GenomeNet

Database: Pfam
Entry: Spore_III_AE
LinkDB: Spore_III_AE
Original site: Spore_III_AE 
#=GF ID   Spore_III_AE
#=GF AC   PF09546.10
#=GF DE   Stage III sporulation protein AE (spore_III_AE)
#=GF PI   spore_III_AE; 
#=GF AU   TIGRFAMs;
#=GF AU   Coggill P;0000-0001-5731-1588
#=GF SE   TIGRFAMs
#=GF GA   20.60 20.60;
#=GF TC   21.20 21.10;
#=GF NC   20.50 20.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 45638612 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR014194;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This represents the stage III sporulation protein AE, which is
#=GF CC   encoded in a spore formation operon spoIIIAABCDEFGH under the
#=GF CC   control of sigma G. A comparative genome analysis of all
#=GF CC   sequenced genomes of Firmicutes shows that the proteins are
#=GF CC   strictly conserved among the sub-set of endospore-forming
#=GF CC   species.
#=GF SQ   888
#=GS A0A1Y4VI14_9FIRM/127-446  AC A0A1Y4VI14.1
#=GS A0A1V0KYJ3_9BACL/1-292    AC A0A1V0KYJ3.1
#=GS E9SFL2_RUMAL/63-373       AC E9SFL2.1
#=GS J3AZA9_9BACL/71-390       AC J3AZA9.1
#=GS A0Q094_CLONN/59-381       AC A0Q094.1
#=GS A0A1B1N0J9_9BACL/77-396   AC A0A1B1N0J9.1
#=GS A0A1T5E8Q0_9BACI/1-297    AC A0A1T5E8Q0.1
#=GS R7BG60_9FIRM/48-368       AC R7BG60.1
#=GS R6IG39_9FIRM/35-349       AC R6IG39.1
#=GS L5N6G5_9BACI/67-385       AC L5N6G5.1
#=GS A0A1X7HJG8_9BACL/72-391   AC A0A1X7HJG8.1
#=GS J1H3I9_9CLOT/64-374       AC J1H3I9.1
#=GS A0A1H8ETU9_9BACL/72-390   AC A0A1H8ETU9.1
#=GS R6ALG3_9CLOT/99-419       AC R6ALG3.1
#=GS A0A1G9KWP8_9FIRM/60-379   AC A0A1G9KWP8.1
#=GS A0A0P8YYP8_9CLOT/62-383   AC A0A0P8YYP8.1
#=GS D4K4C6_9FIRM/52-359       AC D4K4C6.1
#=GS A0A1H0AR47_9FIRM/65-381   AC A0A1H0AR47.1
#=GS A0A0A5GCK6_9BACI/66-385   AC A0A0A5GCK6.1
#=GS R6HMB2_9FIRM/62-383       AC R6HMB2.1
#=GS A0A017RZ61_9CLOT/52-374   AC A0A017RZ61.1
#=GS A0A0U2UQA5_9BACL/84-402   AC A0A0U2UQA5.1
#=GS A0A1M7P6S3_9BACI/59-379   AC A0A1M7P6S3.1
#=GS Q2RI98_MOOTA/84-405       AC Q2RI98.1
#=GS A0A240A9L0_CLOCO/58-380   AC A0A240A9L0.1
#=GS R5VSR0_9FIRM/62-379       AC R5VSR0.1
#=GS R5QK85_9FIRM/26-346       AC R5QK85.1
#=GS A0A1I6DB81_9FIRM/49-370   AC A0A1I6DB81.1
#=GS A0A0R3JTI1_9CLOT/50-372   AC A0A0R3JTI1.1
#=GS R5MY87_9FIRM/108-428      AC R5MY87.1
#=GS A0A1I3JCR1_9BACL/96-416   AC A0A1I3JCR1.1
#=GS S2YPF3_9BACL/3-293        AC S2YPF3.1
#=GS A0A267MQF9_9CLOT/64-385   AC A0A267MQF9.1
#=GS R5ITP2_9CLOT/66-386       AC R5ITP2.1
#=GS A0A1I6B1A5_9BACI/1-295    AC A0A1I6B1A5.1
#=GS A0A2C1YG53_9BACI/72-392   AC A0A2C1YG53.1
#=GS A0A1S9CCK7_9FIRM/68-389   AC A0A1S9CCK7.1
#=GS A0A1Y4HNF1_9FIRM/60-371   AC A0A1Y4HNF1.1
#=GS A0A2C6MBT8_9FIRM/1-120    AC A0A2C6MBT8.1
#=GS A0A074LRR6_9BACL/112-433  AC A0A074LRR6.1
#=GS A0A226C0W8_9FIRM/67-388   AC A0A226C0W8.1
#=GS A0A1C0BP41_9CLOT/73-383   AC A0A1C0BP41.1
#=GS Q97HC3_CLOAB/57-379       AC Q97HC3.1
#=GS W7YRU2_9BACI/68-388       AC W7YRU2.1
#=GS R6SME4_9CLOT/1-90         AC R6SME4.1
#=GS A0A0B0D3L9_9BACI/67-386   AC A0A0B0D3L9.1
#=GS A0A1V2SFW5_9BACI/68-388   AC A0A1V2SFW5.1
#=GS A0A1G8BPL1_9BACI/73-393   AC A0A1G8BPL1.1
#=GS A0A1E5L6P2_9BACL/64-384   AC A0A1E5L6P2.1
#=GS A0A1Q9J722_9FIRM/68-389   AC A0A1Q9J722.1
#=GS A0A1M6HNW1_9FIRM/121-441  AC A0A1M6HNW1.1
#=GS A0A0L6ZD99_9CLOT/55-377   AC A0A0L6ZD99.1
#=GS A0A015L665_9BACL/106-426  AC A0A015L665.1
#=GS A0A023DDW6_9BACI/61-381   AC A0A023DDW6.1
#=GS A0A0J5GL29_9BACI/1-229    AC A0A0J5GL29.1
#=GS R9LXA0_9FIRM/37-357       AC R9LXA0.1
#=GS R6ZRU2_9CLOT/22-342       AC R6ZRU2.1
#=GS A0A1H4GU24_9BACI/62-383   AC A0A1H4GU24.1
#=GS A0A1M5LRW8_9BACI/68-387   AC A0A1M5LRW8.1
#=GS R7K8D5_9FIRM/78-399       AC R7K8D5.1
#=GS A0A1E5G6I1_9BACL/64-383   AC A0A1E5G6I1.1
#=GS A0A0J5TV57_9BACI/56-376   AC A0A0J5TV57.1
#=GS A0A285U405_9BACI/1-295    AC A0A285U405.1
#=GS Q8RAD6_CALS4/56-377       AC Q8RAD6.1
#=GS R5T0F4_9CLOT/61-379       AC R5T0F4.1
#=GS M9LB66_PAEPP/74-394       AC M9LB66.1
#=GS A0A0J1GC23_9FIRM/60-379   AC A0A0J1GC23.1
#=GS R5QIH8_9FIRM/53-371       AC R5QIH8.1
#=GS A0A235BC19_9BACL/69-390   AC A0A235BC19.1
#=GS A0A0C2UQN8_9BACL/89-407   AC A0A0C2UQN8.1
#=GS A0A1G8CZN6_9BACI/71-391   AC A0A1G8CZN6.1
#=GS A0A084GWE0_BACID/62-382   AC A0A084GWE0.1
#=GS A0A1R0IHX6_SULTH/50-371   AC A0A1R0IHX6.1
#=GS A0A1M5TUA5_9FIRM/66-386   AC A0A1M5TUA5.1
#=GS C6PQS2_9CLOT/11-333       AC C6PQS2.1
#=GS A0A1R1QAS9_9BACI/76-396   AC A0A1R1QAS9.1
#=GS R6YAL8_9CLOT/1-78         AC R6YAL8.1
#=GS R6G9M5_9FIRM/66-385       AC R6G9M5.1
#=GS A0A1C7GMC6_9FIRM/62-367   AC A0A1C7GMC6.1
#=GS A0A0E4CY40_9BACL/91-411   AC A0A0E4CY40.1
#=GS A0A1G5FHW8_9FIRM/55-369   AC A0A1G5FHW8.1
#=GS A0A0E3W347_9FIRM/66-385   AC A0A0E3W347.1
#=GS A0A0L0QQW9_VIRPA/53-371   AC A0A0L0QQW9.1
#=GS U2EA73_9FIRM/54-376       AC U2EA73.1
#=GS A0A1A5YC31_9BACL/85-401   AC A0A1A5YC31.1
#=GS A0A1E8F1S0_9CLOT/59-381   AC A0A1E8F1S0.1
#=GS R6PFK9_9FIRM/56-375       AC R6PFK9.1
#=GS A0A1I1UGM8_9BACI/73-393   AC A0A1I1UGM8.1
#=GS R6GZL7_9FIRM/35-351       AC R6GZL7.1
#=GS A0A1W1VNA8_DESTI/64-385   AC A0A1W1VNA8.1
#=GS T0E4M2_PAESO/1-124        AC T0E4M2.1
#=GS G4HEY5_9BACL/77-396       AC G4HEY5.1
#=GS F2JME5_CELLD/64-385       AC F2JME5.1
#=GS A0A0X8D6C0_9BACL/62-381   AC A0A0X8D6C0.1
#=GS A6LU38_CLOB8/101-423      AC A6LU38.1
#=GS C6LAD1_9FIRM/61-380       AC C6LAD1.1
#=GS A0A0L0W7X1_CLOPU/67-388   AC A0A0L0W7X1.1
#=GS R5YEM6_9FIRM/57-377       AC R5YEM6.1
#=GS R7L2Q6_9FIRM/62-336       AC R7L2Q6.1
#=GS A0A0F5R1H8_9BACL/88-408   AC A0A0F5R1H8.1
#=GS R5VTX1_9FIRM/58-369       AC R5VTX1.1
#=GS A0A1H9LXH7_9BACI/64-383   AC A0A1H9LXH7.1
#=GS W4ADL7_9BACL/69-389       AC W4ADL7.1
#=GS G2TPR4_BACCO/71-391       AC G2TPR4.1
#=GS F9DN66_9BACL/21-297       AC F9DN66.1
#=GS R6SD97_9FIRM/70-390       AC R6SD97.1
#=GS A0A140L8C0_9CLOT/66-386   AC A0A140L8C0.1
#=GS A0A174GA88_9CLOT/67-389   AC A0A174GA88.1
#=GS D9RXJ9_THEOJ/55-375       AC D9RXJ9.1
#=GS A0A101E7Y8_9FIRM/66-238   AC A0A101E7Y8.1
#=GS A0A0A6VEU3_9BACI/70-390   AC A0A0A6VEU3.1
#=GS A0A223KSX9_9BACI/64-383   AC A0A223KSX9.1
#=GS A0A1Y5KP06_9BACL/78-396   AC A0A1Y5KP06.1
#=GS R7AQU7_9BACE/23-342       AC R7AQU7.1
#=GS A0A1G4WKC9_9FIRM/55-365   AC A0A1G4WKC9.1
#=GS A0A073KHQ4_9BACI/63-383   AC A0A073KHQ4.1
#=GS A0A292YQX9_9BACL/65-382   AC A0A292YQX9.1
#=GS R7N7G3_9FIRM/66-383       AC R7N7G3.1
#=GS A0A1M4M6L8_9FIRM/66-387   AC A0A1M4M6L8.1
#=GS B5CM44_9FIRM/64-384       AC B5CM44.1
#=GS A0A1Q8QXZ2_9FIRM/66-385   AC A0A1Q8QXZ2.1
#=GS Q67NA0_SYMTH/66-388       AC Q67NA0.1
#=GS A0A0D0RJ54_9FIRM/1-164    AC A0A0D0RJ54.1
#=GS A0A127VZA4_SPOPS/2-292    AC A0A127VZA4.1
#=GS R7GEU3_9CLOT/56-375       AC R7GEU3.1
#=GS A0A1G8PU65_9BACI/47-361   AC A0A1G8PU65.1
#=GS A0A1Y4MA26_9FIRM/65-385   AC A0A1Y4MA26.1
#=GS A0A1I6BGB1_9BACI/72-392   AC A0A1I6BGB1.1
#=GS I4D8X2_DESAJ/64-383       AC I4D8X2.1
#=GS A0A252F7I2_9CLOT/68-387   AC A0A252F7I2.1
#=GS R5Z6C8_9FIRM/51-370       AC R5Z6C8.1
#=GS A0A1M4TN96_9BACL/65-385   AC A0A1M4TN96.1
#=GS A0A1G9WSR0_9BACI/1-295    AC A0A1G9WSR0.1
#=GS G9YNJ7_9FIRM/48-359       AC G9YNJ7.1
#=GS W4CV02_9BACL/123-442      AC W4CV02.1
#=GS D4K6A2_9FIRM/107-350      AC D4K6A2.1
#=GS A0A0F5ICP7_9BACI/72-391   AC A0A0F5ICP7.1
#=GS C0CY24_9FIRM/89-409       AC C0CY24.1
#=GS A0A0C2XZZ3_BACBA/68-387   AC A0A0C2XZZ3.1
#=GS R5FBP4_9CLOT/100-420      AC R5FBP4.1
#=GS A0A1I5UMB4_9FIRM/40-355   AC A0A1I5UMB4.1
#=GS S0INU0_9FIRM/59-378       AC S0INU0.1
#=GS A0A1Y4W911_9FIRM/43-353   AC A0A1Y4W911.1
#=GS R7AZA8_9CLOT/75-395       AC R7AZA8.1
#=GS D3FUV6_BACPE/67-387       AC D3FUV6.1
#=GS A0A259UQY4_9FIRM/59-378   AC A0A259UQY4.1
#=GS A0A1G9LKU3_9BACI/69-389   AC A0A1G9LKU3.1
#=GS A0A1H3KVN8_9BACI/65-384   AC A0A1H3KVN8.1
#=GS A0A2C6LGH4_9FIRM/61-251   AC A0A2C6LGH4.1
#=GS R5R433_9FIRM/65-384       AC R5R433.1
#=GS R7C6Z2_9CLOT/51-370       AC R7C6Z2.1
#=GS A0A161HVK0_9BACI/61-381   AC A0A161HVK0.1
#=GS R5V356_9FIRM/53-373       AC R5V356.1
#=GS A0A0U1QS78_9BACL/56-376   AC A0A0U1QS78.1
#=GS A0A0D6ZA92_9BACI/72-392   AC A0A0D6ZA92.1
#=GS A0A1H0GR52_9BACL/72-392   AC A0A1H0GR52.1
#=GS A0A0T6BTX0_9BACI/71-391   AC A0A0T6BTX0.1
#=GS F8I906_SULAT/51-374       AC F8I906.1
#=GS R7GVS5_9FIRM/36-346       AC R7GVS5.1
#=GS A0A285CK45_9BACI/70-390   AC A0A285CK45.1
#=GS S0FTV6_9FIRM/97-418       AC S0FTV6.1
#=GS A4XLC8_CALS8/45-364       AC A4XLC8.1
#=GS A0A1G9CVM4_9BACI/69-389   AC A0A1G9CVM4.1
#=GS A0A1K1LPP0_RUMFL/47-362   AC A0A1K1LPP0.1
#=GS A0A1B8UN05_9BACL/98-418   AC A0A1B8UN05.1
#=GS R7FTX0_9FIRM/48-362       AC R7FTX0.1
#=GS H3SFE4_9BACL/88-408       AC H3SFE4.1
#=GS R6DNF8_9FIRM/55-367       AC R6DNF8.1
#=GS A0A1W2CKR6_9FIRM/49-367   AC A0A1W2CKR6.1
#=GS A0A075KGW6_9FIRM/60-379   AC A0A075KGW6.1
#=GS A0A101XSJ8_9BACL/97-418   AC A0A101XSJ8.1
#=GS R5Q7A8_9CLOT/1-88         AC R5Q7A8.1
#=GS A0A1X9MH05_9BACI/66-350   AC A0A1X9MH05.1
#=GS A0A101VQD8_9FIRM/64-383   AC A0A101VQD8.1
#=GS Q0AZG6_SYNWW/67-387       AC Q0AZG6.1
#=GS R9JDN7_9FIRM/56-376       AC R9JDN7.1
#=GS A0A1U7LXQ1_9FIRM/1-92     AC A0A1U7LXQ1.1
#=GS A4IQS8_GEOTN/61-380       AC A4IQS8.1
#=GS A0A1U7PMA0_9BACI/5-292    AC A0A1U7PMA0.1
#=GS A0A1Y4U482_9FIRM/76-396   AC A0A1Y4U482.1
#=GS W4V491_9FIRM/2-142        AC W4V491.1
#=GS R5TYT9_9FIRM/79-398       AC R5TYT9.1
#=GS R6KTY7_9FIRM/83-402       AC R6KTY7.1
#=GS U2ALR4_9CLOT/46-366       AC U2ALR4.1
#=GS A0A1M6LMI0_9CLOT/68-389   AC A0A1M6LMI0.1
#=GS A0A1W6WDR2_9FIRM/74-387   AC A0A1W6WDR2.1
#=GS A0A1G6B3R3_9FIRM/62-370   AC A0A1G6B3R3.1
#=GS A0A1V2MDE8_9FIRM/63-386   AC A0A1V2MDE8.1
#=GS A0A235F900_9BACI/81-401   AC A0A235F900.1
#=GS A0A265ND71_9BACI/63-383   AC A0A265ND71.1
#=GS A0A1M7M2J2_9FIRM/66-386   AC A0A1M7M2J2.1
#=GS A0A229UXL2_9BACL/79-399   AC A0A229UXL2.1
#=GS A0A1Y4FDB4_9FIRM/71-390   AC A0A1Y4FDB4.1
#=GS A0A1Y0IVG7_9BACL/81-402   AC A0A1Y0IVG7.1
#=GS A0A1I6T210_9BACL/99-419   AC A0A1I6T210.1
#=GS R7CH18_9FIRM/88-408       AC R7CH18.1
#=GS F7NJX4_9FIRM/61-379       AC F7NJX4.1
#=GS R5YD18_9FIRM/66-386       AC R5YD18.1
#=GS F5LLQ1_9BACL/75-392       AC F5LLQ1.1
#=GS K4ZFR9_PAEAL/96-416       AC K4ZFR9.1
#=GS A0A1G9QU13_9BACI/73-393   AC A0A1G9QU13.1
#=GS F4A173_MAHA5/71-391       AC F4A173.1
#=GS R9BY30_9BACI/83-403       AC R9BY30.1
#=GS A0A024QAX8_9BACI/65-384   AC A0A024QAX8.1
#=GS A0A0B0HLJ1_9BACI/45-177   AC A0A0B0HLJ1.1
#=GS A0A161J763_9BACI/67-387   AC A0A161J763.1
#=GS D9TQB4_THETC/59-380       AC D9TQB4.1
#=GS A0A1M6L591_9CLOT/74-396   AC A0A1M6L591.1
#=GS A0A1Y4RV07_9FIRM/45-281   AC A0A1Y4RV07.1
#=GS M8DJW4_9BACL/68-387       AC M8DJW4.1
#=GS A0A1Q5XNW1_9BACL/89-409   AC A0A1Q5XNW1.1
#=GS R7R722_9FIRM/32-352       AC R7R722.1
#=GS A0A255IQG6_9FIRM/65-386   AC A0A255IQG6.1
#=GS L0EEQ1_THECK/91-411       AC L0EEQ1.1
#=GS A0A1H9ZML3_9BACI/65-384   AC A0A1H9ZML3.1
#=GS R6NNX6_9FIRM/80-400       AC R6NNX6.1
#=GS B8D2F1_HALOH/69-390       AC B8D2F1.1
#=GS B0TEH8_HELMI/69-390       AC B0TEH8.1
#=GS U5S0V0_9CLOT/84-406       AC U5S0V0.1
#=GS F9VKS9_ARTSS/69-392       AC F9VKS9.1
#=GS A0A1I7JXJ8_9BACL/96-414   AC A0A1I7JXJ8.1
#=GS A0A1Z5HXU4_9THEO/66-387   AC A0A1Z5HXU4.1
#=GS R6EKF6_9FIRM/26-346       AC R6EKF6.1
#=GS R6DZC2_9FIRM/38-359       AC R6DZC2.1
#=GS A0A1M5CUK2_9FIRM/65-386   AC A0A1M5CUK2.1
#=GS R5B3G5_9FIRM/56-374       AC R5B3G5.1
#=GS A0A268SF02_9BACL/69-389   AC A0A268SF02.1
#=GS R7G552_9FIRM/104-424      AC R7G552.1
#=GS A0A0B0IF88_9BACI/66-386   AC A0A0B0IF88.1
#=GS R7N6Z2_9FIRM/104-424      AC R7N6Z2.1
#=GS A0A1S2LU46_9BACI/60-379   AC A0A1S2LU46.1
#=GS I3EAC5_BACMT/72-392       AC I3EAC5.1
#=GS A0A1Y4ET95_9FIRM/65-375   AC A0A1Y4ET95.1
#=GS G7M113_9CLOT/107-429      AC G7M113.1
#=GS R6TBX5_9FIRM/1-187        AC R6TBX5.1
#=GS R6YDH6_9CLOT/55-174       AC R6YDH6.1
#=GS A0A1T4P4C4_9FIRM/71-392   AC A0A1T4P4C4.1
#=GS A0A0V8HM88_9BACI/70-390   AC A0A0V8HM88.1
#=GS A0A0Q9LM94_9BACL/87-407   AC A0A0Q9LM94.1
#=GS R6R0J5_9FIRM/60-362       AC R6R0J5.1
#=GS R7I6P3_9CLOT/65-384       AC R7I6P3.1
#=GS T0C7M3_ALIAG/122-442      AC T0C7M3.1
#=GS A0A0A8X8K0_9BACI/72-392   AC A0A0A8X8K0.1
#=GS A0A173WIC7_9FIRM/33-332   AC A0A173WIC7.1
#=GS A0A075JP38_9BACI/69-388   AC A0A075JP38.1
#=GS E6U548_ETHHY/61-371       AC E6U548.1
#=GS A0A0A5GI60_9BACI/64-383   AC A0A0A5GI60.1
#=GS A0A1R1D926_9BACL/88-408   AC A0A1R1D926.1
#=GS A0A1B7LIZ2_9FIRM/68-389   AC A0A1B7LIZ2.1
#=GS A0A168M2R8_9BACL/69-389   AC A0A168M2R8.1
#=GS C0EFZ2_9FIRM/69-382       AC C0EFZ2.1
#=GS A0A1I5U740_9FIRM/70-390   AC A0A1I5U740.1
#=GS R5HPX0_9FIRM/58-379       AC R5HPX0.1
#=GS A7GSK7_BACCN/63-383       AC A7GSK7.1
#=GS R5L5E1_9FIRM/57-376       AC R5L5E1.1
#=GS A0A2B2CED5_9BACI/72-392   AC A0A2B2CED5.1
#=GS R7FFD7_9CLOT/77-396       AC R7FFD7.1
#=GS A0A1H9S6I7_9BACI/1-296    AC A0A1H9S6I7.1
#=GS R6YK70_9FIRM/60-379       AC R6YK70.1
#=GS A0A150Y9C6_9FIRM/65-191   AC A0A150Y9C6.1
#=GS A0A1D7XKN5_9CLOT/90-412   AC A0A1D7XKN5.1
#=GS R7BT38_9FIRM/98-418       AC R7BT38.1
#=GS V6IVC6_9BACL/75-392       AC V6IVC6.1
#=GS A0A1C0A9I7_9FIRM/65-385   AC A0A1C0A9I7.1
#=GS V9WBD7_9BACL/71-391       AC V9WBD7.1
#=GS A0A238ZU59_9FIRM/62-383   AC A0A238ZU59.1
#=GS A0A1C0ZWD3_9BACL/74-392   AC A0A1C0ZWD3.1
#=GS A0A1S2LWG6_9BACI/61-380   AC A0A1S2LWG6.1
#=GS W6NDC2_CLOTY/81-403       AC W6NDC2.1
#=GS A0A0J1FDB0_9FIRM/123-442  AC A0A0J1FDB0.1
#=GS Q3AAL2_CARHZ/51-372       AC Q3AAL2.1
#=GS R5LFC9_9FIRM/45-365       AC R5LFC9.1
#=GS A0A1A5XTS7_9BACL/70-389   AC A0A1A5XTS7.1
#=GS A0A1I1TCB9_9BACI/69-388   AC A0A1I1TCB9.1
#=GS A0A2D1SV23_9BACL/1-296    AC A0A2D1SV23.1
#=GS R6D1X6_9CLOT/1-115        AC R6D1X6.1
#=GS H5XSJ2_9FIRM/64-383       AC H5XSJ2.1
#=GS A0A1T4WHQ3_9CLOT/54-376   AC A0A1T4WHQ3.1
#=GS A0A060LZ34_9BACI/69-389   AC A0A060LZ34.1
#=GS A0A1G8JL15_9BACI/87-405   AC A0A1G8JL15.1
#=GS A0A1U7M9H5_TISCR/51-371   AC A0A1U7M9H5.1
#=GS A0A1I3QAP5_9BACL/70-388   AC A0A1I3QAP5.1
#=GS A0A0J6FYV7_9BACI/63-383   AC A0A0J6FYV7.1
#=GS W4VCU7_9BACI/1-173        AC W4VCU7.1
#=GS X2GMT5_9BACI/1-297        AC X2GMT5.1
#=GS A0A268IJ33_9BACI/71-391   AC A0A268IJ33.1
#=GS Q5KX97_GEOKA/62-380       AC Q5KX97.1
#=GS D9QRW2_ACEAZ/75-396       AC D9QRW2.1
#=GS A0A078KNP9_9FIRM/64-383   AC A0A078KNP9.1
#=GS A0A0V8QFD7_9FIRM/59-379   AC A0A0V8QFD7.1
#=GS W4PXL7_9BACI/66-386       AC W4PXL7.1
#=GS A0A1N6PHJ1_9BACI/41-354   AC A0A1N6PHJ1.1
#=GS A0A263BVQ8_9BACI/63-383   AC A0A263BVQ8.1
#=GS R7ZDK6_LYSSH/1-297        AC R7ZDK6.1
#=GS R6P452_9CLOT/64-374       AC R6P452.1
#=GS A0A024P6B1_9BACI/62-381   AC A0A024P6B1.1
