GenomeNet

Database: Pfam
Entry: SH3_11
LinkDB: SH3_11
Original site: SH3_11 
#=GF ID   SH3_11
#=GF AC   PF18103.1
#=GF DE   Retroviral integrase C-terminal SH3 domain
#=GF AU   El-Gebali S;0000-0003-1378-5495
#=GF SE   ECOD:EUF00899
#=GF GA   25.00 25.00;
#=GF TC   58.20 78.10;
#=GF NC   24.90 23.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Integrase
#=GF WK   SH3_domain
#=GF RN   [1]
#=GF RM   20118915
#=GF RT   Retroviral intasome assembly and inhibition of DNA strand
#=GF RT   transfer.
#=GF RA   Hare S, Gupta SS, Valkov E, Engelman A, Cherepanov P;
#=GF RL   Nature. 2010;464:232-236.
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This is the carboxy-terminal domain (CTD) found in retroviral
#=GF CC   integrase, an essential retroviral enzyme that binds both
#=GF CC   termini of linear viral DNA and inserts them into a host cell
#=GF CC   chromosome. The CTD adopts an SH3-like fold. Each CTD makes
#=GF CC   contact with the phosphodiester backbone of both viral DNA
#=GF CC   molecules, essentially crosslinking the structure [1].
#=GF SQ   10
#=GS J9VBQ0_9RETR/1072-1133      AC J9VBQ0.1
#=GS POL_SFVCP/1064-1126         AC Q87040.1
#=GS A8HC78_9RETR/1060-1122      AC A8HC78.1
#=GS Q9J4C7_9RETR/1065-1127      AC Q9J4C7.1
#=GS POL_FFV/1064-1126           AC O93209.1
#=GS POL_FOAMV/1064-1126         AC P14350.2
#=GS POL_FOAMV/1064-1126         DR PDB; 3OYD A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 4ZTJ A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OYK A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 4E7I A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OYH A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 4E7H A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3L2Q A; 313-374;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OY9 A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 5FRO A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 5MMA A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 5UOQ A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 4BE2 A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 5FRN A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OYL A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 5FRM A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 4BDZ A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3L2W A; 313-374;
#=GS POL_FOAMV/1064-1126         DR PDB; 4E7J A; 313-374;
#=GS POL_FOAMV/1064-1126         DR PDB; 5NO1 A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3S3N A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 5UOP A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OYE A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OYC A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OS1 A; 313-374;
#=GS POL_FOAMV/1064-1126         DR PDB; 4BAC A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 4E7L A; 313-374;
#=GS POL_FOAMV/1064-1126         DR PDB; 4BE0 A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OYJ A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OYI A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OYG A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OS2 A; 313-374;
#=GS POL_FOAMV/1064-1126         DR PDB; 4IKF A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3S3M A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 4E7K A; 313-374;
#=GS POL_FOAMV/1064-1126         DR PDB; 4BE1 A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3S3O A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 5MMB A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3L2U A; 313-374;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OYF A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 4BDY A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OYB A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 4ZTF A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3L2V A; 313-374;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OYM A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OYA A; 313-375;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OS0 A; 313-374;
#=GS POL_FOAMV/1064-1126         DR PDB; 3L2R A; 313-374;
#=GS POL_FOAMV/1064-1126         DR PDB; 3OYN A; 313-375;
#=GS POL_SFV1/1063-1125          AC P23074.3
#=GS D5JWU6_9RETR/1064-1125      AC D5JWU6.1
#=GS Q7SIS6_9RETR/1063-1125      AC Q7SIS6.1
#=GS A0A0G3Y3B8_9RETR/1063-1125  AC A0A0G3Y3B8.1
J9VBQ0_9RETR/1072-1133                 ..RSWTPSPGLLVQERVARPAQLRPKWRKPTPIKKVLNERTV-IIDHLGQDKVVSIDNLKPAAHQ.
POL_SFVCP/1064-1126                    ..RSWSPVVGQLVQERVARPASLRPRWHKPSTVLEVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ.
A8HC78_9RETR/1060-1122                 ..RSWRPSVGLLVQERVARPSQLRPKWKKPVIICELINDRTVVIVDKAGNKRTVSIDNLKLTPHQ.
Q9J4C7_9RETR/1065-1127                 pk--WTPCPGLLVQERVNRPAQLRPKWKKPTPILKVLNPKTVVIAGPGGQERIVSIDNLKKTPH-h
POL_FFV/1064-1126                      .s-GWSPYVGQLVQERVYRPSQLRPKWRKPTKVLEILNPRTVIIVDHLGQRKSVSIDNLKPTAHQ.
POL_FOAMV/1064-1126                    ..RSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ.
#=GR POL_FOAMV/1064-1126         SS    ..TEE---TT-EEEEB-SS--TTS-SBESEEEEEEEEETTEEEEEESSSSEEEEEGGGEEE-TT-.
POL_SFV1/1063-1125                     ..RSWSPSVGQLVQERVARPASLRPRWHKPTAILEVVNPRTVIILDHLGNRRTVSVDNLKLTAYQ.
D5JWU6_9RETR/1064-1125                 .k-TWTPSVGLLVQERVYRPSQLRPKWKKPTPILEVLNERTVVI-DNNGQRRTVSVDNLKYTPHQ.
Q7SIS6_9RETR/1063-1125                 ..RSWTPAVGLLVQERVARPASLRPRWHKPVKILEVLNPRTVVILDHLGNNRTVSVDNLKLTANQ.
A0A0G3Y3B8_9RETR/1063-1125             ..RSWLPSVGLLVQERVARPSQLRPKWRKPTPILEVVNDRTVVILDNQGQRRTVSIDNLKLTPHQ.
#=GC SS_cons                           ..TEE---TT-EEEEB-SS--TTS-SBESEEEEEEEEETTEEEEEESSSSEEEEEGGGEEE-TT-.
#=GC seq_cons                          ..RSWoPuVGLLVQERVARPAQLRPKW+KPTsILEVLNPRTVVIlDHLGpcRTVSIDNLKhTuHQ.
//
DBGET integrated database retrieval system