva-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.--------............................................-----.-.--...-....-..-...-....S.....V..A...E...E...K......K...V....E..A....K.KE..ES--...................E..ESDD........DMG..FGLF...............................
A0A1V6NP66_9EURO/21-106                ......................................................................EVSADKIQTLISA......AN.VqE.VE.....PIWAS..I.......F.A.R...A.......LE............G.K...DI.K.EL.L.TNVGSA--............................................-GPAA.A.AP...A....G..G...A....G.....A..A...A...P...A......E...A....K..A....E.EK..EEEK...................E..ESDE........DMG..FGLF...............................
A0A0L0FZJ3_9EUKA/21-106                ......................................................................EISTENIEKIVSA......AG.V.K.ID.....SYWYG..L.......F.S.K...A.......LS............G.S...DV.N.QL.L.SAVGSA--............................................-SAGP.A.AG...A....A..P...A....S.....G..D...A...P...A......A...A....E..K....A.AE..PEPE..................eE..SEEE........DMG..FGLF...............................
A9PDS2_POPTR/21-108                    .....................................................................a-ISSDKIATLVKS......AN.V.N.VE.....SYWPS..L.......F.A.K...L.......AE............K.R...NV.G.DL.I.MNIGAGGGa..........................................aAPIAV.S.SS...A....P..A...A....A.....S..A...A...A...P......A...V....E..E....K.KE..EAP-...................-..ESDD........DMG..FSLF...............................
C4Y8D5_CLAL4/20-105                    ......................................................................EISADNLNKLVSK......AN.V.E.VE.....GIWAD..L.......F.A.K...A.......LE............G.K...DL.K.EF.F.FNFSAA-P............................................AAGAA.P.AA...G....A..A...A....A.....G..A...E...E...A......A...A....E..E....K.EE..EAK-...................E..ESDD........DMG..FGLF...............................
G5B782_HETGA/231-316                   ......................................................................YPTVASVPHSIIN......GY.K.R.VL.....ALSVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAF--............................................VAAAP.V.TA...G....N..T...A....A.....P..A...A...A...A......A...P....A..K....V.EA..KEES...................E..ESDE........DMG..FGLF...............................
M5G0B2_DACPD/21-112                    ......................................................................EITADKINAITTA......AK.V.D.VE.....PIWAT..L.......L.A.K...A.......LA............G.R...EV.K.EM.L.MNVGAGGGap........................................vaGSAPA.A.AA...G....G..V...A....V.....E..A...A...A...E......E...K....E..E....E.KK..EEEK...................E..ESDD........DMG..FGLF...............................
B7FV43_PHATC/27-113                    .....................................................................d-VSTEQIGALLEA......TG.NtE.VE.....AFYPI..I.......F.A.N...F.......LN...........sP.E...KI.G.EL.I.ALPAAG--............................................-GGGG.G.GS...A....G..G...A....D.....N..A...E...A...A......E...V....V..K....E.EE..KEE-...................-..EVEM........DLG..GGM-dmf............................
A0A1H3DKR3_9EURY/16-110                ......................................................................EINEDNLTAVLDA......AG.V.D.VE.....ESRVK..A.......L.V.A...A.......LE............D.V...DI.E.EA.I.ETAAAAPA............................................AGAAA.G.GA...A....E..A...S....G.....E..E...E...E...A......D...E....E..E....E.AD..EAEE..................aE..EEDE........DEG.dG---geglgelf.......................
A0A0E3S6G0_9EURY/16-101                .....................................................................a-ISEEAVTAVLKA......AG.V.E.VN.....EARAK..A.......L.V.A...A.......LD............G.V...DI.E.EA.I.AKAAFA--............................................APAAA.A.TT...A....A..A...P....A.....A..A...A...E...A......A...V....E..E....P.EE..EDT-...................S..EEDG........MAG.lGALF...............................
K1VVK3_TRIAC/17-110                    ......................................................................SPSAADVKSLLET......VG.I.E.AD.....AAQLD..K.......L.I.S...E.......LE............G.K...DV.N.EL.I.AEGSAKLAsvp......................................sggAGGAA.P.AA...G....G..A...A....A.....A..G...G...D...A......P...A....A..E....E.KK..EEAK...................E..ESDD........DMG..FGLF...............................