#=GS B0PBE0_9FIRM/125-440      AC B0PBE0.1
#=GS A0A1Y4M9Z6_9FIRM/51-361   AC A0A1Y4M9Z6.1
#=GS J7IN72_DESMD/64-383       AC J7IN72.1
#=GS U2DCH5_CLOS4/69-383       AC U2DCH5.1
#=GS R9NDZ7_9FIRM/81-400       AC R9NDZ7.1
#=GS A0A089IS13_9BACL/87-406   AC A0A089IS13.1
#=GS R5YSV4_9CLOT/23-342       AC R5YSV4.1
#=GS A0A1V2YI91_9FIRM/60-381   AC A0A1V2YI91.1
#=GS D4W1Q6_9FIRM/30-345       AC D4W1Q6.1
#=GS R7G461_9PROT/69-389       AC R7G461.1
#=GS A0A0A5I3V8_9BACI/66-385   AC A0A0A5I3V8.1
#=GS C4ZD09_AGARV/59-377       AC C4ZD09.1
#=GS G2G099_9FIRM/64-383       AC G2G099.1
#=GS R6FWF5_9CLOT/67-389       AC R6FWF5.1
#=GS A0A1H1BHE4_9BACI/65-384   AC A0A1H1BHE4.1
#=GS R5NLQ4_9FIRM/55-374       AC R5NLQ4.1
#=GS A0A1I7H646_9CLOT/72-394   AC A0A1I7H646.1
#=GS A0A136WEU2_9FIRM/45-364   AC A0A136WEU2.1
#=GS R6QXF8_9CLOT/61-373       AC R6QXF8.1
#=GS A0A1H0JRC3_HALAD/62-381   AC A0A1H0JRC3.1
#=GS D4LE94_RUMC1/58-369       AC D4LE94.1
#=GS U2NQH8_9CLOT/60-381       AC U2NQH8.1
#=GS R6NKY7_9CLOT/65-384       AC R6NKY7.1
#=GS R6B820_9CLOT/1-92         AC R6B820.1
#=GS D3E6L2_GEOS4/76-396       AC D3E6L2.1
#=GS A0A1I6PSL0_9BACI/58-376   AC A0A1I6PSL0.1
#=GS T0N8Z9_9CLOT/54-376       AC T0N8Z9.1
#=GS D4KWW0_9FIRM/58-379       AC D4KWW0.1
#=GS A0A2A8SER3_9BACI/63-383   AC A0A2A8SER3.1
#=GS A0A0C2VK39_9BACL/55-373   AC A0A0C2VK39.1
#=GS A0A1Y3W8I6_9FIRM/65-384   AC A0A1Y3W8I6.1
#=GS A0A1Y4TGH4_9FIRM/58-359   AC A0A1Y4TGH4.1
#=GS A0A1Q8Q7K2_9BACI/40-354   AC A0A1Q8Q7K2.1
#=GS N1ZI06_9CLOT/61-380       AC N1ZI06.1
#=GS Q24UY2_DESHY/63-382       AC Q24UY2.1
#=GS A0A1H7ZP06_9FIRM/61-376   AC A0A1H7ZP06.1
#=GS R6HEY8_9CLOT/64-376       AC R6HEY8.1
#=GS A0A150YMP1_9BACI/1-295    AC A0A150YMP1.1
#=GS K6D6Y6_BACAZ/70-390       AC K6D6Y6.1
#=GS A0A168P5H3_9BACL/71-391   AC A0A168P5H3.1
#=GS R5MQD4_9FIRM/64-374       AC R5MQD4.1
#=GS R5GTS9_9FIRM/1-169        AC R5GTS9.1
#=GS A5I315_CLOBH/59-381       AC A5I315.1
#=GS A0A1S2MF38_9BACI/60-380   AC A0A1S2MF38.1
#=GS K8E077_9FIRM/65-386       AC K8E077.1
#=GS B2TRP2_CLOBB/90-412       AC B2TRP2.1
#=GS A0A0A2TK70_9FIRM/63-382   AC A0A0A2TK70.1
#=GS R6EVN4_9FIRM/95-415       AC R6EVN4.1
#=GS A0A0A8WHC0_PAESO/62-383   AC A0A0A8WHC0.1
#=GS A0A089K6L2_9BACL/90-410   AC A0A089K6L2.1
#=GS A0A1Y4IQC5_9FIRM/21-341   AC A0A1Y4IQC5.1
#=GS A0A117SH48_9FIRM/58-379   AC A0A117SH48.1
#=GS A0A221MCA8_9BACI/64-383   AC A0A221MCA8.1
#=GS A0A1G9CI99_9CLOT/65-386   AC A0A1G9CI99.1
#=GS A0A075LKU4_9BACI/68-387   AC A0A075LKU4.1
#=GS A0A1M4XMH8_9CLOT/62-384   AC A0A1M4XMH8.1
#=GS A0A1V2M8P4_9FIRM/63-386   AC A0A1V2M8P4.1
#=GS A0A1L3MQ38_9BACI/76-396   AC A0A1L3MQ38.1
#=GS A5Z6N4_9FIRM/59-378       AC A5Z6N4.1
#=GS A0A1V4SJ02_CLOHU/114-435  AC A0A1V4SJ02.1
#=GS R7LRU6_9CLOT/71-390       AC R7LRU6.1
#=GS A0A2A7MGJ5_9CLOT/80-402   AC A0A2A7MGJ5.1
#=GS A0A1H8NB71_9FIRM/60-379   AC A0A1H8NB71.1
#=GS A0A1Q9Q576_9BACI/72-392   AC A0A1Q9Q576.1
#=GS R6WL62_9FIRM/22-335       AC R6WL62.1
#=GS A0A0C7N702_9THEO/102-423  AC A0A0C7N702.1
#=GS D4JTH8_9FIRM/54-367       AC D4JTH8.1
#=GS R4KNB9_9FIRM/80-400       AC R4KNB9.1
#=GS R1CBS0_9CLOT/65-386       AC R1CBS0.1
#=GS R5XR87_9FIRM/63-382       AC R5XR87.1
#=GS A0A081NWM0_9BACL/85-403   AC A0A081NWM0.1
#=GS A0A0S9CKI3_9SPHN/58-140   AC A0A0S9CKI3.1
#=GS A0A1L8ZM36_9BACI/69-389   AC A0A1L8ZM36.1
#=GS A0A0Q9Y3P7_9BACI/68-388   AC A0A0Q9Y3P7.1
#=GS A0A1Y4BZR2_9FIRM/47-358   AC A0A1Y4BZR2.1
#=GS V9G4B3_9BACL/74-393       AC V9G4B3.1
#=GS M1YV77_9FIRM/62-381       AC M1YV77.1
#=GS A0A223D742_9BACL/83-403   AC A0A223D742.1
#=GS R5DYG0_9FIRM/55-368       AC R5DYG0.1
#=GS A0A1R1CFT8_9BACL/76-396   AC A0A1R1CFT8.1
#=GS D7CKG7_SYNLT/68-388       AC D7CKG7.1
#=GS R5TM23_9FIRM/61-344       AC R5TM23.1
#=GS D5X7K3_THEPJ/80-401       AC D5X7K3.1
#=GS A0A1Y6G1Z5_9BACI/71-391   AC A0A1Y6G1Z5.1
#=GS A0A084JRZ3_9FIRM/65-385   AC A0A084JRZ3.1
#=GS A0A1X7JIL1_9BACL/89-409   AC A0A1X7JIL1.1
#=GS A0A0U1L2Y5_9FIRM/59-378   AC A0A0U1L2Y5.1
#=GS A0A096BJP8_9CLOT/63-384   AC A0A096BJP8.1
#=GS A0A1V2A9M7_9BACI/39-354   AC A0A1V2A9M7.1
#=GS N2A2L6_9FIRM/69-388       AC N2A2L6.1
#=GS A0A165XSC5_9BACI/78-398   AC A0A165XSC5.1
#=GS A0A162RS61_9BACL/71-391   AC A0A162RS61.1
#=GS A0A1Y3TN92_9FIRM/71-391   AC A0A1Y3TN92.1
#=GS A0A0M1NXE1_9BACI/75-395   AC A0A0M1NXE1.1
#=GS D4J412_9FIRM/106-426      AC D4J412.1
#=GS A0A220U562_9BACI/66-385   AC A0A220U562.1
#=GS R6UEN5_9CLOT/87-406       AC R6UEN5.1
#=GS I0JNV9_HALH3/60-380       AC I0JNV9.1
#=GS A0A0M2PKL5_9BACI/77-397   AC A0A0M2PKL5.1
#=GS A0A089HTH6_PAEDU/134-453  AC A0A089HTH6.1
#=GS Q9K957_BACHD/70-390       AC Q9K957.1
#=GS A0A1T5L9X1_9CLOT/70-391   AC A0A1T5L9X1.1
#=GS A0A147K7U1_9BACI/70-390   AC A0A147K7U1.1
#=GS R5VLE4_9CLOT/48-367       AC R5VLE4.1
#=GS R7K1I0_9CLOT/37-357       AC R7K1I0.1
#=GS B0K9D4_THEP3/57-378       AC B0K9D4.1
#=GS R6PQT9_9FIRM/42-361       AC R6PQT9.1
#=GS A6TR31_ALKMQ/49-370       AC A6TR31.1
#=GS A0A2A2IBJ2_9BACI/65-384   AC A0A2A2IBJ2.1
#=GS R6VK40_9FIRM/64-383       AC R6VK40.1
#=GS A0A1R0XGM6_9BACL/84-403   AC A0A1R0XGM6.1
#=GS R5PPL1_9CLOT/1-106        AC R5PPL1.1
#=GS K0IY03_AMPXN/68-386       AC K0IY03.1
#=GS A8MFJ8_ALKOO/65-386       AC A8MFJ8.1
#=GS A0A061PD49_9BACL/84-404   AC A0A061PD49.1
#=GS A0A094JPF7_9BACL/66-387   AC A0A094JPF7.1
#=GS A6CTX0_9BACI/82-402       AC A6CTX0.1
#=GS S5Z7E6_BACPJ/62-380       AC S5Z7E6.1
#=GS I3VWP3_THESW/69-390       AC I3VWP3.1
#=GS A0A261QGG4_9BACI/71-387   AC A0A261QGG4.1
#=GS E0ICJ6_9BACL/90-410       AC E0ICJ6.1
#=GS A0A0M2VRB2_9BACL/72-391   AC A0A0M2VRB2.1
#=GS A0A1M5SFK8_9CLOT/62-384   AC A0A1M5SFK8.1
#=GS A0A1M5Z0D1_9FIRM/64-383   AC A0A1M5Z0D1.1
#=GS R5D7P0_9FIRM/32-352       AC R5D7P0.1
#=GS B2A541_NATTJ/75-396       AC B2A541.1
#=GS A0A1M6C2P9_9CLOT/64-385   AC A0A1M6C2P9.1
#=GS A0A098EZI7_9BACI/68-388   AC A0A098EZI7.1
#=GS A5D347_PELTS/58-379       AC A5D347.1
#=GS W6RYB0_9CLOT/55-377       AC W6RYB0.1
#=GS D4N0G6_ANAHA/48-368       AC D4N0G6.1
#=GS A0A0A3IU91_9BACI/1-295    AC A0A0A3IU91.1
#=GS A0A0N0E9X1_9BACI/63-383   AC A0A0N0E9X1.1
#=GS A0A1R0WKG4_9BACL/84-141   AC A0A1R0WKG4.1
#=GS R6K4N4_9FIRM/85-402       AC R6K4N4.1
#=GS W4QW22_BACA3/65-364       AC W4QW22.1
#=GS V9HFW0_9CLOT/81-403       AC V9HFW0.1
#=GS R7DA98_9FIRM/101-420      AC R7DA98.1
#=GS D7GUK1_9FIRM/94-414       AC D7GUK1.1
#=GS W9B5E5_9BACI/67-386       AC W9B5E5.1
#=GS A0A265Q8B0_9FIRM/59-379   AC A0A265Q8B0.1
#=GS A0A0W7YIG4_9BACI/1-297    AC A0A0W7YIG4.1
#=GS A0A0P9CUD6_9BACL/56-375   AC A0A0P9CUD6.1
#=GS R7M9I9_9CLOT/2-119        AC R7M9I9.1
#=GS K4LIH5_THEPS/76-397       AC K4LIH5.1
#=GS C6J3T2_9BACL/71-391       AC C6J3T2.1
#=GS R9J588_9FIRM/67-386       AC R9J588.1
#=GS A0A1B8WQN0_9BACI/82-401   AC A0A1B8WQN0.1
#=GS W4V369_9FIRM/86-196       AC W4V369.1
#=GS L0FB24_DESDL/90-409       AC L0FB24.1
#=GS Q8XJD1_CLOPE/61-384       AC Q8XJD1.1
#=GS A0A1I0WHA3_9CLOT/69-391   AC A0A1I0WHA3.1
#=GS A0A1Y4RP79_9FIRM/93-413   AC A0A1Y4RP79.1
#=GS A0A1S2R1X4_9BACI/76-396   AC A0A1S2R1X4.1
#=GS A0A101V9I2_9FIRM/66-387   AC A0A101V9I2.1
#=GS A0A1Y4USF7_9FIRM/54-374   AC A0A1Y4USF7.1
#=GS A0A0K2SMS7_9FIRM/67-386   AC A0A0K2SMS7.1
#=GS A0A150FPU4_CLOPD/58-379   AC A0A150FPU4.1
#=GS E6SL62_THEM7/162-483      AC E6SL62.1
#=GS A0A0M0GBG2_SPOGL/72-392   AC A0A0M0GBG2.1
#=GS A0A0U4WFA3_9BACL/67-387   AC A0A0U4WFA3.1
#=GS A0A0N0Z8Y6_9BACI/44-315   AC A0A0N0Z8Y6.1
#=GS A3DDP7_CLOTH/81-402       AC A3DDP7.1
#=GS A0A0H4L0E0_9BACI/63-383   AC A0A0H4L0E0.1
#=GS C5VSZ2_CLOBO/59-381       AC C5VSZ2.1
#=GS W1SDA7_9BACI/72-392       AC W1SDA7.1
#=GS R6S603_9FIRM/56-375       AC R6S603.1
#=GS A0A0C2VAN9_9BACL/67-387   AC A0A0C2VAN9.1
#=GS A0A1J0GI17_9CLOT/64-386   AC A0A1J0GI17.1
#=GS R6U837_9FIRM/62-374       AC R6U837.1
#=GS R6Z824_9CLOT/1-179        AC R6Z824.1
#=GS A0A0M0GPR9_9BACI/69-389   AC A0A0M0GPR9.1
#=GS A0A167T3T3_9BACI/60-380   AC A0A167T3T3.1
#=GS A0A0K9GVN7_9BACI/70-390   AC A0A0K9GVN7.1
#=GS Q81M42_BACAN/63-383       AC Q81M42.1
#=GS N0B3R8_9BACI/64-384       AC N0B3R8.1
#=GS A0A1Q6TB89_9FIRM/52-363   AC A0A1Q6TB89.1
#=GS A0A177KYN2_9BACI/33-346   AC A0A177KYN2.1
#=GS A0A1Q9K5Q7_9FIRM/43-363   AC A0A1Q9K5Q7.1
#=GS A0A1Y3YBD5_9FIRM/62-381   AC A0A1Y3YBD5.1
#=GS R6BEX2_9CLOT/1-188        AC R6BEX2.1
#=GS R7NNL2_9FIRM/57-371       AC R7NNL2.1
#=GS A0A0K9YR58_9BACL/67-387   AC A0A0K9YR58.1
#=GS R7MML7_9FIRM/50-367       AC R7MML7.1
#=GS A0A1G5JYW5_9BACL/69-389   AC A0A1G5JYW5.1
#=GS A0A1I0RV79_9FIRM/30-350   AC A0A1I0RV79.1
#=GS A0A1R1EV11_9BACL/69-389   AC A0A1R1EV11.1
#=GS A0A1G9Q996_9FIRM/69-390   AC A0A1G9Q996.1
#=GS W4BIR4_9BACL/75-395       AC W4BIR4.1
#=GS A0A1I2L4T7_9BACL/69-389   AC A0A1I2L4T7.1
#=GS A0A1W2AE92_9FIRM/59-379   AC A0A1W2AE92.1
#=GS A0A1H8C3H5_9BACI/79-399   AC A0A1H8C3H5.1
#=GS L1QG99_9CLOT/67-389       AC L1QG99.1
#=GS C5EH39_9FIRM/101-421      AC C5EH39.1
#=GS A0A1M5Y8H9_9FIRM/73-383   AC A0A1M5Y8H9.1
#=GS A0A1M6KHQ6_9CLOT/61-383   AC A0A1M6KHQ6.1
#=GS M7NHF4_9BACL/4-294        AC M7NHF4.1
#=GS A0A099SB96_9CLOT/56-378   AC A0A099SB96.1
#=GS A0A174TK33_9CLOT/75-397   AC A0A174TK33.1
#=GS D9SLF5_CLOC7/84-408       AC D9SLF5.1
#=GS R6P0W5_9CLOT/72-383       AC R6P0W5.1
#=GS R6I8J6_9FIRM/64-374       AC R6I8J6.1
#=GS K6U8J8_9CLOT/99-421       AC K6U8J8.1
#=GS A0A1E3BWE0_9CLOT/81-402   AC A0A1E3BWE0.1
#=GS B1CBV3_9FIRM/67-388       AC B1CBV3.1
#=GS A0A0U2MXF0_9BACL/101-419  AC A0A0U2MXF0.1
#=GS C7H7Q9_9FIRM/11-204       AC C7H7Q9.1
#=GS A8FF23_BACP2/70-390       AC A8FF23.1
#=GS A4J3E2_DESRM/61-382       AC A4J3E2.1
#=GS R7IEH9_9FIRM/1-293        AC R7IEH9.1
#=GS A9KMC7_LACP7/56-376       AC A9KMC7.1
#=GS A0A0F6BKM5_GEOS0/61-381   AC A0A0F6BKM5.1
#=GS A0A0Q3X0N7_9BACI/64-384   AC A0A0Q3X0N7.1
#=GS R6LS66_9CLOT/37-357       AC R6LS66.1
#=GS F0T0S0_SYNGF/59-378       AC F0T0S0.1
#=GS W4QIB6_9BACI/65-385       AC W4QIB6.1
#=GS A0A061NR47_9BACL/84-404   AC A0A061NR47.1
#=GS R5RUA0_9CLOT/48-368       AC R5RUA0.1
#=GS A0A0K8J7G5_9FIRM/63-383   AC A0A0K8J7G5.1
#=GS A0A1S9I244_9CLOT/59-381   AC A0A1S9I244.1
#=GS A0A1S2QX50_9BACI/70-390   AC A0A1S2QX50.1
#=GS F6DUB2_DESRL/59-380       AC F6DUB2.1
#=GS T0CRN5_PAESO/62-240       AC T0CRN5.1
#=GS A0A0A2TAU8_9BACI/65-385   AC A0A0A2TAU8.1
#=GS A0A1I1NPJ6_9CLOT/90-412   AC A0A1I1NPJ6.1
#=GS A0A1I6TVV1_9BACL/72-391   AC A0A1I6TVV1.1
#=GS R5FUG5_9FIRM/79-399       AC R5FUG5.1
#=GS A0A140LC92_9THEO/55-375   AC A0A140LC92.1
#=GS A0A1B8VUQ7_9BACI/88-408   AC A0A1B8VUQ7.1
#=GS A0A1M4UZM5_9FIRM/61-382   AC A0A1M4UZM5.1
#=GS A0A1G4FHT4_9FIRM/67-387   AC A0A1G4FHT4.1
#=GS A0A1S1FST0_9BACI/62-382   AC A0A1S1FST0.1
#=GS G9RYJ9_9FIRM/57-373       AC G9RYJ9.1
#=GS A0A0C2VAG3_9BACL/61-378   AC A0A0C2VAG3.1
#=GS A0A1M6JR07_9CLOT/66-387   AC A0A1M6JR07.1
#=GS A0A176JBI7_9BACI/56-376   AC A0A176JBI7.1
#=GS C0C3R5_9FIRM/85-405       AC C0C3R5.1
#=GS Q818Q7_BACCR/63-383       AC Q818Q7.1
#=GS R5AHW6_9CLOT/49-363       AC R5AHW6.1
#=GS R5K1X9_9CLOT/55-373       AC R5K1X9.1
#=GS A0A1U7MM24_9FIRM/59-379   AC A0A1U7MM24.1
#=GS A0A1K1MSD9_9FIRM/55-371   AC A0A1K1MSD9.1
#=GS A0A1U9K988_9BACL/78-398   AC A0A1U9K988.1
#=GS R4K7I4_CLOPA/57-379       AC R4K7I4.1
#=GS A0A011VT13_RUMAL/64-372   AC A0A011VT13.1
#=GS C5D480_GEOSW/61-381       AC C5D480.1
#=GS A0A0S2W423_9FIRM/57-371   AC A0A0S2W423.1
#=GS A0A150F6Z1_9BACI/75-395   AC A0A150F6Z1.1
#=GS A0A109RLV0_9FIRM/29-345   AC A0A109RLV0.1
#=GS A0A248TLL0_9BACI/81-401   AC A0A248TLL0.1
#=GS E3E4Y4_PAEPS/69-389       AC E3E4Y4.1
#=GS A0A268E8N3_9BACI/75-395   AC A0A268E8N3.1
#=GS A0A1M6PGB0_9FIRM/61-382   AC A0A1M6PGB0.1
#=GS A0A1I6ILC8_9FIRM/67-387   AC A0A1I6ILC8.1
#=GS A0A1T4K467_9FIRM/66-386   AC A0A1T4K467.1
#=GS R6Q3U0_9FIRM/1-53         AC R6Q3U0.1
#=GS F7KB96_9FIRM/28-348       AC F7KB96.1
#=GS L0K665_HALHC/63-384       AC L0K665.1
#=GS A0A0K9FAS9_9BACI/1-297    AC A0A0K9FAS9.1
#=GS A0A1S9C128_9FIRM/60-381   AC A0A1S9C128.1
#=GS A0A0A8JKT5_BACSX/2-291    AC A0A0A8JKT5.1
#=GS R5DEA0_9FIRM/27-342       AC R5DEA0.1
#=GS A0A1I4KVN1_9BACI/61-380   AC A0A1I4KVN1.1
#=GS A0A084JIV2_9CLOT/56-378   AC A0A084JIV2.1
#=GS A0A0A7FXA2_9CLOT/80-402   AC A0A0A7FXA2.1
#=GS A0A0B7MPF6_9FIRM/62-383   AC A0A0B7MPF6.1
#=GS A0A1Y3TV44_9FIRM/64-362   AC A0A1Y3TV44.1
#=GS R5DUI8_9FIRM/81-399       AC R5DUI8.1
#=GS A0A1G6QAM8_9BACL/66-385   AC A0A1G6QAM8.1
#=GS A0A0B0HR86_9BACI/1-153    AC A0A0B0HR86.1
#=GS E6UIW3_RUMA7/64-372       AC E6UIW3.1
#=GS A0A0D8IDG5_9CLOT/62-383   AC A0A0D8IDG5.1
#=GS A0A0F0C2T5_9CLOT/96-416   AC A0A0F0C2T5.1
#=GS J9HED9_9BACL/64-383       AC J9HED9.1
#=GS A0A0D3V783_9BACL/71-391   AC A0A0D3V783.1
#=GS A0A0D0SHX2_9FIRM/20-131   AC A0A0D0SHX2.1
#=GS A0A268J9Y8_9BACL/65-385   AC A0A268J9Y8.1
#=GS W4VDH9_9BACI/1-114        AC W4VDH9.1
#=GS A0A1M6KKV5_9CLOT/61-383   AC A0A1M6KKV5.1
#=GS A0A0H3E3W9_BACA1/78-398   AC A0A0H3E3W9.1
#=GS A0A1M4N591_9CLOT/56-378   AC A0A1M4N591.1
#=GS A0A1H3CSE1_9FIRM/66-386   AC A0A1H3CSE1.1
#=GS A0A1M6S3S8_9BACL/77-395   AC A0A1M6S3S8.1
#=GS A0A0C1U246_9CLOT/55-377   AC A0A0C1U246.1
#=GS A0A1Y4WEY5_9FIRM/1-256    AC A0A1Y4WEY5.1
#=GS A0A1Y3SME9_9FIRM/50-361   AC A0A1Y3SME9.1
#=GS A0A1T4LID6_9FIRM/61-375   AC A0A1T4LID6.1
#=GS R7FF66_9FIRM/69-383       AC R7FF66.1
#=GS W7UHP5_RUMFL/48-362       AC W7UHP5.1
#=GS E4Q5X4_CALOW/45-361       AC E4Q5X4.1
#=GS F6B9Z1_DESCC/61-382       AC F6B9Z1.1
#=GS A0A1W5ZV05_9BACI/64-384   AC A0A1W5ZV05.1
#=GS R5JZC5_9CLOT/115-433      AC R5JZC5.1
#=GS A0A089L173_9BACL/78-398   AC A0A089L173.1
#=GS A0A162MGU4_9FIRM/63-383   AC A0A162MGU4.1
#=GS C8W104_DESAS/69-390       AC C8W104.1
#=GS A0A1H9A9Z1_9BACI/61-381   AC A0A1H9A9Z1.1
#=GS A0A0Q3TNW9_9BACI/62-382   AC A0A0Q3TNW9.1
#=GS R5C619_9FIRM/79-398       AC R5C619.1
#=GS A0A161XHR5_9CLOT/59-381   AC A0A161XHR5.1
#=GS A0A1Y4NVH9_9FIRM/69-389   AC A0A1Y4NVH9.1
#=GS A0A0Q3WRV2_BRECH/59-377   AC A0A0Q3WRV2.1
#=GS A0A0K9H6Z0_9BACI/77-395   AC A0A0K9H6Z0.1
#=GS R5HVZ3_9FIRM/94-414       AC R5HVZ3.1
#=GS U2RS47_9FIRM/2-248        AC U2RS47.1
#=GS A0A1H9YPL4_9CLOT/62-383   AC A0A1H9YPL4.1
#=GS R7K6M6_9FIRM/70-390       AC R7K6M6.1
#=GS A0A1H8EEX9_9BACL/94-414   AC A0A1H8EEX9.1
#=GS R6WI50_9FIRM/74-394       AC R6WI50.1
#=GS A0A269W695_9BACL/57-376   AC A0A269W695.1
#=GS A0A143XPI9_9FIRM/78-397   AC A0A143XPI9.1
#=GS G5IBT0_9CLOT/96-416       AC G5IBT0.1
#=GS A0A173XL95_CLOVE/69-392   AC A0A173XL95.1
#=GS A0A0N0CWM4_9BACI/1-297    AC A0A0N0CWM4.1
#=GS D4LX77_9FIRM/98-418       AC D4LX77.1
#=GS R6QS98_9CLOT/68-388       AC R6QS98.1
#=GS H6NL74_9BACL/89-407       AC H6NL74.1
#=GS A0A0K0GEX3_9FIRM/52-371   AC A0A0K0GEX3.1
#=GS K0B183_CLOA9/66-387       AC K0B183.1
#=GS V2YG61_9FIRM/46-350       AC V2YG61.1
#=GS A0A1I5EYX1_9FIRM/83-403   AC A0A1I5EYX1.1
#=GS A0A1T4S9B0_9FIRM/55-376   AC A0A1T4S9B0.1
#=GS A0A0M0EXZ4_9BACI/75-395   AC A0A0M0EXZ4.1
#=GS A0A1H8NLJ0_9BACI/64-382   AC A0A1H8NLJ0.1
#=GS A0A143ZV49_9FIRM/73-384   AC A0A143ZV49.1
#=GS R8W3H6_9CLOT/49-366       AC R8W3H6.1
#=GS A0A1M4VIX5_9CLOT/91-410   AC A0A1M4VIX5.1
#=GS A0A1Y4B485_9FIRM/94-414   AC A0A1Y4B485.1
#=GS A0A1I2VHM8_9BACL/72-392   AC A0A1I2VHM8.1
#=GS A0A151B718_9CLOT/63-385   AC A0A151B718.1
#=GS R7F6Q4_9CLOT/56-375       AC R7F6Q4.1
#=GS R5KK58_9CLOT/69-382       AC R5KK58.1
#=GS A0A098M7G0_9BACL/83-402   AC A0A098M7G0.1
#=GS A0A1V4HQY0_9BACL/73-392   AC A0A1V4HQY0.1
#=GS A0A1S6IUP5_9FIRM/61-382   AC A0A1S6IUP5.1
#=GS A0A268KBB4_9BACI/72-392   AC A0A268KBB4.1
#=GS R6XRH5_9CLOT/73-392       AC R6XRH5.1
#=GS C0GE39_9FIRM/58-380       AC C0GE39.1
#=GS A0A1I1ZKV1_9BACI/73-393   AC A0A1I1ZKV1.1
#=GS A0A1I4DJV8_9BACL/101-421  AC A0A1I4DJV8.1
#=GS A0A1I3PKK5_HALDA/63-382   AC A0A1I3PKK5.1
#=GS A0A0M0KZE0_9BACI/62-382   AC A0A0M0KZE0.1
#=GS R7M8A0_9CLOT/57-264       AC R7M8A0.1
#=GS G7W855_DESOD/64-383       AC G7W855.1
#=GS A0A1I4JPL5_9BACI/68-388   AC A0A1I4JPL5.1
#=GS A0A0M2U643_9FIRM/65-386   AC A0A0M2U643.1
#=GS R7ETP2_9FIRM/72-385       AC R7ETP2.1
#=GS I7KA59_9CLOT/54-376       AC I7KA59.1
#=GS A0A0H4P0Y7_9BACI/70-390   AC A0A0H4P0Y7.1
#=GS G4KPT2_OSCVS/45-356       AC G4KPT2.1
#=GS A0A176U881_9FIRM/72-392   AC A0A176U881.1
#=GS A0A1I0Z6N8_9BACL/107-425  AC A0A1I0Z6N8.1
#=GS R6XGP5_9CLOT/58-288       AC R6XGP5.1
#=GS R6FK72_9FIRM/38-359       AC R6FK72.1
#=GS A0A1B9AR33_9BACI/71-391   AC A0A1B9AR33.1
#=GS A0A1H9PN03_9BACI/65-384   AC A0A1H9PN03.1
#=GS A0A1T4WX58_9CLOT/51-373   AC A0A1T4WX58.1
#=GS C6CU16_PAESJ/85-405       AC C6CU16.1
#=GS Q18B59_PEPD6/77-398       AC Q18B59.1
#=GS C0ZBZ4_BREBN/71-391       AC C0ZBZ4.1
#=GS C4IL72_CLOBU/112-434      AC C4IL72.1
#=GS U2M6U5_9FIRM/61-376       AC U2M6U5.1
#=GS R6MMR3_9FIRM/50-361       AC R6MMR3.1
#=GS A0A0A1MXH4_9BACI/76-395   AC A0A0A1MXH4.1
#=GS A0A1S8M9T5_9CLOT/58-380   AC A0A1S8M9T5.1
#=GS A0A1H9ZZI7_9FIRM/68-388   AC A0A1H9ZZI7.1
#=GS R5PDC5_9CLOT/118-436      AC R5PDC5.1
#=GS R6CK21_9FIRM/55-376       AC R6CK21.1
#=GS A0A109MST2_9BACI/75-395   AC A0A109MST2.1
#=GS A0A1V2LV16_9FIRM/60-381   AC A0A1V2LV16.1
#=GS R6TZ24_9CLOT/66-377       AC R6TZ24.1
#=GS R5KXJ5_9CLOT/148-468      AC R5KXJ5.1
#=GS A0A1Y3Q7I6_9FIRM/56-374   AC A0A1Y3Q7I6.1
#=GS R7IS83_9CLOT/75-394       AC R7IS83.1
#=GS A0A0A2UVI8_9BACI/65-385   AC A0A0A2UVI8.1
#=GS A0A1V4IRX5_9CLOT/100-422  AC A0A1V4IRX5.1
#=GS R9KI72_9FIRM/81-400       AC R9KI72.1
#=GS A0A037Z4R9_CLOTT/58-380   AC A0A037Z4R9.1
#=GS A0A1W1VZ10_9THEO/79-399   AC A0A1W1VZ10.1
#=GS A0A1G9Z7I7_9BACI/64-382   AC A0A1G9Z7I7.1
#=GS R6D997_9FIRM/42-358       AC R6D997.1
#=GS A0A1D9FP91_9CLOT/62-383   AC A0A1D9FP91.1
#=GS A0A1I0V6P7_9BACI/70-389   AC A0A1I0V6P7.1
#=GS A0A151AQF1_9CLOT/55-377   AC A0A151AQF1.1
#=GS A0A0V8JN32_9BACI/67-387   AC A0A0V8JN32.1
#=GS R6G4F8_9FIRM/57-377       AC R6G4F8.1
#=GS A0A1H4LFS8_9BACL/72-391   AC A0A1H4LFS8.1
#=GS A0A0J5JWI8_9BACI/63-383   AC A0A0J5JWI8.1
#=GS N9WGH0_9CLOT/76-398       AC N9WGH0.1
#=GS A0A1G7R9G8_9BACL/72-392   AC A0A1G7R9G8.1
#=GS R6BUZ6_9CLOT/30-350       AC R6BUZ6.1
#=GS A0A1G5KEW0_9CLOT/61-382   AC A0A1G5KEW0.1
#=GS B8I3B7_CLOCE/70-391       AC B8I3B7.1
#=GS E6TXP2_BACCJ/67-386       AC E6TXP2.1
#=GS D9R8P8_CLOSW/64-384       AC D9R8P8.1
#=GS I8UKI1_9BACI/70-390       AC I8UKI1.1
#=GS A0A1Y4S6G1_9FIRM/1-83     AC A0A1Y4S6G1.1
#=GS C4Z0I0_EUBE2/49-359       AC C4Z0I0.1
#=GS R6RQG5_9FIRM/44-364       AC R6RQG5.1
#=GS R6I0K0_9CLOT/55-374       AC R6I0K0.1
#=GS A5N7I3_CLOK5/76-398       AC A5N7I3.1
#=GS L7VLG9_CLOSH/76-397       AC L7VLG9.1
#=GS A0A1M4U6H0_9THEO/65-386   AC A0A1M4U6H0.1
#=GS N2AD95_9CLOT/123-443      AC N2AD95.1
#=GS A1HQ74_9FIRM/59-378       AC A1HQ74.1
#=GS A0A1S8TTC2_9CLOT/158-480  AC A0A1S8TTC2.1
#=GS SP3AE_BACSU/72-392        AC P49782.2
#=GS A0A089JER9_9BACL/93-413   AC A0A089JER9.1
#=GS R7HAC7_9FIRM/105-424      AC R7HAC7.1
#=GS A0A135L347_9BACI/66-386   AC A0A135L347.1
#=GS S6EZV7_9CLOT/82-404       AC S6EZV7.1
#=GS A0A1K1PIG7_9BACL/114-434  AC A0A1K1PIG7.1
#=GS A0A0A3J6W8_9BACI/1-295    AC A0A0A3J6W8.1
#=GS A0A150Y9A4_9FIRM/1-190    AC A0A150Y9A4.1
#=GS G8LWK0_CLOCD/77-398       AC G8LWK0.1
#=GS A0A0U5P0U3_9CLOT/78-398   AC A0A0U5P0U3.1
#=GS A0A1I0FHT3_9BACL/95-415   AC A0A1I0FHT3.1
#=GS A0A172TLZ4_9BACL/67-388   AC A0A172TLZ4.1
#=GS C9R8Z6_AMMDK/56-376       AC C9R8Z6.1
#=GS V6MCD1_9BACL/69-389       AC V6MCD1.1
#=GS A0A1H0WJ22_9BACI/62-382   AC A0A1H0WJ22.1
#=GS E2ZIP8_9FIRM/56-358       AC E2ZIP8.1
#=GS A0A0L6JLS8_9FIRM/53-374   AC A0A0L6JLS8.1
#=GS A0A1W1X103_9CLOT/58-380   AC A0A1W1X103.1
#=GS F4LVG3_TEPAE/66-386       AC F4LVG3.1
#=GS A0A259UUV1_9FIRM/59-378   AC A0A259UUV1.1
#=GS U5MSV0_CLOSA/101-423      AC U5MSV0.1
#=GS A0A0Q7SS52_9BACL/69-389   AC A0A0Q7SS52.1
#=GS R6DW40_9CLOT/29-349       AC R6DW40.1
#=GS R5IX65_9FIRM/58-362       AC R5IX65.1
#=GS R6JQT3_9CLOT/112-432      AC R6JQT3.1
#=GS R9N9C2_9FIRM/88-408       AC R9N9C2.1
#=GS A0A135WRD7_9BACL/1-293    AC A0A135WRD7.1
#=GS A0A0K9GAV9_9BACI/72-392   AC A0A0K9GAV9.1
#=GS R5HR35_9FIRM/1-115        AC R5HR35.1
#=GS X4ZNT4_9BACL/120-439      AC X4ZNT4.1
#=GS A0A179SY26_9BACI/71-391   AC A0A179SY26.1
#=GS F5SB04_9BACL/72-393       AC F5SB04.1
#=GS F6CL73_DESK7/65-386       AC F6CL73.1
#=GS R6UG59_9CLOT/70-382       AC R6UG59.1
#=GS R9K4H5_9FIRM/126-446      AC R9K4H5.1
#=GS A0A1H0MYZ2_9CLOT/84-406   AC A0A1H0MYZ2.1
#=GS D1PKW5_9FIRM/26-337       AC D1PKW5.1
#=GS F3BA00_9FIRM/60-380       AC F3BA00.1
#=GS A0A1C7I7N5_9FIRM/171-490  AC A0A1C7I7N5.1
#=GS A0A0A2U157_9BACL/69-389   AC A0A0A2U157.1
#=GS B1I3B1_DESAP/59-380       AC B1I3B1.1
#=GS N4WAX1_9BACI/65-385       AC N4WAX1.1
#=GS Q5WF51_BACSK/70-390       AC Q5WF51.1
#=GS R9JPC6_9FIRM/33-353       AC R9JPC6.1
#=GS M1MJK6_9CLOT/91-413       AC M1MJK6.1
#=GS A0A0B0HTX2_9BACL/68-388   AC A0A0B0HTX2.1
#=GS A0A285TUN0_9BACI/1-296    AC A0A285TUN0.1
#=GS A0A0D1WB59_ANEMI/73-392   AC A0A0D1WB59.1
#=GS A0A1I3U4D1_9BACL/68-387   AC A0A1I3U4D1.1
#=GS R5DFA7_9FIRM/82-402       AC R5DFA7.1
#=GS A0A1I5UNI2_9FIRM/18-331   AC A0A1I5UNI2.1
#=GS K4L228_9FIRM/88-407       AC K4L228.1
#=GS A0A0A3J3I1_9BACI/1-290    AC A0A0A3J3I1.1
#=GS A0A150M7H4_9BACI/74-393   AC A0A150M7H4.1
#=GS W4EQD6_9BACL/1-294        AC W4EQD6.1
#=GS A0A2A9CI29_9BACI/70-390   AC A0A2A9CI29.1
#=GS R6ZV06_9FIRM/59-379       AC R6ZV06.1
#=GS C8WXI0_ALIAD/87-404       AC C8WXI0.1
#=GS A0A0M3DKQ0_9FIRM/65-386   AC A0A0M3DKQ0.1
#=GS A0A1E5LKG6_9BACI/51-371   AC A0A1E5LKG6.1
#=GS R7JX31_9FIRM/57-376       AC R7JX31.1
#=GS R5TZG3_9CLOT/87-407       AC R5TZG3.1
#=GS A0A1I2MV85_9FIRM/66-387   AC A0A1I2MV85.1
#=GS R5E784_9CLOT/57-376       AC R5E784.1
#=GS R6MJ91_9FIRM/83-403       AC R6MJ91.1
#=GS A0A0F2JML4_9FIRM/64-383   AC A0A0F2JML4.1
#=GS F2F909_SOLSS/1-296        AC F2F909.1
#=GS A0A1Y4J1I4_9FIRM/36-346   AC A0A1Y4J1I4.1
#=GS A0A285BJF6_9FIRM/60-381   AC A0A285BJF6.1
#=GS F3AI43_9FIRM/76-396       AC F3AI43.1
#=GS A0A0M0XB78_9BACI/75-395   AC A0A0M0XB78.1
#=GS A0A0J1DPX1_9FIRM/47-365   AC A0A0J1DPX1.1
#=GS A0A143XYL5_9FIRM/43-363   AC A0A143XYL5.1
#=GS A0A069DHL9_9BACL/70-390   AC A0A069DHL9.1
#=GS F0Z5K4_9CLOT/74-394       AC F0Z5K4.1
#=GS A0A174LIJ0_9CLOT/87-407   AC A0A174LIJ0.1
#=GS R5QY43_9FIRM/71-391       AC R5QY43.1
#=GS D5DS78_BACMQ/67-387       AC D5DS78.1
#=GS A0A0J8DAL1_CLOCY/53-375   AC A0A0J8DAL1.1
#=GS A0A1M6MJ38_9FIRM/55-375   AC A0A1M6MJ38.1
#=GS A0A1Y4N759_9FIRM/94-405   AC A0A1Y4N759.1
#=GS Q894G0_CLOTE/58-380       AC Q894G0.1
#=GS A0A0B3VKE9_9FIRM/67-388   AC A0A0B3VKE9.1
#=GS R5ABQ4_9FIRM/53-372       AC R5ABQ4.1
#=GS A0A1Y3XFY1_9FIRM/50-361   AC A0A1Y3XFY1.1
#=GS A0A0K8JIK4_9FIRM/61-379   AC A0A0K8JIK4.1
#=GS A0A154BUE9_9FIRM/65-383   AC A0A154BUE9.1
#=GS R6QUD5_9FIRM/47-367       AC R6QUD5.1
#=GS I8RJN5_9FIRM/59-379       AC I8RJN5.1
#=GS A0A1Q9JZ55_9FIRM/56-375   AC A0A1Q9JZ55.1
#=GS R6IQE6_9CLOT/63-374       AC R6IQE6.1
#=GS R9LS01_9FIRM/68-380       AC R9LS01.1
#=GS A0A090ZHC3_PAEMA/72-392   AC A0A090ZHC3.1
#=GS R6TAR7_9FIRM/43-362       AC R6TAR7.1
#=GS R6Z6G0_9CLOT/54-373       AC R6Z6G0.1
#=GS D4M5J1_9FIRM/80-400       AC D4M5J1.1
#=GS A0A0M4G6V6_9BACI/68-388   AC A0A0M4G6V6.1
#=GS R6RCG0_9FIRM/63-376       AC R6RCG0.1
#=GS R5XJW5_9FIRM/66-381       AC R5XJW5.1
#=GS A0A255ILA0_9FIRM/50-370   AC A0A255ILA0.1
#=GS Q3EN76_BACTI/63-383       AC Q3EN76.1
#=GS W0ED05_9FIRM/95-415       AC W0ED05.1
#=GS G2SX14_ROSHA/73-394       AC G2SX14.1
#=GS A0A1I3NCW7_9FIRM/58-369   AC A0A1I3NCW7.1
#=GS A0A1V4IAP4_9FIRM/58-379   AC A0A1V4IAP4.1
#=GS R9MEB3_9FIRM/64-384       AC R9MEB3.1
#=GS A0A150N0R3_9BACI/62-380   AC A0A150N0R3.1
#=GS A0A1R1AND5_9BACL/87-407   AC A0A1R1AND5.1
#=GS A0A0A3HQE4_9BACI/1-295    AC A0A0A3HQE4.1
#=GS A0A0H3J229_CLOPA/56-378   AC A0A0H3J229.1
#=GS R6NXX0_9FIRM/62-379       AC R6NXX0.1
#=GS A0A1I0FUG0_9BACI/70-390   AC A0A1I0FUG0.1
#=GS A0A1M7YIW2_9FIRM/55-375   AC A0A1M7YIW2.1
#=GS A0A132NG31_HYDSH/58-374   AC A0A132NG31.1
#=GS A0A1T2XNH6_9BACL/70-390   AC A0A1T2XNH6.1
#=GS R7RQ73_9CLOT/53-375       AC R7RQ73.1
#=GS A0A1S9CTM7_9FIRM/57-378   AC A0A1S9CTM7.1
#=GS R5XPD2_9CLOT/60-379       AC R5XPD2.1
#=GS F7KQ70_9FIRM/66-386       AC F7KQ70.1
#=GS A0A075R3C7_BRELA/67-387   AC A0A075R3C7.1
#=GS A0A0M4FJE5_9BACI/85-405   AC A0A0M4FJE5.1
#=GS K6DBF0_9BACI/72-392       AC K6DBF0.1
#=GS A0A1I2J6I8_9CLOT/56-378   AC A0A1I2J6I8.1
#=GS B7GHF1_ANOFW/60-379       AC B7GHF1.1
#=GS A0A0M1P3L1_9BACL/76-395   AC A0A0M1P3L1.1
#=GS A0A1Y4GZF4_9FIRM/55-366   AC A0A1Y4GZF4.1
#=GS R5BD74_9CLOT/28-345       AC R5BD74.1
#=GS A0A150KMG5_9BACI/68-387   AC A0A150KMG5.1
#=GS D5WV76_KYRT2/147-459      AC D5WV76.1
#=GS R6MGD7_9FIRM/32-352       AC R6MGD7.1
#=GS A0A1Y4S253_9FIRM/80-400   AC A0A1Y4S253.1
#=GS A0A1M6F4X3_9CLOT/57-378   AC A0A1M6F4X3.1
#=GS A0A1K1U087_9BACL/74-391   AC A0A1K1U087.1
#=GS M1ZBX8_9FIRM/69-389       AC M1ZBX8.1
#=GS Q8EQ33_OCEIH/67-385       AC Q8EQ33.1
#=GS A0A2C1KQ27_9BACI/74-394   AC A0A2C1KQ27.1
#=GS A0A1M5T3S6_9CLOT/70-392   AC A0A1M5T3S6.1
#=GS U5LFS3_9BACI/72-392       AC U5LFS3.1
#=GS A0A1Y4TMJ7_9FIRM/51-370   AC A0A1Y4TMJ7.1
#=GS A0A0N8GGW5_9BACI/72-392   AC A0A0N8GGW5.1
#=GS A0A0Q3RWX9_9BACI/3-292    AC A0A0Q3RWX9.1
#=GS R5XG71_9CLOT/75-396       AC R5XG71.1
#=GS A0A090IWB8_9BACI/77-395   AC A0A090IWB8.1
#=GS A0A0M8QAK6_9BACI/1-297    AC A0A0M8QAK6.1
#=GS A0A2A8ILY9_9BACI/72-392   AC A0A2A8ILY9.1
#=GS A0A1V4IUW2_9CLOT/56-378   AC A0A1V4IUW2.1
#=GS R7LA14_9CLOT/63-382       AC R7LA14.1
#=GS A0A0U1KMX5_9BACI/74-391   AC A0A0U1KMX5.1
#=GS R5NR28_9CLOT/58-352       AC R5NR28.1
#=GS A0A101E9G6_9FIRM/1-145    AC A0A101E9G6.1
#=GS V6T1K6_9BACI/72-392       AC V6T1K6.1
#=GS A0A1V2YDN3_9FIRM/61-382   AC A0A1V2YDN3.1
#=GS A0A1B1Z619_9BACI/67-387   AC A0A1B1Z619.1
#=GS A0A0M2SK36_9BACI/69-389   AC A0A0M2SK36.1
#=GS R8NWR3_BACCE/63-383       AC R8NWR3.1
#=GS Q65HI0_BACLD/74-394       AC Q65HI0.1
#=GS X0RKT1_9BACI/74-394       AC X0RKT1.1
#=GS A0A0U1P1E8_9BACI/72-392   AC A0A0U1P1E8.1
#=GS A0A1Y4LIK4_9FIRM/41-354   AC A0A1Y4LIK4.1
#=GS E5WIF8_9BACI/75-358       AC E5WIF8.1
#=GS A0A0J1IMP3_BACCI/83-403   AC A0A0J1IMP3.1
#=GS A0A1M4SD22_9FIRM/59-379   AC A0A1M4SD22.1
#=GS W7YWA5_9BACL/69-389       AC W7YWA5.1
#=GS R5W373_9DELT/54-374       AC R5W373.1
#=GS A0A1H1MS11_9BACL/75-395   AC A0A1H1MS11.1
#=GS R5JFX9_9FIRM/95-412       AC R5JFX9.1
#=GS A0A1H3K9M4_9FIRM/66-387   AC A0A1H3K9M4.1
#=GS R5EC19_9FIRM/35-343       AC R5EC19.1
#=GS A0A073JZ77_9BACI/57-377   AC A0A073JZ77.1
#=GS A0A143HBQ1_9BACL/4-292    AC A0A143HBQ1.1
#=GS A6NV00_9FIRM/56-369       AC A6NV00.1
#=GS F4XAH8_9FIRM/38-351       AC F4XAH8.1
#=GS E7GNS3_CLOSY/81-401       AC E7GNS3.1
#=GS R6BIA5_9FIRM/1-299        AC R6BIA5.1
#=GS A0A0N0YG24_THEVU/52-372   AC A0A0N0YG24.1
#=GS A0A1E7DMT6_9BACI/43-354   AC A0A1E7DMT6.1
#=GS D6DGY9_CLOSC/96-416       AC D6DGY9.1
#=GS A0A1H2UAZ3_9BACL/72-391   AC A0A1H2UAZ3.1
#=GS A0A226YU93_9BACI/68-388   AC A0A226YU93.1
#=GS A0A231QZD8_9BACL/83-402   AC A0A231QZD8.1
#=GS A0A1M5CYQ8_9BACI/69-389   AC A0A1M5CYQ8.1
#=GS A0A1I6Q974_9BACI/62-382   AC A0A1I6Q974.1
#=GS R9KZ39_9FIRM/31-351       AC R9KZ39.1
#=GS A0A1D8GPQ2_9CLOT/51-372   AC A0A1D8GPQ2.1
#=GS A0A0V8JF52_9BACI/74-394   AC A0A0V8JF52.1
#=GS A0A0U3W4B5_9BACI/69-388   AC A0A0U3W4B5.1
A0A1Y4VI14_9FIRM/127-446             ......................................................d--FSAIFDALLD-FRFTDALEE.AGMWLLETLTYEISTSWVLMGELIGVIIFAAVFNNISSSFR.Q.FAI.G...DSGFLISYFITFTIIFSNFTIMANLFSHTVETLSKLLKMLIPAYTLAVTLSG........NLTVGVVFYEYFMIVVLVVNWICLT........VVLPMIQYYL...LLELLNNFS.A..RPNISRLCESLYLLLSKSMKFLFVLFFGFHLLETMVVPSFDTTKNAVFNRIVGM-IPGVGSVVQSVAGTVVGSALMIKNTMGAAAIIFILLFLAVPIIKL.LLYCLFYLLLSILLEP..V.A.DERFI...RCISAAQKGGILLVYT..LGI..TA..A..LFILTIAVTSLA-t...........
A0A1V0KYJ3_9BACL/1-292               ........................................mlnflhesiagvvgp----------------------.-------------------FFLLLIMLLLASLVDFFFPA--.-.--F.Q...KWTRFLLLILILVLLIEPAKDSFEQIQVITHSIASLFLGMYPLIAAMILASG........ATFGVLNFQPALLLFAQGAVVFADK........FLLPVLLTAL...LLDIFTRLV.P..EIVFNKMADLLRTSLLAIVSALVAAYSIFITAGGALSWTMNGALNEPLKELIKQNIPVIGSLLTDTLGSIGRYSSGATAYMSVWLLVSIWTIALLPAVRI.LCIAFLFRWTAAIIEP..F.S.QKEVC...GLLDDIGRTLFVLCAI..SFL..LS..F..AFIYTTIFIV---tfi.........
E9SFL2_RUMAL/63-373                  .................................................idsltg-----------------LDQRS.FFASLWDKFTEMLTKPLVMLGRILAVSLIYSAMNMLC--TE.N.SEL.T...DVFGTLCVICVVTVMAESLSDSFERLQNSVNSINTFMISYIPIFSAVTTAGG........HAATAGVYSASTVLVCEAAELISSK........LLIPLLSTIT...ALSVVSVTD.P..KLKISGFTDALRKLTTWLLSTVMLVFVGLLTIQGVTGKAADDLVSRTLRFTASSFIPVIGSSVSDAFLAVKSGAGVIKAAVGGFGMIAVFLIALRPFMLI.ISMKLTIWAGRIANEL..L.G.IQRTA...EFLKNINSVLSIGLSI..LIA..IT..A..AFLIATAALMA--vmt.........
J3AZA9_9BACL/71-390                  .................................................ksqgfi--------QILM-QQEELTISG.VLQGMGKFIFHEILMNGKLLSSIIIITVFAMILETMQNAFE.R.NAV.S...TVAYSIAYLVLMVLAINSFHLAITYAKDAISSMTDFMLAMIPLVIALLASVG........NLATATMFHPLIIFMINISGMMITY........VVFPLLFLSA...MLSIVSLFS.E..RYKVTQLATLLRNIAMGVLGSFLTIFLAVISIQGATSAVADGVTLRTAKYITGNFIPIVGRMFSDAADTVLNASLLVKNAVGLAGVVILIILCAFPALKI.LVLALIYNVSSAVLQP..L.G.NSPII...SALGTIGKSLLFVFAA..LAT..VG..L..MFFLAITIIIAAG............