A0A133UX79_9EURY/16-106                ......................................................................EVTEENISKVLEA......AG.V.E.VD.....EARVK..A.......L.T.T...A.......LE............D.V...NI.D.EA.I.ETAAMP--............................................TAAPA.P.EP...S....E..E...E....E.....E..K...K...K...A......E...K....E..E....K.EE..EKEE...................E..EEEEaa....egAAG.lG---dlf............................
T2DPD1_PHAVU/21-111                    .....................................................................a-VTSDNIVTLLKS......AK.V.Q.VD.....SFWPT..L.......F.A.K...L.......AA............K.K...NL.G.DL.I.ANAAGGGApv........................................avAAAPV.A.AA...A....G..G...G....A.....A..A...A...P...A......A...E....E..K....K.KE..EPE-...................E..ESDD........DMG..FGLF...............................
Q0TZB5_PHANO/229-315                   .....................................................................f-PTLPSVMHSVVN......SY.K.K.VL.....AVAIE..T.......D.Y.E...W.......EE............I.A...EL.K.DR.I.ANPDKYAS............................................AGPAA.G.GA...A....A..S...S....G.....G..A...E...A...A......K...A....E..E....K.EE..EKE-...................E..SEDD........DMG..FGLF...............................
M2W1D9_GALSU/18-114                    .....................................................................k-PTADDLKKILTS......VS.I.E.VE.....EDRVM..Q.......V.V.E...A.......LN............G.K...DL.E.EL.I.EQGLQKMTsvps....................................gataAIAAT.V.GA...A....P..A...T....V.....G..R...E...S...K......E...D....A..K....A.AE..KEEA..................aE..ESDE........DLG..FGLF...............................
H0XI84_OTOGA/17-114                    ......................................................................SPSAKDIKKILDS......VG.I.E.AD.....DDRLN..R.......V.I.S...E.......LN............G.K...NI.E.DV.I.AQGIGKLArvpa....................................ggtvAVSAA.P.GA...A....V..P...A....A.....G..S...T...P...A......A...A....E..E....K.KD..EEKEe.................sE..ESDD........DMG..FGLF...............................
A0A0D9S5Q0_CHLSB/223-306               ......................................................................YPSVASVPHSTII......GY.K.Q.VL.....ALSVE..T.......D.C.T...L.......LL............A.E...KV.K.AF.L.ADPSAF--............................................VAAAP.G.AT...A....T..T...A....A.....P..A...A...A...P......A...K....A..E....A.KE..ELE-...................-..ELDE........NMR..FGLF...............................
A0A075AD76_9TREM/519-589               ................................................................mekttr-------------......--.-.-.--.....-----..-.......-.V.S...L.......NE............R.T...SV.K.EY.L.ADPSKFVAait......................................attPQTAS.G.TP...S....T..V...Q....E.....K..Q...A...A...P......A...A....A..P....P.AE..ES--...................-..ESDS........DMG..MGLF...............................
A0A2I3MMC5_PAPAN/231-316               ......................................................................YPTVASVPHSIIN......GY.K.R.VL.....ALSVE..T.......D.Y.T...F.......PL............A.E...KV.K.AF.L.ADPSAFVA............................................AA--P.V.AA...T....T..T...A....A.....P..A...A...A...A......A...P....A..K....V.EA..KEES...................E..ESDE........DMG..FGLF...............................
V7CTV4_PHAVU/21-113                    .....................................................................s-VSEDNIVTLLKT......AK.V.Q.VD.....SFWPT..L.......F.A.K...L.......AQ............K.K...NL.G.DL.I.ANAAGGGApva......................................vaaAPVGA.A.GG...G....A..A...A....A.....A..A...A...P...A......A...E....E..K....K.KE..EPE-...................E..ESDD........DMG..FGLF...............................
B2WCC3_PYRTR/229-314                   .....................................................................f-PTLPSVMHSVVN......SY.K.K.VL.....SVAIE..T.......D.Y.E...W.......EE............I.S...EL.K.DR.I.ANPDKY--............................................AAAAP.A.GG...A....A..A...A....S.....G..S...A...P...A......A...K....E..E....A.KE..EEKE...................E..SEDD........DMG..FGLF...............................
K5X6P0_AGABU/229-311                   ......................................................................YPTVVSVAHSLVN......AY.K.N.LV.....AVSLA..T.......E.Y.T...F.......EG............A.A...KI.K.EY.L.ENPDAF--............................................--AAV.A.AA...A....A..P...A....A.....A..A...E...A...P......K...E....E..E....K.KE..EEE-...................E..ASDD........DMG..FGLF...............................