A0Q094_CLONN/59-381                  .......................................................MDVKTYVKDYMKNGSGNISVGK.FAKAILMYSFREVIACSKLMAMIIIIAIICALINNLENAFS.N.GNL.S...NVAYFACYALLIIIVTKSFYIGVLEIKDILKGMTDFMAALIPVLLMLLASVG........GFTEAATMDPVIIGVTNISARVFTD........LIIPIITISF...VIQLCNNIS.S..DHKMEKLSGLLNKSVLWIQGIIMTIFIGVITIRGLTTSTIDAVAEKTVKFAIDNFVPVVGKSLSDAISTVAGYSLLLKNALSSVGLVILVTIILFPIIKM.LAMGFIYKLTGALVEP..I.S.DSKLV...KCIESAGDSIILMTSC..VIS..VS..V..MFFIIICIIAGAG............
A0A1B1N0J9_9BACL/77-396              ...................................................lpaf-------KEMILPGGDGFSIPA.GLSGLLRFMWHEVLYNAKILVTIVVLTVFSMLLETLQSAFE.K.GSV.G...KIAFYICYMVLIILAINSFHVAISYAAKAIEGMIDFMMAMVPLLFTLLASMG........NVVTVSVTHPLVVFMVHSVGTLVHV........VVFPLLFFSA...ILHIVSSMH.E..RYKLSRLADLLRTVAMGLLGVMLTIFLGVISVKGIAGSVADGVTLRTAKYLTGNFVPVVGKVFSDATDTVISASILVKNAVGIVGVVIILFLCAFPAIKI.LTLALIYNFTAAVMQP..L.G.DTPIV...ACLETIGKSMLYVFAV..LAA..VG..L..MFFLAITIMLTAG............
A0A1T5E8Q0_9BACI/1-297               ......................................................m-------------------LEQ.IFSFLIDPFFLLLKMTLILCGYVIIILIINMILPEFE----.-.KGT.R...ILFFLIVLATIGPVVVNSFNLIDDIAK----GLAHIFTAFYPILTSSFLLSS........SITAIASWQPFLLFFVQVLTIISSK........WLIPGVLLAI...VFDVCSVIV.K..EISFTRIAELIRFTIMSIVSASVICYIILMSASGVAAFSVNAAVAEPVKKLIEENIPVVGSFIVDSFSMFQHMTQFASSISSITAFIAVITVSFIPTVQL.VVAAYSLKMLAAILEP..I.A.FDDIC...RLLDHVSKSLFTLCAV..SFL..IA..FsfMFSCLFLIV----fvq.........
R7BG60_9FIRM/48-368                  ......................................................v-EFEDIASLVMC-GKYSDALRM.AGTAAVYGIFGGFVRQKEIFIKLFLLGIAGALFKNLAGTFF.E.AGM.A...KTGKYIIQIALMAVMTSGMMWAAGVAEELLESIVGFMEVLIPTYAIVITAGS........GSAGAAAFYEMAMFLIMLVDKVILK........VIIPGASVYM...VINMMNFLS.K..DSIFGKLAELIKEMLEWLNKALFGVVIGLNIIKGLISPMLDSLKGTAFTKLVGM-IPGAGTAADAVAGIVIGTGALIKNSIGVAAMIVIVMLCAMPAVKL.FVFSYGCKAAGALLEP..V.A.DKNYT...ECVSGMHEGISLLMVS..SVN..AG..I..MVLITIAMVCAST............
R6IG39_9FIRM/35-349                  .......................................yarnlageatqpaseg-------------------LER.IESAFTETLSGGLSGVIKRSLSIIAVAVICAVLTVFCD---.-.-DA.P...EYVSLGGCAAIAIISVSDVNSFVSSGADVITALSGFSKTLLPAMCAASAACG........TLSSATVKYAASVLFLDSFVTIAQS........VILPVIYAYL...AAGMASSSF.G..SKSLKDISALLKRACTLLMTAAALGFTAYISISSIVASGGDAVASKLAKTAISTALPVVGGIISDAAGTVVAGAEAMRNTLGVFGMVALLAICVSPFAVM.ALNYIGYKLTAAAVKS..F.G.CARLG...ELTGCIGSAVGMLLGL..VGC..CA..M..ILFVSMAVSIK--av..........
L5N6G5_9BACI/67-385                  ....................................................gen------FRDFID-KESTIEASK.WYSGILKFFFQELMVNGKLLATLLFLTLFSTLLRSIQSAFE.N.SVV.S...RIAYMVIYLVLITLALESFRQVITYTLDTIERMSGFMIGLLPLLLGIMASFT........NLMSISFFHPIIIALVQSSGLLVKY........LLIPLFASSA...LLLIVGTLN.D..DYKVDQLAELLRKTGLAVMGVFLTIFLGVISVQGTVTAVQDGITMKTARFVTGNFVPVIGRLFTDATDTILGASLVLKNTLGIAGVVILLGIAIFPALKV.LAIAIIYKIAAALLQP..L.G.DGPVI...EAMAVVSRHIFYIFAA..LLM..VS..M..MFFLVIVIMVAAS............
A0A1X7HJG8_9BACL/72-391              ....................................................tps-----LMDMLLP-GGQGLSLKG.VLSGIGSFMWHEVLYNGKLLATIVMLSILSMILENLQTAFE.K.STI.S...RVAYTICYMVVLVIAVNSFNVAVGYARDAIDRMIDFMMAMLPLLFALLASMG........NIVTVSVAHPLVIFMVHTVGTLIST........IVFPLLFFSA...VLHLVSSLS.E..KYKLTQLGNLLRGIGMGVLGVLLTVFLGVISVQGITSSITDGVAIRTAKYVTGNFVPVVGKMFADATDTVISASLLVKNSIGLAGVIIILFLCAFPAIKI.LILALIYHVAAAVMQP..L.G.ETPIV...TCLHTIGKTMLYVFAA..LAA..VS..M..MFFLAITIILTT-a...........
J1H3I9_9CLOT/64-374                  ...................................................qsil----------------NLTPET.IFEQIGSSALQQSAAPVRALLSVLAVILLCALMNGMKLSFG.D.RPL.S...GVIGMVGTLCICTVVIQPIVTCIENVAFVIKGAAGFLLASIPILTGIMIAGG........QTISAGSYNLLMLGAGNVISVIAST........VLVPLLNIFL...AFSVVSAVS.P..AMNLGGLCDLFSKTVKWVLTFCMTIFSGLLTMQTVVSSAADGAGAKTVRFMVSAFVPVVGSALSDAIGSVQSSVKLLKSGVGAFGLLATGAIFLPAALEC.LIWLLTLTACAAAGDI..F.E.LKEIT...TLLRSSMKVIQILLSI..ILC..CF..V..ILMISTVLMMAMG............
A0A1H8ETU9_9BACL/72-390              ................................................pglfdll----------LF-NKENLSTKE.VATAFLRYFFHEVLYNGKLLGTIIVLTVFSMILQTLQTAFE.N.NQV.S...KVAYAIVFMVIIILAVDSFAVAVDAAKTAIGRMIDFMLALIPLLLTLLTTMG........NIGSVTLFHPLIVFMIHVIGTFIYT........FVFPLLFFAT...ILSIVSSLS.E..KYKVNQLAGLLRKVSVAVLGGLLTIFLGVISVQGATSAVTDGITIRTAKYITGNFVPVIGRTISEAADTVVGASLLVKNTVGLAGVIILLMVCAFPALKI.LSLAFIYNFSAAIMQP..L.G.NSPII...ESLSIIGRTLFYIFAA..LAA..VG..L..MFFLAITIIVASG............
R6ALG3_9CLOT/99-419                  .....................................................dv---KTLIEKAASNVIEADEPTS.ILLIVKDIFVPNLRFALVRTAGIAALGILTGLCGIAIG-DE.C.AGT.K...KMLLLFLCAAAILSISAVFSDLTGTAADAIGKMRCFSETVEPIMIGLLTAMG........CAKTAKLMNPMLVFLINGIVYVIEK........IVLPMLLAAG...VLTIVDGLS.D..KLKVGRTVKLLHKSVKWLLGLLTTVYIAVTVVGGMTAGAADGISVRTAKYAIDRLVPAAGGMVTGAADAVLGSSALLKNSAGTVAIILAAAVIAKPMLTV.AGGMFALRITSAICEP..F.S.DERIP...KMLDGIAETVSYLFAA..VAA..VT..G..MFVISLVVMLLT-g...........
A0A1G9KWP8_9FIRM/60-379              .....................................................ns----DTVKEIAT-RGVALDWDS.LWRSAAAKFFKEMAVNMHLMGKLLFLAVLCVLLQNLQSSFE.Q.SGI.S...VLAYSVCFIFLSVIALTAFYHAITLARDTIGHMVSFMEALLPLMISLLAGVG........ALTSAALLTPLMLFVISAVSVVVKN........VILPLLLITS...VLDCVNYLS.D..KYRLGNLTSLFKQTGMMILGFTMVVFIGIITVQGVAGGVADGITLRTAKYATTTFIPVVGKMFADTVELVMGASLLLKNAVGIFGVIVVAAICALPLIKL.LSLVAIVKVTGALVQP..M.G.DDRMG...RCLDAMGNNLLLVFGA..LLT..VV..L..MFFLAITMIIGAG............
A0A0P8YYP8_9CLOT/62-383              ......................................................l-DFKTFINV-FKTGEMGYSMEE.ILMAVVRFFISDVLLNAKLLGQLVVLAIICGVMQNLEKAFN.S.DSV.S...SLAYYACYLVLIILVVKSFSLAIGIGKETIGKMVEFMIALIPTLMALLASVG........GFASVTVLDPIILASVQFMGNLVQN........FILPLIFIIS...ILSIVNNLS.D..TFQVTKLNSLIKQICVWTLGFSLTIFVGIISIRSTAVKTLDQMTLKTAKYAVDNFIPIVGKALSDAITTIAGYSLVLKDALSTVGLLALILTCIFPLLKI.ISLIFIYRIAAAIIEP..V.S.DKKIV...GCINDVGNSLTLVFAS..VLC..VA..I..MLFIMVTIMASSG............
D4K4C6_9FIRM/52-359                  ....................................lekaasspwetlksflprs----------------------.--------FGALVRQTASRYTSVLLFLTLTAVLGLLAGECT.D.GAL.L...DLVAA---GGCGVLLWGSLLEEARKLCEQVESWRSFLLGFLPVYAGVLTMGG........EGAAGSAASGALLTALCFLAQLAAA........FVQPLLHCYL...MLSMACCVS.S..EPALGVFCKGVGSALRQALGWAGKILVALLGLQRAAAFQLDRFSLRTGQLLAGS-VPIIGQTLSSASESILAGIQLLKSGLGLAALSVLGAEFVPLYLGL.MIQLALLMGCSLLCSL..T.G.ISRCR...ALFDCFAEAVRCMAAV..VAL..FF..G..L------------aaagvvllfivg
A0A1H0AR47_9FIRM/65-381              ............................................idkisigsfln-----------------LEPLQ.FFKIIWLMIKDTLAKPRILFFSILGIIILCSLVDGFKEGFL.Q.KPI.G...GVFSTVSVLCIIAGIIGPVWTCIQNTAQAVENCSNFMLGFVPVLSGIMSVSG........QPVTASTYSIFLFSAAELVSQIASS........TVVPLLCIYL...AFCIISAVS.P..QINIAGVAKMIKSSATWILGFIITVFVALLGVQTIVSTGADSVALKAGKFLIGSFVPVVGGALADAVTSVGGCLTLLKNVVGGFGIVSASIIFLPVLVES.AVWYLTLNISAAVSDI..F.E.LKSVS...EVLKASATAVSLLMTI..ILC..FA..L..LLIVTTTITLMI-s...........
A0A0A5GCK6_9BACI/66-385              ..................................................qkgsf-------AEFMK-NHDAVSIQG.WVGGLLKFFFYELVMNGKLLGTLVFLTLFSMILQSLQNAFE.Q.QAV.S...KVAYAIVYMVLIMLALNSFYLAVSYAKDAIEMMSSFMVALLPLMLGLMATFG........NVMAVSFFHPVILFLIHSSGVLIST........IILPLLFLSA...LLSIVSSIN.E..EYKVTQLAQLLRNGAMGILGAFLTIFLGVISVQGATTAITDGVAMKTTKFVTGNFVPVVGRMFTDATDTVLSASLLLKNTVGIVGVVLILALALFPAIKV.LAIALIYKIAAAVLQP..V.G.GAPII...SSMDIIAKHILFIFAA..LLV..VT..F..MFFLTIVLLVVT-s...........
R6HMB2_9FIRM/62-383                  ......................................................t-NIKTLIRRIID-GGEAINTQS.FVKYILNSFFGNVTSLAPFIASVLAICVIFGLINAIKGNFA.S.KST.E...SVVRLACIGVVMIITFTQIVGTVKECKSLIENLKIQMDAVFPVLLTLMAAVG........RSAALPAYQPAVAILSTYAVDVVTM........FALPCFLISV...VFHVVGNIG.D..GIKISGIADFFSGAMKWVLGTAFFLFLAFLSVKGVTAMVYDSVYVRSAKMALTKYVPVIGGYLSEGYNLVLSGSVLIKNGVGLSAMIVLIVSVIPVVVHA.VALIMSVKFVSAISEP..L.G.GKEVC...GIYNGLGKSLTALVAI..VLG..VT..F..LYFVFLLLVVCT-c...........
A0A017RZ61_9CLOT/52-374              .......................................................ISFSKMIESYKKNGSLGITVKD.FTNSLLKFMFKEILLNSKLLVELLFIGIFCALLQNIQNAFS.D.DGV.S...KIAYYACFLVMVVVIIKSFSTAVQLGQRTISNMVEFMNSLMPPLIVLIAAVG........GFASAATLDPIVMFILKVTSDIIRD........LVLPLTILVV...VINIVDNLS.D..SIKISKLGGLIKQVSLWVLGFIMTIFVGIVTIRSNASATIDQVALKSAKFAVDNFIPIVGKCLSDAITTVAGYSLVLKDAISIGGLLVMIFICVFPLIKI.IILALIYKFVGAVMEP..V.V.DKRIV...DCLSATGSSLTMIFIC..VLS..VA..I..MFFIMITIVAST-g...........
A0A0U2UQA5_9BACL/84-402              ................................................pgfaemv-----------VPGGEGLKLST.VLNGLLRFLLQEVLYNGKLLVTIVLLTVFSMLLETLQSAFE.R.NAV.S...KVAYAIAYMVLIVLAVNSFHVAIGYAKDAIGGMVQFMLAMVPLLLTLLASMG........SIVTVSILHPLIIFMIHAVGTLIYS........FVFPLLFFSA...VLHIASALS.E..RFKVTQLANLLRRIAVGVMGVMLTVFLGVISIQGATGSVTDGVTMRTAKFVSSNFVPVVGKMFSDAADTVLSASLLVKNAVGIAGVVILLFLCAFPALKI.LTLALIYNIAAAVMQP..L.G.TSPII...ACLQTIGKSMIYIFAA..LAA..VS..L..MFFLAVTIILTAG............
A0A1M7P6S3_9BACI/59-379              ...................................................lske----NLWDM-IK-GDGELSVQQ.WVKGFFRYFLYEIVENGKLLATLMLLTLFCLLLQTIQNAFE.N.QVV.S...KVAYAIVYMMLIIIALKSFQLASSYVLDTVDMAKSFLIALLPLILGLLASLG........HLVTISFFHPIIIFLIHVSVFIISK........VVIPLFLISA...ILQIVSTIS.P..EYKATKLANLIKNIAISLMGILLTVFLGVISVQGAASAIQDGIAMKTAKFVTGNFIPVIGRIFTDATDTVLSATILIKNGIGMIGVVILIGIVLFPAIKI.FTISLMYKVATAILQP..I.G.DGPVI...ECLDIIGRHILYLFAA..LLL..VT..F..MFFFTIVILIIS-s...........
Q2RI98_MOOTA/84-405                  .......................................................FSLQEILAN-LRQGKMPLDPGA.AARGLLQYLFHEILASGALLGQLIILAVACAVLQNLQSAFS.E.GST.G...TLARGVAFLALITLALASFTIAVRTGGEAIDNMVSFFQSLLPALITLLAATG........GITTSTLLQPVLIYAVTIIGTLMHN........VLFPLLYLTA...VLTVVSQIA.D..RFQVAKLAGLLKQVTMLGLGAMMTVFTGVLSIYGVAGSVADGVGLRTIQFATDALLPVVGGMLSDAVETIAGTTLLLKSAVSLVGVAIIFFLAAFPMLKI.LSLLVVYKVAAAVVQP..F.G.EEKLA...EALDGIGGALTLVFAC..VAV..TG..L..IFFMAIAVIVVL-g...........
A0A240A9L0_CLOCO/58-380              .......................................................MNVKKYIENSMKTGEGDLSIKK.IGKTLIGFLFKELATSIKLMSVIVIIAIICSLITNLEMAFS.N.ESL.S...NIAYFACYSLLIVIMARSFYLGVDLARVTIERMSNFMLILVPVLVMLLFSVG........GVAEAAVMDPVVIISINLASKIFAK........ILIPLISMVF...VLQFVNNIT.E..EYKIDKLTKLLNQIALWGQGILMTVFIGIMTIRGITSKTLDQVVAKTAKYAVDNFIPIVGKCLSDAVSTVAGYSVLLKDAISGLGLVMLIVMVSFPTIKL.LINAFVYKLTAALIEP..I.G.DKRLV...NSISSAGDSLVLISSC..VIC..VS..I..MFFIMISIIAAAG............
R5VSR0_9FIRM/62-379                  ......................................................v-KFSEIYEL-LRTGDIDGACRR.VGRALADSIAYEVRTSRVLALQIIAVIVLGSTFAQVSGNI-.G.EYV.M...ENGFMVTYMVLVSLLLGDFVIVQNVVTDTIGDVTEFMRAFYPMYASQILYVS........GPESAMYSQSVLILVIYICQTGIIG........FILPLIKCSG...IVALVNNLN.K..EDNFSRLAGLMKKLASWGLGTMFAVVTGINVVKSMIAPSIDRVSRNGILRAIGK-MSGM-SSVSAVLSVMISTGEFIKNCMGMACTVIIVILAAVPMIKI.LIIVFTLRCIAAVVQP..V.G.DSRYS...EGVGIMAATAELMLKA..CGI..SV..M..MFVISIALMTM--s...........
R5QK85_9FIRM/26-346                  ......................................................v-SFSDLFGLFIK-GDFTGAYKL.LMQELGQLFFPGITAFREILLAILGIGMVAMLLHYLAGFVK.N.KQV.A...DMTAYFIYLLMMILLFRYVTTMLSISKQNLENLREFMSVLVPGYFLSVSLAG........GSVAAAVNYQFFLLLLMGVDYILLN........LLLPCSKGCI...YLAVMNGID.D..RGRMKELIRLVERTLSLGIKLCLTVTVSVSTMQNLIASKLDGVQKSLLQRAIGS-IPGIGDLSESMVQVFMGSAGLIRNTIGTAGMCMMFFIMIKPMFRI.FCILAAMKLGGACLGL..M.G.LKNLA...TAVSQIGDGGIQMLKI..NLC..GL..L..AFYIAILMTMV--iv..........
A0A1I6DB81_9FIRM/49-370              ......................................................t-DFKSLVRGLAT-GDISLQPAD.IFNRCVQYIFREVVANSALLGKLVVLAVICAVLQNLAGAFE.K.SST.G...QLTHMVAYLVLITIAVGSFGLAIQLGREVVDKMVTLMQALLPLLLTLLVAVG........GITSAAIFHPLIFITITASGTIIKN........IILPLIFFAA...ILEIVSGLS.K..HFQVSRLAGLLKGVAMGLMGLLSTIFLGVMAIQGVAGAVGDSVTFRTAKFATDTFIPVVGGVFSDALEAVIRSSLLMKNAVGIAGVLLIAMIVIIPLVKI.ITIAFIYKLAGAVIQP..V.G.EEKIS...DCLNGLGNSLITVFGA..VAM..VG..L..LFFFALAIVVGL-g...........
A0A0R3JTI1_9CLOT/50-372              .......................................................ISLKSLIENYKSNGSLKITFKE.MIINIAKFSIKEIILNYKLLLEILAIGIISAIIHTLQNAFE.D.NNI.A...KLSSYAIFLIVTIIIIRTFTYAIAVANRAIDDMVNFMNALIPALITMLIGTG........SIATATTLDPILMFFIKFSSDVIKN........IILPITIIAV...VVFLIDNLS.D..DIKISKLGEFINTINQWLLGFIMTIFIGIITVRGITANTFDEVAIKSTKFAVDKFIPIVGGALSDAVTTVASYSLILKDAVSIFGLFIIIGICIFPLIKI.IVLSLIYRFACVILEP..I.V.DDKIV...KPLSVSGKTMLIIFAS..VLS..VA..V..MFFIMITILASAG............
R5MY87_9FIRM/108-428                 .......................................................FSVTEAFHRLLS-GEEVLSEES.VREFLHSLLFSSLEKEKSLIVKLLLLLLFAAVFSGFAGAFD.N.GQI.G...EISFYVVYLLVFTLLMNSFSGLSASLLSILRWITEFMKELSPVYFMAVAAAS........GASTAAVFYQGVLLLVWLFQWILES........VLLPGVSLYI...LLKFVNHLS.R..EEMLGKMAELIETLISWGLRTLLGVVAGLQVVRGLVTPVMDSLKRSAIGKTAGT-LPGVGNAVNAVTELVLTTAVLVRNSLGVVFLLVFLVVGAGPVIRY.GLLALVYRFLAAVAQP..V.S.DKRLV...EVFSTMGEGCALLMRI..LFT..AE..V..LCMLTFLILMA--gg..........
A0A1I3JCR1_9BACL/96-416              ....................................................dvp----SFVEMIVP-GGKGLKLTT.VLSGLLRYMLHEVLYNGKLLVTIVILTVFSMMLETMQTAFE.R.NAV.S...KVAYSITYMVMIVLAVNSFNVAIGYAKDAITGMIQFMMAMVPLLLTLLATMG........SVVTVTVLHPLIVFMIHAVGSVIYT........IVFPLLFFSA...VLHIASSLS.D..RFKVTQLANVLRNVGVGLMGVMLTVFLGVISVQGATGSVTDGVTMRTAKFVTGNFVPVIGRTFSDAADTVLSASMLVKNAIGLAGVVIILFLCAFPAVKI.ITLALIYNVAAAVMQP..L.G.DSPIV...GCLQTIGKTLIYVFAA..LAA..VG..L..MFFLAITIILTAG............
S2YPF3_9BACL/3-293                   ........................................eplyayffgvtryfi----------------------.---------------------VLLIAIVFAMIIDILF----.-.PAA.K...RWTRLSLFCIAVLYTLTPAIDAMHIMQQFARQMVTVFMSVYPVLTAGLLMNS........GTMAFSIWNPALYVFIQFTVVLTER........ILIPLLMTTI...LLDFISRFH.P..ATPFSKLTDIIRTSLLSIVSAVVVIYSFFISVQGFISWNISSAVTEPIKKIIQQNIPFVGSFFSESLSTFTRFSSSITSITGGGIAITILLVVLIPTLKT.ISIAFCYRVVAAIIEP..F.G.PEDLA...SFLDDIGKSIFVLSIL..SFL..IA..F..AFFYTAIFIV---ilvk........
A0A267MQF9_9CLOT/64-385              .......................................................INVKKMLIDIIK-GEGNYSVKA.GIEYSFKVLFREIISNSHILAQIIILSIICTLLSNLSSAFE.S.DSV.A...QLAYMVCYLLIITLAIKNFSNAISIGNKSIDNMLSFMQALFPILITFIVSTG........SITTATLFQPIIYSSISIVSTFMQT........IIMPLIFFTA...ILSMVNNLS.S..KIHINKLSSLLREGTLVAMGFILTLFSGVIAIKGVTSAASDGLTLRTARFAVESFVPVVGGFISDAFDTIIGCSVLLKNAVGIIGIIVLLIIVSMPLLKI.LSLIFLYKISAAIIEP..I.T.DSKLV...NCLNEISKAMVLVFAV..VAS..VA..I..MFFLAVTIIIGTG............
R5ITP2_9CLOT/66-386                  ......................................................v-SLTDLMQVIIQ-GNMKEIVNT.AGKLLEDALFSQAKEGQALLVQVAVLGLTGAVFSHAASAFK.G.SQI.P...ETAFYMIYLLIFTCLAGSFLSSIQITAQVLDQILEFVRLLMPAYFISVAFAG........GSTSAAAFYEIALGAAWAVQWLCRQ........VFLSIVRVYG...LLVLGDHMM.E..EPFFSKMTELMEKIVSWGLRSILGLTLGLQILQSLVLPYADSAGRSAIMKFAEM-IPGLGQATGAAARLVFGSSVLIKNSLGAAAVLILAVITLVPVVKL.AVLMVMYQGAAALLQP..V.C.DKRII...SCIQGMAAGHGLLLRI..TLY..SL..F..LFILVIAITCA--gt..........
A0A1I6B1A5_9BACI/1-295               ...............................................meemlmsl----------------------.---------VQPVKEVAQTFSYMLLFGFIFICLEWFIPS--.-.--S.K...KLLKLLFMLIICIYCLEPAIRSLEMIQAMTKELVTLFLGIYPILTLGIAASG........GAFLITSWNPAVMLFASFTTVLAGK........ILIPAIMAAF...IFDLISRIH.P..PTSFAKMADLIRLTLIGSTSIILLLYSIFMSVNGVITWSVSGTVNETVKRLIQNNIPFVGSLLTESISTMKNFSSSASVITGNAVILSVLMLVSIPTIQT.ILIAFLYRLLSAILEP..F.V.EGNIS...GLLDDIGKTLFVLSII..SVL..IA..F..TFFFTIILTM---lfa.........
A0A2C1YG53_9BACI/72-392              .................................................sqkgsl-------YDFVK-GDKKFSFKQ.WGQGILKFAFHEFIANGKLLGSLIMLTIFSMFLQSMQNAFE.K.STI.S...KVAYSIIYMVLVILALNSFHIAISYTNEAIGTMISFVLALVPLLLALIAASG........GVVSAAFFHPVILFLMNSSGLIMQY........VILPLLFLAT...LLSIVSTMS.E..QYKVSQLAALLRNWSIGLMGLFLTVFLGVISVQGASAAVTDGVAIRTAKFVTGNFIPVIGRMFTDATDTVVSASVLLKNTVGIAGVAILLIIVAFPALKI.LMISFIYKFAAAILQP..L.G.GGPVI...KCLDIISKSVIYVFAA..LGI..VS..L..MFFLSITVIVAAG............
A0A1S9CCK7_9FIRM/68-389              ......................................................f-DLKHEVMLILK-GQKEFNLST.VLEFIKDSLFADVFTYINVIVRFILIVIICNMLNNLSAAFD.T.KAT.T...KIAFFVCNIVVLYSVMQSLVLIVELAHKTIDMLQGVMLIMLPTLLAFMAASG........YIATSAAMSPIIIGALNMMVFIVQN........ILLPNVIIVV...ILQILNSLS.D..EFEINKLIALYYRINKWILGTIFATSLAILGIYRMSLPFTDLTMKRVGLSLSTKLIPILGNAVSGAVDMIIQISGMIKNAFGVGVIIFIVIVIATPLIKI.FAYIFLYQVAAAVIEP..L.G.DKKMA...KIATDIAKGCEFVMSC..VGT..VS..I..LSILALVVCMSV-g...........
A0A1Y4HNF1_9FIRM/60-371              ...................................................esls----------------SLSPEK.VFSFAADAAAQASRDPIRAGASVMAVILICTLISGMKLTLA.E.NGL.G...QAAGLAGTLCAAAVVVKPITECVQYAGRIVQAAADFQLACVPVLAGILLAGG........EPAKALSYETLTALAGNAVSLIAAH........FLAPLISCYL...ALSIVSAVC.P..AIHMNGLCELFSRVVKWVLGLCMTIFSGILTIHSLVAASTDSAASRAVKFAVSSFVPVVGGALGDALRTVSGCVGVLKSGVTAFLLLAEAVLFLPALLQC.VCWQLVLTACGAAGEA..L.G.QKELA...SMLSAAGKAVGLLLAI..LLC..CM.lV..MTVSSVAIVL---lgg.........
A0A2C6MBT8_9FIRM/1-120               ......................................................m----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..---------------------------------------TDGVAIRTAKFATDAFIPVVGGMFSDALDAVIGSSLLIKNAVGIAGVIIIFVLTILPMIKI.FAVAFVYKLAGALIQP..V.G.DKQMA...DCLTGLGKSLISIFAA..VAT..VG..L..LFFFAITIVVGMG............
A0A074LRR6_9BACL/112-433             .....................................................dv---KGHVTELVLHGKLGTLFQG.LLTGLLKYLFHELFLNSRLLGTIIVLTVFAAILENMQSAFE.G.KNV.S...KIAHTICFLVLMILAVQSFAAATSYAKDAIAVMVDFMTATIPMYLALLASTG........GVASAAMIHPLIVFLINVIGDLIEF........VIFPLIFFSA...ILSLVSKIS.S..RYQVTQLAGLLKSTAVWVMGVFFTIFLGVVSVQGAAGAVADGVSIKTAKYVSSNFIPVVGKLFSDAADTVVGASLIVKNALGITGAGILLLLAAFPALKI.LSLAIVYNVSSAVMQP..L.G.DSPII...GCLSTIGKSLILVFAA..LAT..VG..F..MFFLAVTVIIAAG............
A0A226C0W8_9FIRM/67-388              ......................................................l-TFRDLFYL-IRGDDGDISLAQ.LFSGLLRFFLHEVVVNFQLLGKVILLTVVAVLLTTLQNAFA.N.ENV.A...KLAHTVIYMSIVVIALQSFYLAIQIGRETVDNMVDIILALIPLLLTLMASMG........AVTSVAIFHPITIFLINTFSTLISN........VILPLLLFSA...VLNVISHIN.P..KFKVSSLADLFQNVSITAIGFFLTIFIGIMGLQGVGGAVADGISIRAAKFLTGSFIPVIGKALSDAVETVMGASLVLTNSVTMAGAVILFFITIFPALKI.LALVFIYKLAASLMEP..L.G.ETTIP...DSLNTMSKSLTLVFAG..VAT..VS..V..MFFIAMATIIGAT............
A0A1C0BP41_9CLOT/73-383              ...................................................ntit----------------SISPQN.YFQKILSVFTGQAKNPLKILCGVLAVILLCALLNGMKLSFG.E.KPM.G...GVIGMVGALCICTIVVTPIVSCIHDAADVLNAASGFLLACIPVLTGIMIAAG........QPVSAGSYHILMLAAGNAISILSTT........FFIPMLNIFL...ALSIVSAVS.P..GINLSGLCAALNKMVKWIMGLCMTLFTSLITMHSIVASSLDNTGSKAAKFVVSSFVPVVGNALGEALQTVTGCVKLLKSGVSAFGLLAGIFIFLPIIAEC.MIWILTLNLCAGIGQI..F.D.LNEIS...SLLKASSDVVSTMLAV..LLC..SM..M..ILIISTVIMLVV-g...........
Q97HC3_CLOAB/57-379                  ......................................................l-NIKDYVEYYMKNGKGNTSVSK.FSRAVFSYFMQDITSCLKLVSTLVFICIVCALLTNLQKAFS.S.EKL.T...QIAYFSCYAIIIIIIAKNFKICVSTAQGAMKDISNMMGAVVPILLTLLISSG........SLVESTVFDPVILFSINFTEKVFTD........ILIPLILLSF...VLEFVNNLS.E..DYKISNLSKLLKRSVIWIQGIIMTVFIGIITIRGINAKAIDNVTAKTAKFAVDNFVPIVGKCLSDAISTVAGYSILLKNAIGTVGLIVLIVMIIFPVIKI.FLLAFVHKIVAAFVEP..I.S.DKRIV...NCLNSVGDCLILIGSC..LIG..VA..V..MFFIMIAIIIAAG............
W7YRU2_9BACI/68-388                  ..................................................sqkgs------LTDFLT-GDKQFSIKE.WSLGLVKYLLHEFIVNGKLLGMLLLLTIFSYILQSFQNAFE.H.QTV.S...KTAYAITLLVLCMIAMNGFHTAITYATDAINAMVHFSIALLPMLLAMMASLG........GISSSALFHPVIIFLVHTSGLLVNT........FVLPMLLISA...VLGIVSTLS.E..NYKVTRLANLFRTGAIGLLGVFMTIFLGVVSVQGTTAAAADGLTLRAAKFIAGNFVPVVGRMFTDATDTVMSASLLLKNTIGMSGLVILLAICAFPAMKV.LSIALIFQLSAAALQP..L.G.NGAII...DCLGIIGKSILYVFAA..MAL..IG..F..MFFLAITLMVAAS............
R6SME4_9CLOT/1-90                    .......................................................----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..--------------------------------------------------------------------MVMGSGILIKNTAGAAAVLVLLFMAAVPVIKL.LVLMFLYYMAAAVMQP..V.C.DKRLV...ACMTGAAAGHGILLKI..VGC..SL..A..LFSVTIAVLCAST............
A0A0B0D3L9_9BACI/67-386              ...................................................tmdn------FKEYIQ-SEGSVKSSD.WYTGLLKFFFHELMVNGKLLASLLFLTLFSTLLHSVQSSFE.N.SVV.S...RIAYLVVYLVLLTLALESFRQVIDYTLDAIDRMSSFMIGLLPLLLGIMASFS........HLMSISFFHPIIVALVQSSGLLVKY........LLIPLFASSA...LLLIIGGLN.E..TYKVDQLAELLRKTGLAVMGIFLTIFLGVISVQGTVTAVQDGVTMKTARFVTGNFVPVVGRLFTDATDTILGASLVLKNTLGIAGVVILLGIAIFPAIKV.FAIAIIYKLAAALLQP..L.G.DGPII...EAMSVVSRHIMYVFAA..LLM..VS..M..MFFLVIVIMVAAS............
A0A1V2SFW5_9BACI/68-388              ..................................................sqrgt-----LI-EFLQ-GDKSFSIKG.WFTGIVAFAFQELTMNGKLLGTLLLLTIFSAFLQSLHHAFE.K.SAV.S...KVAYSVIFMVLIILALNSFRVAVDYAIGAIDSMTQFIFALIPLVLGLIASSG........GVTSSALFHPLLVFLINTSGLLVKN........IVLPLLLLAL...ILQIASSLN.E..QYKVTQLAGLLKKISIGLLGIFMTVLLGVISLQGTASAVADGVAIRTAKFVTGNFIPVVGRMFTDAADTVLTASLLLKNAVGLAGVAIVLIIAAFPAVKI.LMIVFIYKLAAALLQP..I.S.NGPVI...SCLDAISKSMLYVFAS..LAI..IS..F..MFFLGITIVITSG............
A0A1G8BPL1_9BACI/73-393              ...................................................sqkg-----SIKDFLT-GDKSFHPKE.WGIAFIRFSLHEVTANGQLMGTLLLLAVFSAILKALQNAFE.E.ESV.S...KAAYGVIFIVLIIIALNSFYIAMNYVQETVADMVHFMIALLPLMLALLASSG........SFATAGLFHPLVIMLVQSSGILIQY........VILPFLFFSA...VLSIVSSLN.E..HIKVTKLAELLRNAAMGVLAVFFTVFLGVISVQGATAAVTDGIAIRTTKFLAGNFVPVIGRMFTDAADTALGASVLLKNTIGLAGVGILFIICAFPAIKI.LVIGFIFHLTAALIQP..L.G.EGALL...DALSTLGKTVLSMFAA..LAA..VS..F..MFFLALTLIIASG............
A0A1E5L6P2_9BACL/64-384              ....................................................qsp----SIFQALLP-GEEQFKIRD.VLKGLLHYLFHEIVYNTKLLSSIILLTVFSIVLENVQNAFE.R.NAV.S...KVAYAIAYMVLIVLAINSFHVAVFYAREAIDSMVNFMFALIPLVLGIMAAIG........NVTSVAMFHPVIVFVVNIIGTFIST........IIFPLFFFSA...VLNIVSALT.D..KYKVTHLANFLRTISLGLMGVFVTIFLGVLSIQGAAGAVADGITIRTAKFITGNFVPIVGKMFSDAADTVIGASLLLKNTVGIIGMIILLLICAFPAIKI.LTLAVIFNFSAAVMQP..L.G.DSPII...QCLSIIGKSLIYIFAA..VAV..VG..L..MFFLAITIIIATG............
A0A1Q9J722_9FIRM/68-389              ......................................................t-SFSDLFEALWKGETKNLDITQ.VMDSVKDAICAQVRENRKILAEILLLLAAFSTLSNFTGMLE.K.TYV.S...DICFMLLYCLLSVLLLQSVMNVSELVSQSLQNCISFMKALVPTFCFTMMFSS........NVNSSLGFYQLSFLVIYLVEWIFER........FLLPGVHFYI...LLELFGNFF.E..EDKFKGFTELMKSLIQWTFKACWGIILGLNVIQNLIAPAKDRLTGGAFGKVASF-LPGIGNSFSSVSELLVGSGMVIKNCVGVAALLLLGIVCLVPFLKI.MCMVVLYKVTGAIAGP..I.S.DKRIY...GCMEGVTNGCILYAKT..LGT..CL..L..LFVVTIALTTAAT............
A0A1M6HNW1_9FIRM/121-441             ......................................................l-TFGALVEQLVS-QETDGLGEK.LLQWIEDKLSYEFRYNKSNFIRILLIAVLAALFTNFSDAFQ.N.RQI.S...ETAFFVLYLLLLTLCLNSFRVSIDGVEESVKEVLGLMQVLCPAYFLAVTVSV........GSSTSIAFYNMVLFVIYLVNLVILN........FLLPAVQMYM...MIQILNHLS.A..EEYLTQLGELVEKGIIWMHRILLGLVLGLNVVQGLIGPAIDRVKRSTLSGGAGA-IPVVGDALGSVADVFFGTAVLIKNGIGLGAAILVCLACVYPLLQM.GVLVLMYKLAAALVEP..V.S.DKRIV...GCIDSVSRGHELLLRT..IYT..TG..V..LFLVTLAVVAATT............
A0A0L6ZD99_9CLOT/55-377              ......................................................v-DIKTYVKEYVKNGTGGFSAEN.IAKAVISFAFKEVVASGKIMSMIIIICIICAFLSNLESAFS.N.GNL.S...NIAYYACYALLIVLIAKTFYIGVSTAKVAIKDMTDFMAALMPVLLMLLATVG........GFTQAAIMDPIIIGVTNISARVFMD........LIIPLVSISF...VIQFVNNIS.Q..EYKVDKLAKLLNKSILWIQGTIMIIFIGITTIRSMTSATIDAVAEKTMKFAIDSFVPFIGKSLSDAISTVAGYSLLLKGAISSIGLIILIIIIVSPLIKL.LIMSFIYKLTSALIEP..I.S.DARLV...KCIAAAGDSLVLIMTS..LIS..VS..V..MFFIMISIMASAG............
A0A015L665_9BACL/106-426             ....................................................rvp----SFMEMILP-GGEGLDYRN.VLGGLLRYGLYEVLYSGKLIVTIVMLTVFCMILETLQTAFE.R.NAV.S...KVAYAVAYMVLLVLAVNSFNTAIGYAKDAIGGMIQFMMAMIPLLLTLLASMG........SVVTVTVMHPLIVFMIHTVGTLIYT........LVFPLLFFSA...VLHIASALS.D..KFKVTQLANLLRTIAVGSLGLLLTVFLGVISVQGATGSVTDGVAIRTAKFVTGNFVPVVGRLFADAADTVMSASLLVKNAVGIAGVVILLFLCVFPAVKI.LVLAFIYKVSAAVMQP..L.G.NSPIV...GTLDTIGKTMIYVFAA..LAA..VG..M..MFFLAVTIILTAG............
A0A023DDW6_9BACI/61-381              ..................................................sqkgs-----LM-DFLR-GEKELSLKE.WLVALMKFLFYELQVNGKLLGTLIVLTVFSMVLQSLQNAFA.Q.QTV.S...KVAYAVVYMVLLIIALNSFRLAMDYALDAVRTMSHFMIAMIPLLLALLASSG........GVISAAFFHPIILFLMNMTGTIVEY........VTLPLLFLAA...LLSIVSTLT.D..HYKVTQLAGLLTKIGVGILGVILTVFLGVMSVKGTTSAIADGIALRTAKFVTGNFIPVVGKMFTDAADTVVAASMLLKNTVGIVGVAILLMIAVFPALKI.FAIALVYKISAAIMQP..L.G.GGPVI...SCLSIMSKSIAYVFAA..LAI..VS..L..MFFLSLTIIITAG............
A0A0J5GL29_9BACI/1-229               .......................................................----------------------.-----------------------------------------.-.---.-...--------------------------QDAINNMIHFMIALLPLLLAIMAAVG........SITSAALFHPLIIFLVHTSGLLIQF........IVLPLLFLSA...VLGIVSTLX.D..HYKVTKLANFLRAIAVGALGVFLTVFLGVISVQGASTAVADGITVRTAKFIAGNFVPVIGRMFTDAADTVMSASLLLKNTVGIAGLAILLMLCAXPAIKI.LSLALIFNLSAAILQP..L.G.GGPII...ECLSIIGKAVIYVFAA..LAI..VC..L..MFFLAITIMVAAG............
R9LXA0_9FIRM/37-357                  ......................................dlleqvdasgpkglssg-------------------ISA.ILEWMGREAGGIIRQRIRGAALVLLAVVLCGAVDGFYQGVD.G.GKV.T...VFLPMAGALSVTLLTAGSLDSLMGLGAKTIEELSTFSKVLLPTLAAATAASG........AVTSATVQQVSTVFLADVLISLIDR........LLMPLVYLYA...GALAASAML.P..ENRLGALAEALKKVITWLLTTVLLAFTVYLSVVRVVSGSADAAALKVAKAAISGVIPVVGSILSEASETVLAGAGMLKNTIGVFGMLGILAACAHPFLQL.GVQYLLYKLTAFLAAT..V.G.APSLC...KLIDGLGGAFGLVLGM..TGS..CA..F..LLLISVL------ssvaav......
R6ZRU2_9CLOT/22-342                  .......................................................FSFEELLKAVFR-GDMKEACSM.AFHGISDSLFSELSAGAGQMAKILLIALTGAVFTCFSDIFS.G.GQI.S...ETAFYVTFLLLFSLLASSFYESIAVADQAVSQAFELMKALTPGYFMTVAFTG........GSLSAGASCGWMLFSITAAQWLLSH........LIFPVFRVYI...LLVLAGHLT.K..EGVFSRMTEGIRTAVEWSMKTLTGAVLGFHLLQGMVLPYADAVKNASLKRMVSM-IPGLGQGAFTVSQMVLGSGILIKNTVGAGAALALLAVTAVPMIKL.FVLMLMYHLMAAAAEP..I.C.DKQLT...ACMADVGKGHQILLKL..VFT..SL..L..LLVVSIGVICMA-s...........
A0A1H4GU24_9BACI/62-383              .................................................elkqmn------IKE-MAEQTSEVTITD.WLTGFLKYFFHELIANGKLLGSLIFLTLFITVLQTLQSAFE.Q.TAV.S...KVAYMIVYLVLIMLALNSFHLAVSYTSDAIDAMSAFIIGLLPLLLGIMATFG........HMVSLSFFHPIIIFLIQVSGVLISK........VILPLFYLSA...LLLMTSSLT.D..KYKVDQLAQLLRNVGLGLLGTFLTIFLGVISVQGAATAIQDGVAMKTARFVTGNFVPVIGRLFTDATDTVLGASLLLKNTIGLAGVIIVIGLALFPALKV.LAIALTFKVAAAVLQP..I.G.NGPVV...TSISIISKHILYIFAC..LLT..VT..F..MFFLLIAILVAA-s...........
A0A1M5LRW8_9BACI/68-387              ...................................................ekts------VYEFIK-NQDSLSPQS.IIIGILEFLFHELILNGKLLGSLLMLTLFSAMLQTMHNAFE.T.STV.S...KVAYFVVYIVLIFLALNSFYSAVTYTKDAIDTMSSFMIALLPLVLGLMASFG........NIVAVSFFHPIIIFLIHAGGLIVAN........FVLPLLFLSA...LLVIVSSLT.E..HYKVTHLANLFKSIAVGTLGVFFTIFLSIMSVQGTASAIQDGVVMKTTKFITGNFIPVVGRTMTDAADTILSASLLLKNAIGIVGLIIILFIALFPALKI.FAIAVIYKVAAAILQP..I.A.DGPVI...TTLNTISKYIVFILAC..LLA..VS..F..MFFLAIVIIIAAS............
R7K8D5_9FIRM/78-399                  ......................................................t-SVKELVEKLLS-GESDDFFSG.FYSAFSSAALNYFFSFLPSFLAIVTISVFTAILTQAVSGFK.K.KET.E...EVVRFVTFAAISTILLVIIGNIATMCVTLLGNLGKISAFLFPPLLTIVSGLG........GHATVATLQPMMAIMSSGIIALINS........LILPVFLSTT...VLSIVGNLS.S..QVSLDKLSGGFKTFGTFVLGGVFSLFVTFITFQGITTSAFDSISFNASKYMVSSYVPILGGYVSEGFDLAVAGVVLLKNSIGYVGMLLLLATILFPLVKV.LIFVLCLKFCSAVIEP..I.G.EKRIA...NMLSQLSKNSMLLVTA..IIG..VT..F..MFLVLIMLVITS-c...........
A0A1E5G6I1_9BACL/64-383              ..................................................spsif-------DI-ILPGEEGLSVNA.IFQGLLTYLFHEVVYNTRLLASIILLTVFSAILENVQSAFE.R.NSV.S...KVAYSITYLVLIVLAINSFSIAVTYARDAIENMVQFMIALMPLVLGIMAAIG........NVTSVAMFHPVIVFVVNIIGTFVSI........IIFPLIFFSA...VLHIVSAFT.D..KYKVTHLANFLRTVSLGLMGVFVSIFLGVISIQGAAGAVADGITIRTAKYITGNFVPVVGKMFSDAADTVIGASLLVKNSVGLVGMVILLLMCAFPAIKI.LTLAIIFNFSAAVMQP..L.G.NTPII...QCLNTIGKSFIYIFAA..VAV..VG..L..MFFLALTIIIAT-a...........
A0A0J5TV57_9BACI/56-376              .................................................sqkgsl------FD-FLT-GDKTFSFKE.WAIGLLKFLFHEIIAGGRLLGSLILLTVFCLILQSIQNAFE.H.QTV.S...KVAYAITYLVLMILALNSFRLAIDYAEYAVSNMTNFMVAMLPLLLALMATIG........NITSAALFHPLIVFLVHTSGLLIQY........LVFPLLFLST...VLHIVSTLT.D..HYKVTKLAGLLRTIAVGALGVFLTVFLGVISVQGASTAVADGLTVRTAKFIAGNFVPVVGRMFTDAADTVLSASLLLKNTIGIAGLVIMLILCAFPAIKI.LGLAFIFNFTAAVLQP..L.G.GGPII...DCLSIIGRAIIYVFAA..LAI..VC..L..MFFLAITIMISA-s...........
A0A285U405_9BACI/1-295               ......................................................m----------------------.--NEILNIFLDPLKIAGQSILLIITYTVLFLAIEAYVPKFK.-.---.-...KWSDTLFIVVLVLALGQTVMDAFSLMAQLAGIFSNFFLALYPIIMSLLVILN........SVFSFIAWSPIIFFIFELLILLCER........ILIPAVTIAL...IFDFCTRFI.G..EMSFGKASDLIRGSVMTIITATVIAIMTILSFTGVAFFTIDKAIADPVKKVIEQTIPIVGSLIVQGFSIFNKYQSTATTVAGLGAMSAFWVAAFYPAGKL.LIHAMTFKLLAAIIEP..F.S.SSTVS...GLVDDVGKSLLVLCAV..AFL..LG..I..AFVFIWLILMVM-t...........
Q8RAD6_CALS4/56-377                  .......................................................IDVKTYLLEVLE-GKQPFEVKK.IFEGILRVFFKELYSSFNLLIQLLVLGVIGSILMNLHSSFE.S.ESV.S...EIAFLAIYIVFIIIAVKSFSEAMSIGKQAIDSMVDFMQSILPLLITLLVSVG........SFTSAAFLEPLVIVTVQFTAHVMRD........FVIPIILFMT...AVKIVGNIS.D..KFSLNKMGDFLKTLSTASISVLLSIFLGVITIQGLSSSIADGVISRTAKYTVGAFLPVVGGLLADSVDAVIGASLLIKGAIGTYGLMIIIAIAAFPLIKI.FSLALIYRFVAALIEP..I.S.DKRIV...SSLSEVANSLTYILAA..LAS..VT..V..MMFFTITAIIGT-a...........
R5T0F4_9CLOT/61-379                  .......................................................FNISDFSNDLIS-GR-GIGYNK.IFQNIISLLGKEIFISLKSAILILIIILLMAILNGIN---E.N.SQI.L...NIVYLVCFIAIASITIGNFTQIISMFKNTSDILSKIVQIVSPFLIAILIGTG........AITSTGLIQPLILFMASLIGFIITY........IIIPCISVSV...ALNVISSMS.D..NFKFNELSKMFSKCAIWIIGIVLTLFLGILSLETTLSASVDSLTVNVTQAAFSNFIPVVGKFFSDSLETVIGTSKIIGKAGGVVGIVSMVVISSVPIIKI.ASVCIVYYLLAAISEI..V.CkEEKIK...KYIKGFGDVYKTLLGI..LIG..IN..I..LFIISIGIIIN--lc..........
M9LB66_PAEPP/74-394                  .................................................slpefa-------DL-LLPGGEKLTAGA.VLQAFGKFLMQEVIQNGKLILTIVILAVFSMVLETLQSAFE.R.NAV.S...KIAYAVSYMVIIILAINSFHVAIGYAKEAISGMIHFMMAMVPLLFTLLASMG........NLVTVSVMHPLIVFMVHFIGTLIYT........VVFPLLFFST...LLHIISALS.D..KYKVTQLANLLRNISIGMLGVLLTVFLGVISVQGATSSVTDGVTVRTAKYITGNFVPVVGRVFSDAADTVISASLLVKNAVGLTGVVILLLICAFPALKI.VTLALIYNVSSAIMQP..L.G.DTPAA...ECLKTVGKSMIYVFAA..LAA..VG..L..MFFLAITILLTAG............
A0A0J1GC23_9FIRM/60-379              .......................................................FDFKDALGKLIK-GEMPMTPSS.ILQIVKEAFFAELNQYKSTMMHIIMIVIAAAIFTNFTGVFE.K.SQI.A...DISFYMMYLLLFTVLIKAFWDMSQLTMDTLGQVLNFMKVLLPAYFVAATFAA........GSITAAGFYELTLILITVIQWVLKY........LLLPGVNLYV...LFLLLNHLA.K..EEYLSKMAELLNLMISWVLKTLLGAVIGIQTVQCLIMPAVDSLKNTLLHKTSGA-IPVIGNVFNAVSEVVVGSAVLVKNAVGVAGLIAVLIICLMPLVKL.VIGTFMYKLLSAVIQP..I.S.DKRMI...DCIASIGDGAALLVRI..LFT..AG..A..LFLITLAMVTA--s...........
R5QIH8_9FIRM/53-371                  ...........................................dfftggvsglse----------------KMSIGF.FLRAAGKMLSSAFPRAVKSFSFLLGILVISSVLGALGDSIA.S.PSV.K...SVFSYISSVCICAAVYEATGSLFSLTKDFILGLSGFVTKLMPVMTALLYASG........KVSTAAVSGGIITAALAILENICAG........VLFPLIQMCF...AISAGGAMC.G..NAGLSGITATVKKTVTYLLSFIMLLLSLTLAFQSVITKSADSLALKGVKFAVGSFIPIVGGAINEALTAITGSIGTIRSAVGIACAAAVLFMTVSPIIYI.LLNKALLELSASFAVM..L.G.LERES...RFLSDTAGIAGFFVSL..SAV..TG..V..FFIFSLSVLAGI-s...........