A0A061DRB7_THECC/55-124                .............................................vtssfslitpnsaifqviirgggdg-------------......--.-.-.--.....-----..-.......-.-.-...-.......--............-.-...--.-.--.-.-------Gf.........................................lgKRVAA.L.AG...G....T..T...P....T.....V..E...T...P...A......A...E....E..K....K.KE..EKVE...................E..SDDE........DMG..FSLF...............................
RLA1_CHICK/22-113                      .....................................................................t-VTEDKINALIKA......AG.V.N.VE.....PFWPG..L.......F.A.K...A.......LA............N.I...DI.G.SL.I.CNVGAGGGa..........................................pAAAAP.A.GG...A....A..P...A....G.....G..G...A...A...P......A...E....E..K....K.EE..EKKEe.................sE..ESDD........DMG..FGLF...............................
J3KEF3_COCIM/229-311                   .....................................................................f-PTLPSVMHSLVN......GY.K.K.AL.....AIAVE..T.......D.Y.S...W.......SE............I.E...EL.K.DR.I.ANPDAY--............................................AVAAP.T.GP...A....E..T...K....G.....E..E...K...A...A......A...K....E..-....-.-E..EEE-...................E..ESEE........DGG.fGGLF...............................
A0A1R0GLY5_9FUNG/21-107                ......................................................................EINADNLQTIINA......AN.V.H.VE.....SIYFS..L.......F.A.K...A.......LA............G.R...DV.S.EM.L.MNVGTASA............................................AAPVA.G.GA...A....S..S...D....A.....P..A...A...D...A......P...A....A..E....A.AE..EEA-...................E..ESDD........DMG..FGLF...............................
A0A151B8Y5_9ARCH/18-100                ......................................................................EITENALENVLQA......AG.V.K.PD.....SVRIK..A.......L.V.A...A.......LS............E.I...DI.D.EA.L.KAPLLT--............................................----A.A.VP...A....A..A...P....E.....K..A...E...E...E......E...E....E..K....P.RE..EEEE...................E..EEED........LQG.lSALF...............................
A0A0D7BIE2_9AGAR/17-110                ......................................................................SPSAADIKKVLSA......GG.V.E.VD.....EERLS..S.......L.I.S...E.......LE............G.K...DI.N.TL.I.TEGNSKLAsvp.....................................sgggGGGAA.P.AA...G....G..A...A....P.....A..A...A...A...E......K...V....E..E....K.KE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A0L0S0X3_ALLMA/17-106                .....................................................................a-PTAADVTAILAS......VG.V.D.AD.....SAQLN..K.......V.I.A...E.......LD............G.K...NV.E.EV.I.AEGMTKLAs.........................................vpSGGAA.A.AS...A....P..A...A....G.....A..A...P...A...A......A...E....A..A....P.VE..EEK-...................E..ESDD........DMG..FGLF...............................
A0A175WEH6_9PEZI/21-108                ......................................................................EITADKLQTLIKA......AN.V.D.VE.....PIWSQ..L.......F.A.K...A.......LE............G.K...DV.K.DL.L.SAVGSGGG............................................AA-AA.P.AA...G....A..A...A....A.....G..G...A...A...A......E...E....A..K....E.EA..KEEE..................kE..ESDE........DMG..FGLF...............................
A0A1S9D6K4_ASPOZ/21-108                ......................................................................EVTADKLQTLLTA......AK.VqE.VE.....PIWTS..I.......F.A.K...A.......LE............G.K...DI.K.DL.L.TNVGSGGA............................................APAGA.A.AA...A....G..G...A....A.....A..P...A...E...A......A...A....E..E....K.KE..EEK-...................E..ESDE........DMG..FGLF...............................
A0A1V6PXR3_9EURO/17-108                .....................................................................t-PSAADIKSVLSS......VG.I.D.AE.....GDRLD..K.......V.I.A...E.......LE............G.K...NL.Q.EL.I.SEGSTKLAsv.......................................psgG-AGA.A.AP...A....A..A...A....A.....G..G...A...A...A......P...A....E..E....K.KE..EKVE...................E..ESDE........DMG..FGLF...............................
C1EI19_MICCC/20-105                    ......................................................................EVTGDKMDTIIKA......AG.V.T.IE.....PYWTM..L.......F.S.K...F.......LS............G.K...PV.E.EL.I.ANVGAGGG............................