A0A235BC19_9BACL/69-390              ....................................................qpa----DLFDLVLSKGSEGFEWGN.LVQGFLKYLFHEILYNGKLLGTIIVLTVFSMILSTLQTAFE.R.NQV.S...KIAYAIAFMVIIILAMDSFSVAVESAKTAIERMIHFMMALVPLVLTLLASMG........NFGSVGMFHPLIVLMIHTIGTLIHL........VVFPLLFFSA...VLSIVSCLS.D..KYKVNQLAGLLRRVSVGLLGSLLTIFLGIISVQGATAAVTDGVTIRTAKYVTGNFVPVVGRMFSDAADTVVGASLLVKNAVGMAGVLILLFISAFPALKI.LSLALIYSFSAAVMQP..L.G.NSPIV...ECLSIISKTLIYVFAA..MAT..VG..L..MFFLAITIIVASG............
A0A0C2UQN8_9BACL/89-407              .............................................pelrrlmfpd--------------GESWSLGQ.ALFGVVRFFLHEVLYSSKLLVTIVLLTVFTLLLETMQNAFE.R.NTV.S...KVAYAIAYMVLIILAVNSFRTATSYAGDAIGNMVQFMLAMVPLLLTLLAGTG........GVTSVAIMHPLIVFMVNAIGTFIHL........VVFPLLFFSA...VLHLVSSIT.D..RYKVTQLANLLRNAGTWIMGGMLTAFLGVLSIQGAAGAVTDGVALRTAKFVTGNFVPVVGRMFSDAADTVMSASLLVKNAVGLAGVIILLFLCAFPALKI.LTLALIFNVAGAVMQP..M.G.DSPIV...QCLQTIGKTLLYVFAA..LAA..VG..L..MFFLAVTIILTAG............
A0A1G8CZN6_9BACI/71-391              ...................................................sqkg-----SLKEFIT-GDKSFQVTE.WMSAFLQYVFHEIIANGQLMGTLLLLAVFSAILKALQNAFE.E.ESV.S...KVAYAVIFIVLLIIALNSFYIAMDYVKDTVADMVHFMIALLPLMLALLASSG........SIAAAGLFHPLVILLVQSSGVLIQY........IILPFLFFSA...VLSIVSSLN.E..HVKVTKLAELLRNAAMGILAVFFTVFLGVISVQGATAAVTDGVAIRTTKFLAGNFVPVIGRMFTDAADTALGASVLLKNTIGLAGVGILFIICAFPAIKI.LVIGFIFHLTAALIQP..L.G.EGALL...DALSTLGKTVFSMFAA..LAA..VS..F..MFFLALTLIIASG............
A0A084GWE0_BACID/62-382              .................................................sqkgsl------LQF-LN-GEKELSFKE.WSKAFLSYIFHEIIANGKLLGTLIMLTIFSMLLQLLQDAFS.Q.STV.S...KVAYALVYMVLMIIALNSFHIAIEYTVEAIRTMSSFILALIPLLLALMAASG........GLISAAFFHPVILFLMNTSGVLIEK........IVLPLLFLSA...LLSIVSTLT.D..QYKVTQLAQLLRNIGIGLLGTFLTVFLGVISVQGASAAVSDGMAIRTAKFVTGNFIPVLGRMFTDATDTVISASVLLKNTVGILGVAILLFIAAFPAIKV.LTLAFIYKFTAALLQP..L.G.GGPII...KCLDIISKSVIYIFAA..LAI..VS..L..MFFLSLTVIIAAG............
A0A1R0IHX6_SULTH/50-371              ......................................................t--VSKMASDLLH-HKNPFPLKT.LLSAMGQAIAGDLAQEGRVLGVIFLLSVLAAILARLTQSIDgA.GRI.A...ELSEMVVVSALILIALHAFGVALSMVHHLLTDVVHLMEALIPLLVVLMAGSG........AVASAGIFHPVMMLTVNLVAVLTRS........WVLPLVLLAT...IVDLVGHWL.P..NFSLKNLALLLRQTGLTLLGGLMTLFLGVMAVEGSAGSVADGVTLRTGKFLANTFVPVVGKAFSDAMEAVLGSSMLLKNAVSVVGALTIIVLVAFPLIKL.FIMMVLYRLGAAATEP..L.G.VSGVN...KTLETMATAAGWLLAI..TGS..VA..L..MFFLMITVVVTA-s...........
A0A1M5TUA5_9FIRM/66-386              .......................................................INLKEFISSTIK-GERTINSTD.ILKGIGKLFFNEVIDNLSLLIQILAITIMCAVLTNLQTSFE.K.DTV.G...ELAYYICYILITTIVIKSFATIMVLGQSTVDKMVNFMEIILPILLTMLVAVG........GTTTNALFHPMVLGTVNIIGILIKD........VIFPLIFFSF...IVGIISRIS.E..KVQFTKLSELMRQIVVTILGVALTIFIGIMSVYGVASK-VDGVTARTAKFAVDKFIPVVGKFLSDAMDTVVGCSLILKNAVGGIGLFTLFLICIIPTIQI.VALIFIYKVLIVLIEP..I.S.TMRIG...DSLNEVSKSLVLILVS..IIS..VS..M..MFFITITIIVEA-g...........
C6PQS2_9CLOT/11-333                  ......................................................v-DVKEYVKDFIKTGDGKISTKK.ILNAVGSYLFREVIASLKLLAVLVAIALICALLTNLQKAFS.S.EDL.S...NIAYFACYSLLIIIMAKSFYMGVDIARTTIKEMTDFMTALIPVLIMLIASVG........GFVEAAVMDPVIIGTITISANLFMN........VIIPVICMAF...VLQFVNNMS.N..EYKIDKLTKLLNQVTLWSQGIIMTIFIGIITIRGITSKTIDEVTARTAKFAVDNFVPIVGKSLSDAISTVAGYSILLKNALSSLGLIIIIIIMLFPVLKI.LIMAFMYKLTGALIEP..I.S.DSRLV...NCITSAGDSLILIASC..LIS..VS..V..MFFIMVAIIASAG............
A0A1R1QAS9_9BACI/76-396              .................................................sqkgsl------LEF-VK-GEKHFSPEE.WVKALFSYMFHEVLAGGKLLGTLILLTIFCVLLQLLQNAFQ.Q.STV.S...KVAYAIVYMVLIILALNSFRIAVTYANEAIQSMTSFILSLIPLLLALMASSG........GAASAAFFHPVILFLMNSSGLFIQF........VVLPLLFLSA...ILSIVSTMT.E..QYKVTQLAQLLRNVAIGTLAAFLTVFLGVISVQGASAAVTDGITLRTAKFITGNFIPVLGRMFTEATDTVISASLLLKNTVGILGVAILICIAAFPAIKI.LSLALIYKIAAAVLQP..L.G.GGPVI...SCLDVISKSVIYIFAA..MAI..VS..L..MFFLSLTVIITAG............
R6YAL8_9CLOT/1-78                    .......................................................----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..--------------------------------------------------------------------------------MGVVGVIVIIGICIIPIIKL.TILMAMYYLGAALCQP..I.A.DEKII...KLLEQMGDTFKIFLAI..MCS..VS..V..MLVVGVTLIINI-s...........
R6G9M5_9FIRM/66-385                  ......................................................q-SMRGMIRDILKSGQ-AFSSEQ.WKAVIQQGVWDAMGIQKETCVHILVLVLLSAVFCHLSGVFQ.N.NQI.G...DISFYMIYLLLFLLLLQAFDEMTGQMERLLEGVAVFMKALLPAYYIALTGAC........GVATATAFYQMILILIFLTEKILLL........FLLPAIRMYL...VLELINFLT.K..EEFLSKMTELLKNGILWALKSMIGVIVGIQLIQRMISPAVDTLKQSVIGRTAGA-IPGVGNLFSGVTEVVLGSAVLIKNCLGAAAIVILLLAGAAPLCRM.GISALAYQFLAAVVQP..V.T.DKRMV...GCIHTMGESLGLLVRL..LLT..ME..I..LFLLTIAILAG--s...........
A0A1C7GMC6_9FIRM/62-367              ................................................ggqvtgg-----------------LSGER.IFGMVSTLLRDKLSAPLKALAAILGVAALCRLADGISE---.G.E--.-...GIAPLVGAAACGLILSAPVLGLLTGCQRVAGAASAFLTAAVPVYAGLLVAGG........NLATGGGYSFLTMLAGAAVPVLAGG........VFLPLLQIYL...GLSVAGAVS.G..-TELGGLAEALYRLGKWALTVLVTLFAAILSVQTAVNAQVDAAAGKAAKLALSAGVPIVGGALGDAVAAIQNSVHIVKSGTGAFGILAAMCIFAPAMAEC.ALWAGVCMIGKGFGEL..F.R.VKAIS...ALMEAAVSTVKMVLAL..LGS..IC..A..ACVASAAAVLLA-g...........
A0A0E4CY40_9BACL/91-411              ....................................................ktp----SLMDMLLP-GEDGLSFKS.VLKGLTSFMWHEVMFNGKLLVTIVMISVLSMILETLQTAFE.R.KSV.S...KIAYMLCYMVVLVIAVNSFNVAIGYAKDAIDRMTDFMMAMIPLLFALLASMG........NIVTVSVTHPLIVFMIHTVSTLIHT........VVFPLFFFSA...VLHLVSAMS.D..KYKLTQLANLLRNVGAGLLGVLLTVFLGVISVRGITSSVTDGVTLRAAKYITGNFVPVIGKMFADATDTVISASLLVKNAIGLSGVIIILFLCAFPAIKI.LVLALIYNVAAAVMQP..L.G.ETPIV...VCLQTIGKSMIYVFAA..LAA..VS..L..MFFLAVTIMLTAG............
A0A1G5FHW8_9FIRM/55-369              ...............................................esvdvqkl---------------SQISFDS.VVGEISNIAAQNAEMPLKGLITIIALLLLCSILSAYRNTLS.-.SDV.S...TAINIVSALCITCAVAMPAISVIDSAASVIEISSNLMLSYIPIITVIMASSG........QAASSGAYYASMIAAGEGVGQISSK........IVVPFLNMFL...GLSITSNIS.P..DINLGGFTNIIAKIIKWLLGFAMTIFTSILAVKQLITGSLDNVSGRAVRFALTSFVPIVGPALSDAYRTVQGSVSMLKSGMGVFVIIAIAVVFMPVIIQS.FMWVITLWVGKSTAEV..L.N.LSQTA...KLLQSVSTVFTTLIAI..LLC..IM..S..IYIISSAVVLLV-g...........
A0A0E3W347_9FIRM/66-385              ......................................................k-SVKEWLLD-FSKGDWQLNPQE.ILSNIVKFFGKEFLANSGLLSKLIILSVLAALLINLQQSFT.S.-EV.G...KIAYMACFLALCAIAIGSFKVVLGIGQHTIDNMVTFMLSMLPQMMVLVTGLG........NVNASVMLFPLLMTTATAFASAIKT........IVFPLIIISA...TLHLVNGMS.D..TIKVERLAKFFGQVSQLVLGFLLTFFVGIITLRALYASVLDKVTLRTTRFVTDNAVPVIGKMLGDTVEVAAGYVVMLKQALGIFGVLIVFGIIIFPLVEI.AVLALIYKLVGAVVEP..I.G.DPRTA...AVLEIMSTHLFLMLAA..TAA..VG..L..MFFIMIAIVAG--l...........
A0A0L0QQW9_VIRPA/53-371              ....................................................kas------VYELIK-NQNSLSPKA.IIIGFMEFLFHELILNGKLLGLLLMLTLFSAMLQTMHNAFE.A.STV.S...KIAYFVVYIVLIFLALNSFYSAVTYTKEAIDGMSSFMIALLPLVLGLMASFG........NLVAVSFFHPIIIFLIHAGGLIVAN........FVLPLLFLSA...LLVIVSSLT.E..HYKVTHLANLFKSIAIGTLGVFFTIFLSIMSVQGVASAIQDGVAMKTAKFITGNFIPVVGRTMTDAADTILSASLLLKNAVGIVGLIVILFIALFPALKI.FAIALIYKLAAAILQP..I.G.DGPVI...TTLNTISKYIVFILAC..LLA..VS..F..MFFLAIVIIVVA-s...........
U2EA73_9FIRM/54-376                  ......................................................l-DAKDYVKQFIKTGDGKVSTNK.LIKAVTAYSFKEVIAVIKSMSILVIIAIICALLNNLQKAFS.R.DDI.S...NIAYFACYALIIIILSKSFYDAVDVAKNTISKTGDFMAALVPVLLMLLASVG........GFVEATVMDPIIIAAININVKIYVN........LIIPIIFMSF...VLQFVNNIS.T..EFKIDKLTKLLNQFAIWTQGIIMTIFIGIITIRGITSKTIDQVTVKTAKYAVDNFIPIVGKALSDAISTVAGYSLLLKNALSGLGLLIILLIVLFPIIKI.LIMSFVFKLTAALIEP..I.S.DSKIV...NCITAVGNSLTLVMSC..VIS..VS..I..MYFIMISIIASAG............
A0A1A5YC31_9BACL/85-401              ...........................................alsdmllpgggi------------------GLGD.SLTALLRFMWHEVLYNGELLVTIVMLAVFSMVLENLQSAFE.R.NTT.S...KVAYAITYMVLLIIAVNSFNVAIGYARDAITGMISFMLAMVPLLLTLLASMG........SLVTVSVLHPLIIFMIHAVGTAIYM........FVFPLLFFSA...VLHIASALS.D..KFKVTNLANLLRSVAVGALGVLVTIFLGVISVQGATGAVTDGVTLRTAKFVTGNFVPVVGRMFSDAADTVISASMLAKNAVGLAGVIILLFLSAFPAIKI.LTLALIYHLSAAVMQP..L.G.ESPIA...KCLQTIGKTMIYVFAS..LAA..VS..L..MFFLAVTIILTAG............
A0A1E8F1S0_9CLOT/59-381              .......................................................IDVKDYVKHYMQKGESKLSGKK.LIKHFITYAFREVHASLKLMAILIIIAVICALLTNLQKAFS.N.ESL.S...NIAYFACYSLIIIIMTKSFYIGVKIANESINKMTDFMAALIPVLIMLVASVG........GFVEAAILDPIIIGAINISSQIFVK........IIIPIIIITF...VLQFANNIS.S..DYKVDKLTKLLNQIALWSQGIIMTVFIGIITIRGISSQTIDEVTSRTAKFAVDNFVPIVGKCLSDAIGTVAGYSMLLKNVISSLGLFMLVIMISFPLIKI.LAMVLMYKLTAALIEP..I.S.DGRLV...NCISSAGDSLILIMSC..LIC..VC..V..MFFIMIAIIASAG............
R6PFK9_9FIRM/56-375                  .......................................................FSVKESIKKALS-GEEPFSAEH.FGEIGKAFLYQQLLPDKKILVQVILLVLAASLFSNFTGMFG.K.GET.G...GISFYMVYLFLLTILMKSFGQMSRIISSGLEDFVFFMKALMPSYFLAVTAAG........GVASAMIFYNMVLAVIYVIQVILLK........LVVPGIHLFV...LFQLVNYLH.K..EDILSKMAEFFKTILEWTLHTCVAVLVGMQVIQNMISPAVDSLKRDVIGKTATA-IPAVGNAIDGVTEVALGTAVLIRNCIGVVGILVLLLLGLPPIIRL.GVTTLIYKLLAAVVQP..V.A.DKRMT...GCLSTMGEGCRLLLRV..LLT..VE..L..LLLITIAILSV--s...........
A0A1I1UGM8_9BACI/73-393              ..................................................tqkgs-----LMEF-IK-GEKDFSIKA.WALGILKYLFYEVLIQGKLLGTLILLTVFSMLLQTIQNAFE.H.HTI.S...KVAYSIIYMVLIILALNSFHIAMQYAQESISTMMNFMMALVPLLLALMATVG........SVTSVAFFHPVIVFLVNSSGLLINN........FVLPLLFLSA...LLSIVSTLS.E..HHKVTQLAKLLRSIGMGALAVFFTVFLSVISVQGATTAVADGITVKTAKFITGNFIPVVGRMFTDATDTVMSASVLLKNTVGIAGVAILFLLAVFPAIKV.LALGFIYSFAAAVLQP..L.G.GGPII...ECLGIIGKSVLYIFAA..LAT..VS..I..MFFLAVTVIVAAG............
R6GZL7_9FIRM/35-351                  ..........................................aeditehmddsas---------------FSEGLSL.LWERACGYLTNALRESISGGVLLLAAAVLCALTEECMDAAG.G.K--.V...HFVPMAGALAVTLAAAGSVRTMMGLGQETVEELNTFSKALLPTLSAAVAASG........SILSASVRQVATVFFVDLLLSLIRG........LLLPLVYFYV...AAAAADAML.P..GRHLAGISTAIRKGTVWLLTGALALFTLYLTVSGAAAGSADTVTARLARGAVGV-LPVVGSILADAVDTVLAGAGAVRNTVGVAGLLAVLAVCLLPLVRL.GTQYLVYKAAAFLAGV..L.G.AERLT...GLIDALGGAFGLIFGM..TGA..CG..L..LLLISIS------salgv.......
A0A1W1VNA8_DESTI/64-385              .......................................................FSVHQFIQD-LKEGKVDLSFKD.IINNTFKFLFKEIGVNLALMGKLIVLAVLCSVLSNLHNAFE.K.GTI.A...KLAYAVSFLVLITFMISSFQYTIEIGKDAVQNMVTFMQALMPILLTLLASLG........AFTSTAILHPFIFITIASLSTLYKT........VIFPLILLGA...VLSIINNIS.S..EFKITRLSSLLNQVIVFFLGLTFTLFIGVLSVQGVGGAIADGVSLRTAKYMTGAFIPVVGSMFSDVLEAVIGGSLLLKNAIGIMGLLIIVVISLFPAIKI.FAIIIIYKVSSAIIQP..L.G.NSQIS...DTLDSMAGSLLLVFAS..VAT..VA..L..MFFLTIIIVVTT-a...........
T0E4M2_PAESO/1-124                   .......................................................----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..----------------------------------MYVKSLDGFAIKSTKFAIGNFIPVVGGFVSDSFDIILSSSQLIKNLFGGVGLIILIGICLIPIVKI.ISIILVYKASAMIVEP..V.G.EENIS...NFLNEISNLMAIMLGC..IIA..IT..I..MFFVTIAIVISI-s...........
G4HEY5_9BACL/77-396                  .....................................................tp----SLMEMLLP-GGDGFSFKG.IMSGLGKYLWHEVLYNGKLLVTIIMLSIMSLILENLQTAFE.K.GTV.S...RVAYTICYMVVLVIAVNSFSVAIGYAKDAITGMIDFMMAMLPLLFALMASMG........NVVTVSVAHPLVIFMVHTVGTLIRT........IVFPLLFFSA...LLHLVSSLS.V..KYKLTQLGNLLRGIAMGFLGVMLTVFLGVISVQGITSSVTDGVTIRTAKYVTGNFVPVVGKMFADATDTVISASLLVKNSIGLAGVIIILFLCAFPAIKI.LTLALIYNLAAAVMQP..L.G.DTPIT...TCLQAIGKTLLYVFAA..LAA..VS..M..MFFLAITILLTAG............
F2JME5_CELLD/64-385                  .......................................................FSLKQEVTNLVS-GKADLSINY.ILKQMGNLFLGEIALFLQLGARFILIVLLCNLLQTLSSSFQ.S.KDT.M...KIGFFVCYMAILLSVVQSFVVMIQLAQQTIDQVLKLMYICIPTLLAFMTTTG........YAVSAAAMAPVIITALSLTTYVIRV........IVLPCIIWVI...VLEIVSSMS.E..EFKVDQFIKLFYKGIKWTLRGLLVLSVSILSIYRMTLPYADVTVKKAALKFSTAFIPVVGNAVGGAADFLMSCSGLIKNTFSAGVIIWLLLLVSVPLIKI.FSYVVVYQIAGALIEP..I.G.DKKMA...SIAHKLGKGCEFIMSA..VGI..VA..L..LCVCSLAICMSV-g...........
A0A0X8D6C0_9BACL/62-381              ...................................................dgrs-----LFEM-VT-GEKGFSFTE.VMKGLGAFLFHELLINGKLLGAILIITVFAMVLETLQTAFE.K.NTV.S...MVAYAISYMVLIILAVNSFRVAVDFAQGAIQDMVGFMLALMPLVLVLLASTG........GITSAALFHPMVVFLVNTSGTLIST........IVFPLLFLSA...ILSIVSSFS.V..KYQLTKLAQLLRTVSLGVMGSFLTIFLAVLSLQGATAAVADGIAIRTAKYVAGNFIPVVGRVFADAADTVVGASLLVKNTVGIAGVLILLFLVAFPSLKI.LMLALIYHLSSAVMQP..L.G.NSPVL...SCLGIIGKNLLYIFGA..LAT..VS..L..MFFLAIMIIISA-a...........
A6LU38_CLOB8/101-423                 ....................................................lnp---VEYVKTYIKEGKGNLSIDT.LLKAALSIIFKEVKSVLSLVISIVTIAIICSLLKNLQDAFS.G.ESI.S...QVAFYACYALIIMVLSKSFIISISVAKDVINNISDFMNALLPILVTMISLAG........GIAAATTLDPIVLGAVVFIPKVYSN........VIIPMILMGF...VLEFANNIS.A..EHKINNLCKLFKQIIIWFQGIIVTIFIGLLTIRGITSTTIDAVTLKTAKFAVDNFIPIVGKAFSDAITSVAGYSLIIKNAISSIGLVVIILILLHPLIKL.VLIEFIYKLSAALIEP..I.S.DSRIT...KSLEAAGSSMMLIISC..VLT..VS..F..MFFILIGIMAST-g...........
C6LAD1_9FIRM/61-380                  .......................................................FDFRDSIAELLR-GEIPLRRDT.LLEFLKEAAFSELSNQKNMVLQILVLAIAAAVFSNFVKIFE.K.NQI.S...EIAFYMIYLLLFVILMKAFGDLGRMAENNLQQMLHFMKLLLPTYLVVASLAA........GSLTAIGFYELTLVFIAAAQALMTY........IVLPGIRFYV...LFLLLNHLG.R..EELFSKLAELIHLALSWILKTLFALVVGVQTVQALLLPAIDSLKNSVWTKATGA-LPVLGNTLNAVTETVLGTAVLLKNAVGVAGLLVIVLICLAPVVRL.LVCTFLYKAVGAAVQP..V.S.DKRIT...ECISGVGEGAALLLKT..VSV..TG..V..TFLITLALVTA--s...........
A0A0L0W7X1_CLOPU/67-388              .......................................................INLKEYLTSMIK-GKEVLGWDE.IAKGMIKTLFKEVIANWSILSKVLFLSIICSILTSLQGAFE.N.ETI.S...ELAFYVCYLILISLSIKSFIIAIDIAKDAISNMVILMQALLPVLITLLLAVG........AFTTSTLFQPIVLGSVSVVGTLMKD........IILPLILFST...IIGIVSKIS.S..KIQITKLSGLIRQISLYIIGISITLFMGIMSIRGAIAPKMDGLTIKTAKFAVDKFVPIVGKFLSDTMETVVGCSTIIKNGVGIIGMIGLFLISIIPIIKM.ISLIFVYKFTTVVIEP..I.A.NPRIV...ESLTEISKALTLVLAV..IAI..VT..V..MFFITVTIIIGAG............
R5YEM6_9FIRM/57-377                  ......................................................y-TFSDMVQSFVAEGTDGISRDN.ICDYVFDLFFYEIAAVKPLFIQIISMSILFAFFGKLL-VTK.S.QYV.S...EMSFFVVYTGIMLLLLQSFQLISEVVESGIGKTTSFMTAFIPTYATTLLLSG........NTASAGSFYGLAFGIVYVLELAMKF........LFIPGVHIYV...LLVLLDHLF.E..ESKLSKFAELFESGIYLALKVGLAVVMGMGVVQSLIAPAKDRLSVSSLYQGVKA-VPGVGNSFGAAGELLVGCTIMIKNSMGAAALLVLVILGLEPVLKV.LCFHVMYRLASAVLQP..F.C.DKRLA...ESIAGMGKGCGIYLKI..MWN..AL..L..LFFLTISMIAAST............
R7L2Q6_9FIRM/62-336                  ....................................................dpe-------------GITSLSPKT.VIAYMTEKLKHSAAAPLRLFGTVISVVILAAAGGAAADVVQ.S.GGS.E...KIYRTVAVLAAVGVTVPSLESCIDTAAQTLVQGSDFLVCYVPVFTGIAAASG........NVTASAGYNLTVLLLAQAAVKIASD........VLVPVISVCM...AMNIIDAVN.P..AFSLSSITGLLKKWTSLFLGLMMTVFTGLLSIQSIVGTSADTLGVKAAKFVVSNFVPIVGSAVADAYTTMRSGLGLLRGATGAFGIIALCVTLLPPILET.LCLYLAMTA-------..-.-.-----...----------------..---..--..-..-------------gactlpcpqgk.
A0A0F5R1H8_9BACL/88-408              ....................................................smp----SFVEM-ITPGGEGLKLGT.VLSGLMKMLLHEVLYNGKLLVSIVLLAIFSSILQTLQSAFE.R.NMV.S...QVAYSVAYMVLIVLAVNSFHVAIGYARDAIESMIQFMMAMIPLLLTLIASTG........SVATVTLLHPVIIFMVNTVGTLIYT........IVFPLFFFSA...VLHIASSLS.D..RFKVTQLANLLRTTGAGILGVMLTIFLGVISVQGAAGSVTDGMTLRTAKFISGSFVPVVGRTFSDAADTVISASMMAKNAVGLAGVIILLFLCAFPAIKI.LALAAIYNVSGAVLQP..L.G.SSPIT...TCLLTIGKTMLFVFGA..LAA..VS..L..MFFLAVTIILTAG............
R5VTX1_9FIRM/58-369                  ...............................................smehpeel---------------QQFSVGS.IFKTVLDGIQKEITAPIRLLLLFLAVILCSALLHAVQH---.-.GKN.A...GICEMMGVMGAVSACSKELCDCFSQGKAILSQCTDFMTLFTPVFSMFMTATG........QFGSAAIYQTSSLFLTNSILQILDH........ILLPFLSMSF...AIAIANAVY.A..EHTLDGLLQFNKTIVTWSLGFLMSVFIGVISIQSIVSSAADGLTTKTTKYVVSNFVPIVGGAVSDAYATVLGSLQVLKSATGAIGIVVLLLIFLPILLRV.VLYRLVLKLAVACADL..F.S.VSQVS...RFLKGAEQVLSMLFAI..LTC..FA..V..LFLVTVALLLL--is..........
A0A1H9LXH7_9BACI/64-383              ...............................................rksdfwtm----------VR-DQNQISLKS.WFKGFIRFFLYEIIENGKLLATLMLLTLFCLLLQTIQNAFE.R.KVV.S...KVAYAVVYIMLIIIAMKSFQLAATYVTDTIDMAQSFLIALIPLLLGLLASLG........NLLSISFFHPIIIFLIHTSVFVVSK........VVLPLILLSA...ILQIVSTLN.S..EYKATKLANLIKNIAISIMGILLTVFLGVISVQGAASAIQDGIAMKTAKFVTGNFIPVIGRIFTDATDTVLSATILIKNGIGIIGIVILIIIVMFPAIKI.FIISLMYKVTTAILQP..I.G.DGPVI...ECLDIIGKHILYLFAA..LLL..VS..F..MFFFTVVILIVS-s...........
W4ADL7_9BACL/69-389                  ...................................................ktps-----FMDM-LIPGNEGFSLKS.VFVAIGTFMLHEILYNGKLLVTIVMLSVLSMILETLQTAFE.K.NNI.S...KIAYSICYMVIIIIAINSFSVAIGYAKDAITGMINFMMAMVPLLFTLLASMG........NVITVSVTHPLIIFMIHLVSTLIHL........LVFPLLFFSA...VLHLVSSLS.D..KYKLTQLADLLRNISVALLGILLTMFLGVISVQGASGSVADGVSLKAAKYIAGNFVPVVGRTFADATDTVITASLLVKNAIGLTGVIIILFLCAFPALKI.LALALIYNVTGAIMQP..L.G.DTPIV...GCLQAIGKSMIYVFAA..LAA..VG..L..MFFLAITILLTAG............
G2TPR4_BACCO/71-391                  ..................................................sqkgs-----LM-DFMK-GEKHFSLQA.WLKGLLSYIFQELLINAKLLGSLIILTILSILLENLHHSFQ.Q.GTI.S...KIAYAVVFMVLVIIALNSFHVALQYALEAIRTMKGFILALMPLLLALLSTSG........GAGSAAFFHPVIIFLSGTSGMLVEI........IVLPLLLLST...LLGVVSTLS.E..QHKATQLAGLLRNLGIGILGAFMAVFLGVLSVQGTATAVMDGLAVRTAKFVTGNFVPVVGRMLTDAADTVISASVLLKNTLGIAGVAIVLLIAAFPAIKI.FAMSFMFKLASALLQP..L.G.GGPVI...SCLDIISKNMLYVFAA..LAI..VT..I..MFFLSITIIVTAG............
F9DN66_9BACL/21-297                  .....................................ffllmvmllitllvdffl----------------------.-----------------------------------------.-.PAF.Q...KWTRFVLLLLVLLLLMEPATESFRQIQLITHSIASLFLGMYPLIAAMILASG........ATFSVVNFQPAMLLFAQGAVVFAEK........FLLPILSTAL...LLDILTRLM.P..EIVFTRMADLLRTSLLAIVSAMVAAYSIFITAGGALTWTLSGTLNEPIKELIRQNIPLIGSLLTDTLGSIGRYSSGATAYISIWLLLSIWTVALLPALKI.LCTAFFFRWTAALIEP..F.S.QKEVC...GLLDDIGRTLFVLCAI..SFL..IS..F..AFIYTTIFIV---tfi.........
R6SD97_9FIRM/70-390                  ......................................................l-DFKEILIGVLS-GDITFSAQL.LKQLVKEQFSYAFASSRQNLIHILMLAIMTAVFTNFARAFG.N.GQA.A...DTGFYVMYLMIVALCLNSCQIIMDWVEAGISNLIQFMTVFGPIYFPAVAVAK........GSVTAISFYSLTLFLVYLVEMFLKY........VVLPAIHIYI...LVSMLNYLT.K..ESYLSKLAELIKTVLVWIMKTILAGVVGLNLVQSLLSPAMDTVKRSALTRGTEA-IPGIGDAIGGVTEVIFASAVLVKNGIGVVGAIICFALCLMPIVQI.GAIALLYKLAAALMQP..V.S.DVRII...GCMETVGEGMRLLIRA..VFT..VG..M..LFLITIILVAAST............
A0A140L8C0_9CLOT/66-386              .......................................................FHLKSLVQGLIR-GENIFSIKD.VFQGLLKYLFKEVVANSVLLVKLIVFAVLCAFLNNLSDAFE.S.DGV.G...KLAYMTCYIVIIAIAIQSFAIATQIGVDAIDEMVMLMQALLPVLLTLLMSMG........GIASSALFQPMIIASVGIISTLMKN........IVMPLIFFSV...ILTIVNYLS.S..KIQVSKLASFLKQICIILIGFMLTIFIGVITIQGLAASATDGVTIRTAKFAVGL-IPIVGGFISDAADAIFGCSLVLKNALGGLGLFLLTLMVMMPLLKI.LSLILIYKLASALIEP..M.M.DNALP...DCLNDLSNSLMMVFGT..VLS..VA..M..MFFMAVTIMIGAG............
A0A174GA88_9CLOT/67-389              ...................................................ldpv----SYIKAYMEDGKGNISLSK.IGGAVVSLLLKEVKSVLGLSFSIIAIGIISALLKSLQEAFN.S.EGI.S...EVAFYACYALMIVILTKTFLISLDMAKDVITNVVEFMSKLLPVLVLMLGAAG........GLTQAATMDPIVLGATILIPQLYLN........IIIPLILSSF...VLQFANNMT.N..GSKLSNLCDIAKKSTIWIQGIIITIFIGLLTVRGITSSTIDAVTLKTTKFAIDNFIPIVGKSFSDAISSVAGYSLIIKNAIGSIGLIVIILIILYPIIKI.VLSSIIFKLSASLLEP..I.A.DKRIT...KSIAAAGESLTLIMSC..VLC..VS..L..MFFLLIAMMVQAG............
D9RXJ9_THEOJ/55-375                  ......................................................y-DLKDLINT-LR-GNQRYDLRG.LVNGIIKYVFREITANYHLLAKLVALSVICAVLKNLNNGFE.K.DNI.G...RMAYSAIYLVLVVIAVQSFIIAINTGRDAISNMVSFVHALMPTVFTLLAAVG........GITSVNVFNPLIFIGITAASTWIKD........IILPVIFFIS...VLSLVNNIS.D..SFHVSHLAQLLRQVCVFLLGLFLSVFLGIMVVQGAAAATVDGISIRTAKFASKNFVPIVGGIFSDALDAVVGYSLILKNTVGLIGLLFIFIITLFPVIKI.LSMIFIYRLSAAIIQP..V.G.EDSIV...KCLNDIGNSLTMVFIS..VAS..VA..M..MFFIAITIILASG............
A0A101E7Y8_9FIRM/66-238              .......................................................ISIKGIIES-IKEGKIDFSFGF.LLRGMGEYLFHELIRHSALMGKLVILAVICAVLYNLLDAFE.-.GTT.G...QVAYTIVYLVLITIAIGSFTEAIKIGRESIDKMVSFVQALLPLLLTLLASIG........GVSSAAIMHPFIMAALGLLGTLIKN........FVFPLIYFSG...ILSIISHIN.K..KLRFQIL---------------------------------------------------------------------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------llf.........
A0A0A6VEU3_9BACI/70-390              ..................................................sqkgs-----LID-FIK-GEKHFSLQA.WFKSLLTFIFQELLINGKLLGSLIILTVLSVLLETLHHSFQ.Q.GMI.S...KIAYAVIFMVLVIIALNSFHVALDYAKHAIETMNGFMIALMPLILALLSTTG........SVTSATFFHPVVVFLSNTSVMFIQY........IVLPLLLLST...LLSIVSTLS.E..QYKATQLAKLLRNISIGGLGIFMAIFLGVLSVQGTATAITDGLAIRTAKFVTGNFIPVIGRMLTDATDTVISASVLLKNTVGIAGVAMILLIAVFPAIKI.FVMSFMFKLAAAIMQP..L.G.SGPVI...ACLDTISKNMLYVFAA..LAI..VT..I..MFFLTITIIITAG............
A0A223KSX9_9BACI/64-383              ...................................................qkgd-----FIDY-VT-GDKSFSLSE.WFKGFLKYLFHELLTNGKLLGSLILLTIFSMFLQTLQNAFD.Q.KAV.S...KIAYSVVFMVLIIIALNSFHIAITYTTDAIQNMMAFILALVPLLLALIASSG........GLVSASIFHPIIIFLMNTSGLLIQY........VVLPLLFLSA...ILSIVSTLS.E..QYKVTQLAQLLRNISVGILGIYLTVFLGVISVQGATAAVADGITIRTAKFVTGNFIPVIGRMFTDATDTVISASLLLKNTVGILGVVVLLLIAAFPALKV.LSLAIIYKLAAALLQP..I.G.GGPVI...ACLDIISKSVIYIFAA..LAI..VS..F..MFFLSITIIIAAG............
A0A1Y5KP06_9BACL/78-396              ............................................mptfremllpg--------------G-GFKLKD.VLQGLVRYLWHEVLYNGKLLVTIVLLTVFSMVLETMQSAFE.R.SAI.S...KVAYAITFMVLVIIAVNSFHVAIGYARDAIESMITFMLAMVPLLLTLLASMG........SLVTVSVLHPLIIFMIHAVGTVIYT........FVFPLLFFSA...VLHITSALS.E..KFKVTQLANLLRNVAVGALGIMLTIFLGVISVQGATGAVTDGVTLRTAKFVTGNFVPVVGRMFSDAADTVISASMLAKNAIGIAGVIVLLFLSAFPALKI.MTLALIYNVAAAVMQP..L.G.DSPIA...DTLQTIGKTMIYVFAA..LAA..VS..L..MFFLAVTIILTAG............
R7AQU7_9BACE/23-342                  ......................................................l-DFETLVRSIISNGV-ADSLPQ.LWNRIVIAATAELRENVTGICQILIIAVFTALFTNFASVFA.D.SSV.S...DTGKKLSRIAAVTVMAAAYTCTAGIAYDVLASVTGFIKMLMPAYLSCVALCS........GNFSAAAFSEGVMLAVLVLNYVFSD........VVITGGSIYV...MIMAADAIT.G..-GGLDKIAGLIMTVLKWIIKSSMAAVIGINLIQGMVAPMADGVNRGVLTRAVGL-IPGIGGGVSTLSSVLLGAGALIKNGMGAASLIVIVTICAAPVAKL.AMFTVTYRCVGAFTQP..M.C.GREFA...EMITGFADAMRLMLSL..VAS..SL..A..TVFIIIAIICIST............
A0A1G4WKC9_9FIRM/55-365              ..................................................adtls----------------SISFEG.ILAEISRIGSQSAQEPLRGLISVTAMLLICSLLSSYQTALS.-.ADI.G...GTLNTVLALCLSAAVAVPAAGLIRQTGEMLVCSSNLMLAYIPVMALLLTASG........SIAGSAAYYAGVLAMGEGIGQLSAR........IIVPFCNMLL...GLGVAGGLN.S..AVNLSGFTRSLAKTAKWLLGFGMALFTAALGLKQVLSSAADSLTGRAAKLALSSFVPVVGSALGEALRTVQGSVTVLKSGIGVFVILALGVTFLPSVMSA.LLWLVTLWAGKSTAEA..L.N.LPQGA...LMLESISDVFRVMLAA..LLS..VM..T..VYIITTAMIFTM-g...........
A0A073KHQ4_9BACI/63-383              ..................................................sqkgs-----FM-EFVK-GEKEFSIKE.WMIGLLKYLFHELVANGKLLGTLIMLTIFSALLQSLQTAFS.K.SSI.S...KIADAVVYMVLIIFALNSFYVVMTYARETIQTMVDFILALLPILLALIATGG........GVVSVSFFHPIIIFLMNTSGLLMNY........IVLPLLLLAT...ILSIVSTMS.D..QYKVTKLSKLLQNVSVGIIGIFLTVFLGVLSVQGTATAVADGIAVKTAKFVTGNFIPVVGRMFTEAADTVISASGLLKNTVGIIGLVILCLIVAFPAIQI.FCIAFIYKFAAAVLQP..V.G.GGAII...QCLDIIGRSIIYVFAC..LAI..VS..F..MFFLSITIIIAAG............
A0A292YQX9_9BACL/65-382              ................................................sphildl----------LR-GD-GFTVQG.VLLGMLKFLFFEIMHNSLLLGSILILAVLAALLENLQNAFE.R.NTV.S...QVGFAVIYIALIILSVNSFMTATGYAKQAIEAMSSFMMGSIPLLLTLMASSG........AVTSAGLLYPTVVFVVNAFAGLVTT........VVFPLIFFSA...ILLMVSEFS.S..RYKLSQLGGFLRTTGNWLLGAFFVIFIGIMTVKGAMGGVADGIALRTAKFATSTLIPVVGKMFSDSIDTVVGASMLVKNSVGVGGLLILALLCTFPALKI.ISLGIVYSLSGALMQP..L.G.NSPVV...SCLSTIGKTLFIIFSA..MAT..VG..F..MFFLSVTMILLA-g...........
R7N7G3_9FIRM/66-383                  ......................................................v-TFEDIVDSIYS-GN---STRD.SGKKIVQYITEVISSNRNDCMKILILCILSAFINVFGPFFN.K.QQL.T...ESTLSVIAISLITVLFVVFIQASDTASSTLTSIINLYKAISMVFLPAISASG........AIMSKAVYYQIIIAMIAVSNIFFKN........ILLKTNKIYL...IISLCDCID.K..EAHMDKACNLIKKGVKWCCYTILTVFIGLNAIKSILTPVQDTVNSKGIFMGISL-IPGIGDTAQVLSNTILSSSALIKNAIGVSGIIAIVMCMFFPLLRI.GLLAVIYQGIAAGLQP..I.S.DKRMV...RAVSSLGQALGMIVYI..MMI..TL..V..LFILTIAIICVAT............
A0A1M4M6L8_9FIRM/66-387              .......................................................INFKEFIVSLIK-GEKILDGGK.LLNGILKIIFSEVIANSSLLAKLLILGIICSIFTNIQSAFE.S.DAV.G...EVAFYVCYLILISLSIKSFVIAMNITWKAINDMVALMQVLLPILLTLLVAVG........GITTSSLFKPVILGVVSIVSTLMKD........IILPLIFYST...VVGIICKIS.S..RIKITKISSIIRQISIVIIGVSLTIFIGIISIQGTMTAKVDGVTIRTAKFAVDKFIPIVGKFLSDVMETVVGCSMVLKNAVGSIGMVSLFFICIIPIIKI.ISLIFIYKVAGALVEP..I.T.NSKIV...DSFNEISKSLIMLLAT..VTS..VG..V..MFFIAVTIIIGAG............
B5CM44_9FIRM/64-384                  ......................................................l-SFREILMQLIS-ENGGSTAGT.VVQFIKETVFYQFGTNKKILVYMILIAVAAALFNNFTSVFQ.N.RQV.S...EVSFYILYMLLMTLSLVTFQHTLQDTEQLLSYLTEFMKLLCPSYFLAVAFAA........GSSSALVFYNIVLWIIYLVELVILE........LLMPIVHVFV...MIQVLSNLT.G..EDLLSEFADLIRKGIAWCLKTLLAGVVGINVLQGLLAPAIDTVKRSAVNRTVEA-IPWIGDVTGGVAEVALGSAVLIKNGIGAAGMVIAVMVCAVPVIRL.VLLAFIYKFVAAMVQP..V.S.DKRIT...ACIGGVSEGYGLLLQI..LLY..TA..L..FFLITLAVIAGAT............
A0A1Q8QXZ2_9FIRM/66-385              .......................................................FSLARMFED-LKSGKLDLRPEK.LGQTLVEILGREILSSAPLIGKLLILAVLCAVLGQLQVAFG.-.GSV.G...KIAQVMTYLVLLSLALTSFQEALGMATGTIDRMVGLMQTLFPVMLTLLISMG........NLTSAALFKPLIMGSLTVLATMIKT........VVLPLYFLSA...VLRLFNHIS.E..QFKLSKLAGLLEFAGKLSLGVIMTVFIGVMTVQGVTGGVADSVVFRTAKYSADL-VPVVGKFFKDAVELVITSGLLLKNAVGIIALFAIIVICVGPVVKL.LAMILVFRVSAALIEP..L.G.EKALA...DSLQDMSKSLIFILVT..VAS..VG..I..MFFMTVAVVIGTG............
Q67NA0_SYMTH/66-388                  ........................................itlgdflrlssgeds---------------PSLSAGA.ILQGLLRYLVREVLANADLLMKLVVLAITAAVLGQMQSAMG.A.DAA.G...SVAYWVIYLVLVGLAITGFGLAVGAARQVMESLNAFMLAVLPTLLTVLIALG........GAATAAIFQPLMVTMLNVTSTVMVN........VVFPLAFLAA...VLDIVSGLH.E..KYRLSNLAHLLRQGATVTLGATGTVFLGTVAVKGAAGAVADGLSVKAAKFVTGSFVPVIGKTLADATDLIVGSSLLLKNALGMLGATAIFFIVAFPLLKI.LSISWVYQVAGALVQP..A.G.AGEIA...RMLTTMAKSLYMLFAA..VGM..VA..L..MFFISVVVIVGS-a...........
A0A0D0RJ54_9FIRM/1-164               .......................................................----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---MLNELG.D..EKYFSGFLNLGNKLIQSGLNVLIALVIGMQVIEGMILPQADAIKNQALIKAVSV-IPGIGGVTGTMSGALLGSGVLIRNGIGLTAMIILVFICLIPLCQM.VMTNLLIQLVLAVMTP..I.A.DKKML...SGVNKLSQSFSILIKV..MTY..CL..C..IFLIVIACVCAMT............
A0A127VZA4_SPOPS/2-292               .........................................isflesilgtvlss----------------------.-----------------------FVIIIIATFMALLV-DFL.F.PSF.A...KWTRMILIFIVVTVVLQPAFDHLTLIRDIANSISMMFISIYPILTASMVAAG........GAFSMLNFQPAMLLFANGAIVLTEK........VLIPLLTAAL...ILDLVSRIL.P..AVPFTKMADLIRTTLLGTVSAVVAAYSIFITVGGTMTWALTGLASEPIKELIRQNVPLIGSFMTESMGTMGRYSSGASVFAGGWLISAIWTVALIPSFKT.LLTAFFYRWTAALIEP..F.A.NEDIT...GILDDIGRTLFVLCAV..SFL..IA..F..AFIYTA-------lfsiilv.....
R7GEU3_9CLOT/56-375                  ......................................................n-DINQLLDDAIK-GQ--VNNKN.ITAKIWGIFGKEFKSTLSTLVSILAIIVIHSILKSISDSLE.N.DGV.S...KLIYYVQYILIVTIIMTNFSDVVKIVKEATVNMVGFINLLIPLLTSLMVFTG........SITTSSMIEPVILFLVNLIGNLIQS........VLIPFVLVIA...ALSIVSKIS.D..KVQINKLSNFMKSGVVWALGIFLTLFVSVISLEGTLSSSVDGISAKTTKAVVSSAIPIVGKILGDAVDTVLGCGIILKNAVGIVGVVIIIGICITPILKL.ALITVSYKILAGICEP..I.A.DEKIM...KLLDQIGDIFKIFLAI..LAS..VS..V..LMIIGVTLVVKI-s...........
A0A1G8PU65_9BACI/47-361              ...............................................rgwletgp----------------NMKMDH.WLEGILSFVLDEMVTNVYLLSSLLFLTLLSTLLHTLTHAFK.D.KGV.H...QTGNLILAVLLVTLIIQSFETVLEYTYETIDQMSAFMIGILPLLLGLMASLT........HSVSVAFFHPFTIVMIQFSSFFVKF........VILPLFLSSL...LLSLVSTLH.T..EYKLDRLADLFKKLAIALLGIYITIFVGVLSVQGTFTAVQDGVTLRTARFVTGNFIPVFGRLFTDAADTILHASLLLKNTLGVIGLILLMSIALFPTIKV.AIIALMYRLAAGLLQP..L.G.DTPSV...MAMDVVGKHIIFVCIS..LFT..VS..F..MFFLMIVILVAS-s...........
A0A1Y4MA26_9FIRM/65-385              .......................................................VSFEDLVKT-LTDGDFSGFVHL.IFSGIRTGTFSVLRDNREAIVHILVIAMIAAVFVNFSHIFT.N.RQV.A...ETGFLILYLLLITILLKSFGIMIDSIDGSLKVLKDFMKVLCPLYFLATAFST........GSTTSVLFYNLMLILIYLVETVILH........IILPMIHVYM...MIRILDHLS.P..EPYLTRFGELLDMIVRWILKTMLICVAGINVMQGLISPAMDAVRRSGIQKGLEA-IPGVGGALGGMTDVILSSVVLIRNGIGAVGAVVCVVICAVPILQI.GMMTLIYKLIAAVAEP..V.S.DKRIV...SCIASTGDGAVLLLKT..VYT..SA..V..LFLLTIVVVAAF-g...........
A0A1I6BGB1_9BACI/72-392              .................................................sqkgsl-------YDFIK-GDKQFSFKH.WVQGILKFTFQEFIVNGKLLGSLIMLTIFSMFLQSLQNAFE.Q.STI.S...KVAYSIIFMVLVIIALNSFHVAIDYTNEAIGTMISFILALIPLLLALIASSG........GIVSAAFFHPVILFLMNMSGILIQY........VILPMLFMAT...LLSIVSTLS.E..QYKVSQLANLLRNWSIGLLGLFLTVFLGVISVQGASAAVTDGITIRTAKFITGNFIPVIGRVFTDAADTVVSASVLLKNTVGIAGVAILLLIVAFPAIKI.LMIAFIYKFAAAILQP..L.G.GGPVI...KCLDIISKSVIYVFAA..LGI..VS..L..MFFLSITVIVAAG............
I4D8X2_DESAJ/64-383                  .......................................................FSLGQMFED-LKSGKLNLSPEK.FGQMLLGVLVREISKNVPLIGKLLVLAALGGILGQLQTAFS.-.GNV.G...KTGQVMTYLVLLTIALTSFREALTIAGGVIDQMVGLMQTLFPVMMTLLITMG........NITSAALFKPLILGSLTVLATIIKT........VILPLFFLAA...VLKLFNQIS.K..EFKLSKLAGLFEFVGKVSLGVVLTIFIGVMSVQGVTGGVADSVAFRTAKYSADL-VPVVGKFFKDAVELVVTSGLLLKNAVGIIALLAIIIICLGPLIKL.LTMILVFRISAALIEP..L.G.EKGLA...DSLQDMSKSLIFILVT..VAS..VG..I..MFFMTIAVVIGTG............
A0A252F7I2_9CLOT/68-387              .............................................aqsllsgldg------------EGDLAQSVYT.LLQRTKQEQQSAVRRAAATLVRVAVILILCGCAGSFAK---.T.SQL.S..pLILSLAGALGVTAVVYRDLSGLMGLCSQTAEEIQVFSKSMLPVMMTAVSLSG........SPASAALAYSGTMFALDLCISLITG........IFIPAVSAYV...AMITVNAAI.S..NNMLSRLAAFLKWLTVGTLKLLLTLFFTYITISGTASHGMDTNTVKAAKFALSGAVPVVGNILSGATDAVLSGAVVLKNSLGIFGMLCVAAICLVPFLRL.GISYLVFRTGTALLSP..I.C.PPQLA...GLLDGITGSIGLILGM..LGS..CS.aI..LFFELV-------ysvvmvt.....
R5Z6C8_9FIRM/51-370                  .......................................................IDIDELLQE-ISKGNVMAAVNI.IIDNVRDKLENQFNDIKQVIITIIFTTVFAALIVNFSYSSS.K.NGV.N...EMAFYACYVLQISTLMYIFQIAMEIGEKLVLFILQLMGAIIPTYLLAVGITS........-QATALGFNSLIMTLIAVIEAVILN........IVFPMLKVYM...AISMVNSIS.K..EDLLSGMADLIKKAINFIYKIILGTVTGLNLIQSLILPTTDLAKNNIAKKIISN-VPIVGNGTDAVAQIILSSVGIIKNSIGVLAIILIVFVCIVPMVKM.TAYSAVVQISGAVLQP..I.A.DKRIL...NCIKQTSEGIKLLNRG..ISV..VG..F..LFIITIAIICIST............
A0A1M4TN96_9BACL/65-385              .................................................pqdift--------FLQSMNSKEFSLAE.FGKGLLRYFLHEVLYNGKLLGMIIVLTVLSMILQTLQTAFE.Q.NQV.S...RVAYAVVFMVILILAIQSFSSAVTAAKAAIGQMVDFMVASVPLLLTLLASMG........NLASVALFHPFIIFMIHIVSLLIYL........VILPFFFFST...ILSIVSTIS.D..KYRVDQLARLMNKFSITLLGGSLTIFLGVLSIQGATAAVTDGIAIRTAKYVTGNFIPVIGRTISDAADTVLGASLLVKNTLGLAGVIILLMICAFPALKI.LSLALIYHFSAAVLQP..L.G.NSPII...ESLGIIGRTLVYVFAA..LAA..VG..L..MFFLAITIMVSAG............
A0A1G9WSR0_9BACI/1-295               ...............meeilqslvqplkevaqtfsymllfgfaficlewfipssk----------------------.-----------------------------------------.-.---.-...RLFKLLFMLIICIYCLEPAIRALQMIQAMTSELVNLFLGIYPILTLGIAASG........GAFLITAWNPAVMLFASFTTILAGK........ILIPAIMAAF...IFDLISRIH.P..PTSFSKMSDLIRLTLIGSTSIILLLYSIFMSVNGMITWSVSGTVNETVKRLIQNNIPFVGSLLTESISTMKNFSSSASVITGNAVIITVLMLVAIPTIQT.IFIAFLYRLLGAILEP..F.V.DGNIS...GLIDDIGKTLFVLSII..SVL..IA..F..TFFFTIILTM---lfa.........
G9YNJ7_9FIRM/48-359                  ...............................................agisldeg-------------------LQT.ILDTGSGQISGVVRKAVRSGVLLLTVVLLCGLAEGLYGGMG.V.SQT.T...DVVAIVGALAITAVAVADANSLIGMGREALEQMETFSKILLPTITAAAAAAG........SPSGAVARQLATMLFSDMLITLINR........LLLPLVYTYI...AACVAYAAV.G..NEGLKRIAGTLKWVVTSVLTVVLLVFVGYLTVSGVIAGSTDAVTVKAAKFTMSSLVPVVGGILSDAAETVLAGAGILKNAVGVFGMLAVLCMCVAPFLQL.GIHYLTYKVTSALSAT..V.S.SGRVA...GLIDQIGGAFGLVLGM..TGA..SA..L..LLLISMVS-----aitav.......
W4CV02_9BACL/123-442                 ....................................................tps-----LMDMLLP-GDKGLSFKS.VLSGLMNFMWHEVLYNGKLLVTIVMISVLSMILETLQTAFE.R.KSV.S...KIAYMLCYMVVLVIAVNSFNVAIGYAKDAIDRMIDFMMAMIPLLFALLASMG........NIVTVSVTHPLIVFMIHTVGTLIHT........LVFPLLFFSA...VLHLVSAMS.E..KYKLTHLANLLRNIGAGLLGVLLTVFLGVISVRGITSSVTDGVTIRAAKYITGNFVPVIGKMFADATDTVISASLLVKNAIGLSGVIIILFLCAFPAIKI.LILALIYNLAAAVMQP..L.G.ETPIV...TCLQTIGKSMIYVFAA..LAA..VS..L..MFFLAVTIMLTAG............
D4K6A2_9FIRM/107-350                 ...............................cgvllwqeldklaaalctrmagwk----------------------.-----------------------------------------.-.---.-...----------------------------------SYLLGFLPVYSGVLAAGG........EWNAGAAANGFLLTVLCFIAQAVTL........WLQPLLRSYL...AISMACGIS.S..RKSLFEGCTLTGRLLRQAIGWAGKAFAALMSIQRVVTVQLDRSASRLGQLLTGS-VPIVGQALSNAADAVLAGMQLLKSTLGIAALLSIGAEFAPLYLGL.LIHLLFLSCCGWLAGI..G.G.LEYCH...KLLQCFAEAVRCMAAV..TAL..FF..M..LFVVGIALLMLT-g...........
A0A0F5ICP7_9BACI/72-391              ...................................................ekkp------LTELLKDGQ-AFSMEA.WVKGILSFMFHELAANGKLLGTLVLLTVFSAFLQTLQNAFE.Q.GTV.S...KTAYSVVLMVLLILALNSFRLAINYATEAVDYMVNFLLALMPILLALLASTG........GAVSAAVFHPLVIFLMNAGGMAAQK........IILPLLFFST...LLSLVSVFS.A..RYKATKLADLLRKGSIGLLSAFMAVYLAVVSIQGTAAAVTDGLAIRTAKFFAGNFIPVVGRMFTEAADTVMSASLLLKNTIGVAGAGILLLIVAFPALKI.LVLVIVYRVAGAILQP..L.G.DEVVS...ECLEIIGRNMTYIFAA..LVI..VS..F..MFFVSIVILVAA-s...........
C0CY24_9FIRM/89-409                  .......................................................FSFTSMMKSLLT-GDLKSVLGQ.AGMGLKNSLVSEVHSAGSLLAQVVVIGMVGAVFTNFSSVFK.G.GHI.S...DTGFFVTYLLLFTCLAASFFASIEIASDVLGQVLDFVKLLMPAYFLTVAFSG........GSVSAVALYEAMTAAVTLVQWLCCN........LLLPVVRIYV...LLVLAGHVA.K..EEMLSKLTELLEQWVGWALKTLMGLVLGLQVLQGMVVPYADSAGQAGVRKVIEI-IPGLGQGAGAVAQMVLGSGVLIKNSLGAAAVVVLLIMTLVPIAKL.AVLMLFYQLAAAVMQP..V.C.DKRVV...SCVSGVSCGHKLLLKI..VVS..SL..L..LFVIAIAITCAAT............
A0A0C2XZZ3_BACBA/68-387              ...................................................qqqp------LTDLFK-GGQAFSISA.WSKGLLSFVFHELYANGKLLGTLILLTVFSVFLQILQNAFE.Q.GTV.G...KTAYSVVLIVLLILALNSFRLAMEYAGDAVDQMIQFLLALMPILLALLASTG........GAVSATVFHPFLLFLMNVSGLVIQK........VVLPLLFFST...LLSVVSLFS.E..HYKATKLADLLRHWSVGLLSVFMAAYLAIVSIQGSAAAVADGLAIRTAKFFAGNFIPVVGKMFTEAADTVMSASLLLKNTIGIAGAGILLLIVAFPALKI.FALVLVYKVAGAVLQP..L.G.DETMT...ECLEIIGKNMTYVFAA..LVI..VS..F..MFLLSIVILVAA-s...........
R5FBP4_9CLOT/100-420                 ......................................................l-SFWGLMKELMK-GNLKGILGQ.TGMGLKNALFSQVDRGSQMLFQVAAIGLIGAVFTNVSSVFK.G.GQI.S...DTGFFVTYLLLFTCLAASFSASLQVAAQVMEQILEFMKLLMPAYYMAVAFSG........GSMSALALYECMLGAVTGVQWLCST........VLISMVRIYV...LMVLGSHVA.K..EALLSKLTELLEQAVVWSLRTLTGLVVGFHLIQAMILPYADAAGQAGMKRLMEM-IPGLGQGAGAMAQMVLGSGVLIKNTMGAAAVVVLAVISVVPVMKL.TVLMIMYQCVAAVMQP..V.C.DKRVV...SCVSGVSKGHKLLLQI..VLY..SM..F..LFMVAIAITCATT............
A0A1I5UMB4_9FIRM/40-355              ..........................................rdadisgvdglsg------------------GVEN.ILDWMASQVQAVFRQRVKGAAAVLLVVVLCSAVDGFYQGAS.S.K-T.T...LFLPMVGALSVTVAAAGSLDTLIGLGAETIDQLSIFSEVLLPTLAAATAASG........AIATATVQQVTTVLFVDLLLRLIDG........LLLPLVYLYI...GVLTASAML.P..ENRLNAIADALKKVIVWILTTALLVFTLYLSMARVISGSADGMTVKVAKTAISGVIPVVGGIISEASETVLAGAGMLKNTIGVFGTLAILAACAYPFLQL.GIQYLLYKLTAFLAAT..V.G.APGLC...KLIDGLGGAFGLVLGM..TGA..CA..L..LLLISVL------ssvaa.......
S0INU0_9FIRM/59-378                  ......................................................l-DFQELVRK-LTDGEEP-DRGW.ILKEIAEAVFAEVAAFRGTLVQIMLLCFVFAILCNFADVFE.N.PAV.T...ELSFYLVYMLLFVLLMKSFFILRDVSAQVIDEMMVFLKVMIPTFTMSMTFSG........QITTAAGFYDMTFLLIYAMEWLLRV........MILPAVQIYM...VLELMNYLT.E..EDFLSRMTELLKSGIVWVMKLLFTVVVGINVVQNLLTPVIDTFKSNLIAKTAGM-LPGLGASVNAVTEIMVGSGIIIKNGIGLAAVLVLLVLCAGPLIKV.GVMTFLYKLLAAVMQP..V.S.DRRMT...GCISSAGESGRLLGKV..VVT..TT..M..MFLVAVAMITAAT............
A0A1Y4W911_9FIRM/43-353              .........................................egadleqgmghlls----------------------.---DAAEQLGELGKSSLAAGLKLLAVVLLCSLAEGAAGQE-.K.REG.L...QAVELAGALAITALTMTDMAAMIGLGRETIGKMEVFSQSILPVMAVLTAATG........SVTGAAVRQGATVLFSQLLIMVLDK........LIIPLVYGYV...AVSCAYAAV.D..NPGLGKLAGVLKGIAAFLLTALLVVFVGYLTATGAVAGSVDASAIKAAKLAISRAIPVVGGVLADASETVLAGAGALKGTVGVAGMLVVLAICLSPFLQL.GLQYLVYKGAAVLCAT..V.A.QPRLS...RLINAIGGAFGIVLGM..TGA..SA..L..VLLVSIVSA----ltaa........
R7AZA8_9CLOT/75-395                  ......................................................l-SFREILSMLLS-GNYQSVVRM.LMDFCRTALFREISENGRWMGQVILLGILGAVFASFSSLFA.D.SQV.S...EMGFYVTYLLIFTLLAASFLNGVRITRTLLEQLFEFVRVLVPAFFLAVSFSG........GSTSAAAGYAWTLASVNVAEWVFLQ........LFLPCAQLYV...LLSLAGHLS.S..KDLFSKALELLEQGMRWGSKALLGVVLGFHVLQGMIAPYTDSVRQTALRRAVSL-IPGIGQGAAAVSQVLLGSSVLIRNTVGIGGVLVLAAVSLLPLLKL.LILYLGCQGSAALLQP..V.S.DSRVV...EAVGAVAKGFYFLLAA..AGS..AV..V..LFALSIAVVCAST............
D3FUV6_BACPE/67-387                  .................................................sqkgsf------L-EFIK-GDKQFSFKE.WGIGFVRYLMHELIVNGKLLGTLILLTVFCMILQSLQNAFE.Q.HTV.S...KVAYAITYMVLMIIALNSFHVAISYAQDAINNMIHFMIALLPLLLAIMAAVG........SITSAALFHPLIIFLVHTSGLLIQY........IVLPLLFLSA...VLAIVSTLT.D..HYKVTKLANFLRTIAVGALGIFLTVFLGVISVQGASTAVADGITVRTAKFIAGNFVPVIGRMFTDAADTVMSASLLLKNTVGIAGLVILLMLCAFPAIKI.LSIAIIFNLSAAILQP..L.G.GGPII...ECLSIIGKAVIYVFAA..LAI..VC..L..MFFLAITIMVAAG............
A0A259UQY4_9FIRM/59-378              .....................................................ta----STMKEIAS-KGLNFNWQN.LSTKFLSYFLTELSTNLHLMGKLLFLAVLCALLQNLQNSFE.Q.SAI.S...LLAYSVCFIFLCVIALSAFYNGLTLARETVNNMVGFMEALLPLLLSLLAGVG........ALTSAALLTPLMLLVVSATSVIVKD........VILPLLFLTA...LLECVNYLS.G..KYSLSNLTGVLKQAGMVILGLVLVIFIGIVSVQGVAGSVADGLTLRTAKYATATFIPVVGKMFSDTVELVMGASLLLKNAVGIFGVSAIALLCALPLIKL.LSLAAIMKIVGALIQP..M.G.DEKMA...KCLDSMGNNLLLVFGA..VLT..VV..L..MFFLIVTMIIGVG............
A0A1G9LKU3_9BACI/69-389              ...................................................lqks-----TFMEFIK-NQESLSFKD.WAKGILQYLFHEVIINGKLLGMLILLTLFCVILQTLQSSFE.N.NNI.S...KIAYAIVYLVLIVLALNSFHSAASYAKESIELMSGFMVALLPLLLGLMASLG........SMAAVSFFHPAVVFLIHISVLLISV........VVLPLFFLSA...LLSIVSTLN.E..HYKATQLADLLKNIGIGLLGVFLTAFLGVISVQGAATAVQDGIALKTAKFVTGNFIPVVGRMFTDAADTVLSASLLLKNTIGLVGVILILGIALFPAVKI.FVIALIYKLASALLQP..I.G.DGPVI...ECMDSISKYIIYIFAA..LLI..VT..F..MFFLAIVILVAS-s...........
A0A1H3KVN8_9BACI/65-384              ..................................................qrgsf-------MDFIR-GDKQFSPSE.WITGLVRFLLNEIFANGKLLGNLVLLSILSMVLAQLQQAFE.K.HSI.S...KVAYAIAYMVLLIIALNSLYVAMDYVQKTIQTMSDFMIALVPLLLVLVASIG........GVTSVALFHPIIMFLVHASGVFVQY........IVLPLLFLST...LLFIISTMT.E..HYKVTKLAEFLRNIAVGSLGIFLTVFLGVLSVQGATAAVADGIAVRTAKFVTGNFIPVVGRMFTDAADTVMGASALVKNTVGVVGLVILFLICTFPALKV.LAMSLIYSFTAAILQP..L.G.GGPII...QCLSIIGKSVMFIFAA..LAA..VS..M..MFFLSITIIVVSG............
A0A2C6LGH4_9FIRM/61-251              ......................................................l-KFKELVLKLVK-GDLDWQVSD.VFIGLIKFFFKEVVANASLLGKLVVLAVICAVLQNLMSSFE.K.GTT.G...KLAYAVSYMALISLAVGTFTLAVNIGREAVDNMVHFMQALLPLLLTLLAAMG........GVASTAIFHPIIFGSITAIGTIIKV........IVFPLIFFSA...ILSILSNLS.E..KFQVSRLADLMKSVAMSVLGLC------------------------------------------------------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------slssw.......
R5R433_9FIRM/65-384                  .......................................................VSFRELFQGLVKDGQISFDF-S.WEKVGLLFLADVLGIQKKTCIHILLLVLVAALFSGFSGVLE.N.RQI.G...EISFYIVYLFLFVLLLKNFEGFSSQIQETMTRTVEFMRALLPAYYLAITAAE........GVSTATLFYQMILLIILLAERVILA........FLLPGVRIYF...LVELTNYLT.K..EELLSKMAELLKTGIQWALKTIVGVILGLQLIQRLISPAVDALKRTIVGKTAEA-IPGVGNLFSGVTEMVLGSAVLIKNCLGAAALIILLLAAAPPVIRL.GVSSVFYRFIAALVQP..V.T.DNRMV...GCIQTMGEGVGMLLRL..LFT..VE..I..LFFLTIAILAG--s...........
R7C6Z2_9CLOT/51-370                  .......................................................FSLQQYVTDVMD-GTADFSFGA.IVDCICEQVTGQWDAQKKTILHILALSVFAGIFVKFAGTIG.D.GDL.G...ETGFFVVFLLLFSLVLSGFLGVYAVAEKALESLIAFMKALIPSFSLTLCYGG........KMQSSLAFYEAMLLAMGLLSMAMKY........FLMPGVEIYF...FLSVINQMA.-..GHRFSKMVDLIGSILRMSIRILFAAMIGYQGIQGLLVPVMDRVRNNAVWNVAKG-MPGVGNTAGSVMDTVYGSGLLIKSAVGVGGVIAIVILCLYPMMKV.FLFTFLYRVAGAVAQP..V.S.DHRIV...MVLQSAATSGKLMLGY..LLA..SG..L..MFLLSIVIVLVST............
A0A161HVK0_9BACI/61-381              ...................................................sqkg----SLVQF-LQ-GQKEWSMKE.WLLALLKFLMYELQMNGKLLGTLILLTVFSMFLQSLQTAFE.Q.QAV.S...KVAYAVVYMVLIIIALNSFRLAMEYAHEAIQTMTHFMVAMVPLLLALLASSG........GLISAAFFHPIILFLMNTTGVVVQY........VTLPLLFLAA...LLGIVSTMS.E..HYKVTQLADLLTKIAVGTLGAILTVFLGVMSVKGTTSAVADGIALRTTKFVTGNFVPVVGKMFTDAADTVVTASMLLKNAVGIVGVALLLMIVIFPALKI.FVIAFIYKLSAAVLQP..L.G.GGAII...SCLNVISKSITYVFAA..LAI..VS..L..MFFLSLTVIITAG............
R5V356_9FIRM/53-373                  .......................................................MDFEKMVNKLVTEGTDGLDAGM.ICEYIADLFFYEITAAKPMFLQMFAIGLLFALYGKVM-MTR.Q.GYV.S...QMSFFIVYLGVVLLLLQSFALISEVVDQGIDRLVAFMTAFVPLYAATLFCSG........NAASAGSFYQLAFGLMYLLELGMKF........IFLPGVHVFV...LLLLMDNLF.E..ETKLGKMAQLFEDGIRLVLKGGLTAVMGIGVVQSLIVPARDRLSTNSIFNSISA-VPGVGNTFGSAAEILLGSGILIKNSIGAAALILLLVIGMTPLLKS.FCFSVMYRLTAAFLAP..V.A.DSRIA...QCVQAAARGCALFCTI..QLD..AL..L..LFFITTSIISVS-t...........
A0A0U1QS78_9BACL/56-376              ..................................................etean------FKDLLH-SDKESFFKK.MIDGSVRFFLNELVVSSKLLGTLILLTVFSTLLQTIQSAFE.H.KAV.S...KVAYLVVTLVLMILMLNSFRLAINYTNETVGMMSHFLVALLPLVLGLTAATG........GFASVAFFHPLVIFLVNAAGWLISS........FVLPLLLMSA...LLAIVSTLS.D..HYKLTRLSDLMKNVALFTLAGFFAVFLGVISVQGAATSISDGLMVKSAKFFTGNFIPVVGRMFTEAADTVMGASVLLKNTIGIVGLLILICITVFPLLKI.VSLAFIYNLAAAVLQP..L.G.GGPVI...DCLVIMAKSIFYLFAA..LAV..VS..L..MFFLAITIIIASG............
A0A0D6ZA92_9BACI/72-392              .................................................sqkgsl-------YDFIN-GEKKFSLNG.WFKGIMNFAFHEFIVNGKLLGSLILLTIFSMFLQALQNSFE.K.STV.S...KVAYSIVFMVLIIIALNSFHVVVEYTNDTIGTMIQFILALIPLLLALMATSG........GLVSAAFFHPIILFMMNTSGMFIQY........VVLPLLFLST...LLSIVSILS.E..HYKVTQLASMLRNWSIGLLGILLTVFLGVISVQGASAAITDGVTVKTAKFITGNFVPVIGRIFTDATDTVISASMLLKNTVGIAGVAILLMIAAFPAVKI.LMIAFIYKFAAAILQP..L.G.GGPVI...TCLDTISKSIIYVFAA..LGI..VS..L..MFFLTITVIIAAG............
A0A1H0GR52_9BACL/72-392              ..................................................sktpt------FMELLL-GTKGISLKN.IFKGLLSYLFHEIIINGKLLASIVILTIFSMILETLQSSFE.R.NTV.S...KLGYSITYMVMIIIAINSFSIAIGYAKTAISSMIQFMIAIVPLLLTLLASMG........NVTSVAILHPLIVFMIHSVGTAIYV........FIFPLLFFSA...VLHIVSSLS.E..KYKVTQLANLLRTISLSMLGVFVTVFLGVISIQGTAGAVRDGVAIRTAKYITGNFVPVVGRLFSDATETVIGASLLVKNAIGLVGVVILIMLCAFPAIKI.LTLAFIYNLSAAIMQP..L.G.DSPII...ACLQTIGKSLVYVFAA..LAA..VS..L..MFFLALTIMITI-s...........
A0A0T6BTX0_9BACI/71-391              ..................................................sqkgs-----LLEF-IK-GEKHFSPEE.WVKALFSYLFHEVLANGKLLGTLILLTIFCVLLQLLQNAFQ.Q.STV.S...KVAYAIVYMVLIILALNSFRVAVTYANEAIQSMTSFILSLVPLLLALMATSG........GAVSAAFFHPVILFLMNTSGLFIQY........IVMPLLFLSA...ILSIVSTMT.E..QYKVTQLSQLLRNAAIGTLAAFLTVFLGVISVQGASAAVTDGITLRTAKFITGNFIPVLGRMFTEATDTVISASLLLKNTVGILGVAILICIAAFPAVKI.LTLALIYKIAAAVLQP..L.G.GGPVI...SCLDVISKSVIYIFAA..MAI..VS..L..MFFLSLTVIITAG............
F8I906_SULAT/51-374                  ......................................................t--LTDIVKA-LSTHQMPFDPRQ.LIAAIGRQLAGDLRTESRVLGIIFLLTVLAAMLQRLADAFE.G.KDA.SglvGLSRMIVLSAILLVALRSFSIAVGMVEGVVGNLVHLMESLIPLLLVLLAGSG........AIASAGIFHPLMMAVTNLVAVLTKR........WVLPLVLFAT...VTELVSQWL.P..KYSLKNLGSLFRQVGLTLLGGLMTLFIGVMAVEGAAGAVADGVTLRTGKFLANTFVPVVGKMFSDAMEAVLGSSLLLKNAVTVLGALGIIVLVTFPLIKL.FLMMFLYRLGGALSEP..L.G.VSGVG...DTLNVMANALGWLIAI..AGA..VA..L..MFFLVITVVVGTT............
R7GVS5_9FIRM/36-346                  ...................................................ssfl----------------DLQFLD.ILSAFFQDAVEKAEAPFQLFGILLILILFTAVLQSVGGIGL.Q.KQT.G...PIYEMVCVLAAALVLGQPLSACFLSVKDTLQQGASFMMTFVPVFAGILAAGG........HTGTAVCYQAAVCGLANCIMQFLAG........ILLPLLSMTF...AMSIVDGVN.P..SVSLGGFIRAVKRVTIWLLGLCMAIFLGVVSMQSFVGGAADSAATKAAKYVVSNFVPVIGGAVSDAYSTVRGSLGILKSATGAIGMIVLCLLFLPVFLHV.FLYRLVVTLAAATAEL..F.S.VPQLA...RLLRNTEQVLSITFAV..VTC..FA..M..MFLVATAIVIGL-s...........
A0A285CK45_9BACI/70-390              ..................................................sqkgs-----LVDF-LK-GEKEFSLDA.WFHAFLRFIFHELIVNGKLLGTLILLTVFSVFLQSLQNAFE.S.GTI.S...KVAYAIVFMVLIIFALNSFHIAIEYTKDTIETMIHFTLSLVPILLALMAASG........GVISAGLFHPLIVFLMNTSGIFINV........IVLPLLFLAA...ILSIVSTLS.D..QHKVTQLAQLLRNWSIGLLGIFMTVFLGVISVQGAATAISDGIAVRTAKFLTGNFIPVVGRMFTDAADTVINASVLLKNTVGIVGVVLLLVIAAFPAIKI.LIIAFIYKFAAALLQP..L.G.GGPVI...QCLDIISKSMIYIFAS..LAM..VS..F..MFFLSVTIMIAAG............
S0FTV6_9FIRM/97-418                  ......................................................f-DPEKIIAGAAK-GNFDLSVKG.ILDRVVKYLLEEVFLNVDILFKIVVLAIICAVLKNLQNSFL.G.ESV.G...ELAFFVCYIVIVSVLMVSFSSAMKMCMSIIDSMVTFMHAIIPLLITLLVSAG........NFTSAGVFQPILIMLVEVGATVIKN........FFIPLIFLVT...VLNIVNNIS.D..KVQLTKLSGFIKQICTWGLGLILTVFIGIVSIQGSMGAVVDGVTSKTAKYALGTFVPVVGKYLADAADTVVGCTLIIKNASGLITMIGIIIICLAPLLKI.LAVIILYKLACAFVEP..I.S.DKKIT...NCLNDMAGSLTYVLGV..TAA..VA..V..MFLIVITVVISTT............
A4XLC8_CALS8/45-364                  ......................................................n-DIRDYIDGILS-GRK-LN-ID.VFRLIKDKLFSEIDATLKQIATILVVTLIYTLIYSVQTSLK.N.QGL.G...KATFLAFFLTLSTIVLQNLKDILLYANEVIQKGNSFVEAIFPILISTLATMG........YATYAASLSPKIVFALVFSSEFLKN........IILPIVNVYI...VISILSNIDgG..RFNLRRLLSFLKTVLLWSIVIGLVVFTGIVSIEGFTGATVDNLVAKSIKYTVGNFVPFVGKILSDAADTLAGSLGIIKNTISVVGLLTLLFIVGVPLLKI.LIISLLFRLTAAFVGI..I.S.DSRFA...QFLDDYADNILLIFSI..VFA..SL..L..VFVVTFSTVL---fi..........
A0A1G9CVM4_9BACI/69-389              ...................................................lqkt----TLVEF-IK-NKESLSFKE.WMQGIAKYLFHEVIINGKLLGMLIILTLFCVILQTLQSSFE.N.QNI.S...KIAYAIVYLVLIVLALNSFHSAASYAKESIDMMSGFMVALLPLLLGLMASFG........SLAAVSFFHPAVIFLIHISVLLIST........IVLPLFFLSA...LLSIVSTLN.E..NYKATQLADLLKNIGIGLLGVFLTAFLGVISVQGAASAIQDGIALKTAKFVTGNFIPVVGRMFTDAADTVLSASLLLKNAVGLVGVFVVLGIALFPAVKI.FVIALIYKLASALLQP..I.G.DGPVI...ECMDSISKHIIYIFAA..LLI..VT..L..MFFLAIVILVAA-s...........
A0A1K1LPP0_RUMFL/47-362              .............................................dietnsdeis----------------ALSFGS.FARTIAAKVTDSETSPFKLLGTILLVIVLSALLKSAGS-IG.F.KGS.A...DIYGLVSVLTAVTVISPQLFAAFSRASEAVNVSGGFISVFIPVFSGAAAASG........HMTSAAVYDVAVLAASELIVQLVSA........FLMPVLSAAA...MLSITGSVF.T..QNDMSGVVQLLKKVITWGMTITMTVFIGFVTLKCSLAGKTDGAATKAARFVISGSVPVVGGAVSDAYAAVRSSFDLIRGTVGTVGCIAVTFIVFPPVIQL.MLFRFVMWIGASAAEL..F.G.AEHMK...KLLSSFDSALAIAQSV..LAC..YG..V..MFVLCTGILMH--ta..........
A0A1B8UN05_9BACL/98-418              ....................................................amp----DFVDLLLP-GGEKLTVSN.VFKAIGKFMLQEVFMNGKLIVTIVILVVFSMVLETLQTAFE.R.NTV.S...KIAYTISYMVIIILAINSFQIAIGFAKEAISSMINFMMAMVPLLLTLLASMG........NVVTVTVMHPLIIFMVHLVGTLIYV........GVFPLLFFSA...ILHIVSSIS.D..KYKVTQLANLMRSISVGLLGVLLTIFLGVISVQGATSSVTDGVSIRTAKYITGNFVPVIGRAFSDATDTVISASLLVKNAVGLSGVIILLFLCAFPAIKI.LTLALIYNASAAIMQP..L.G.DSPVL...GCLKTIGKSMIYVFAA..LAA..VG..L..MFFLAITILITAG............
R7FTX0_9FIRM/48-362                  ...............................................aeasdvas----------------AFDAGW.LLKTILSILSDVAPKAVSSVVTVLGILIIASVLAVVRDTTA.S.GTL.K...NVLTYVCSVCICGASYGLIGGLIGMVSEFTGRMGEFLRYVLPALGALMASEG........AITASSVGCAVVYGAVALLEKLTEG........FVFPMIKISF...CISVGAVAL.G..NDGLSGISATVKKLVTSVMTLTMIAFSCVLTFQSIVARSADSVLFKGVKFALSNIIPVVGSAVGEALTAVTGSISVLKSAMGMIGAVAILLIFLYPFCTL.WANKVAFELLSSTAGV..L.G.LSREG...KFLSEMSSVTGLMMAV..ISS..ST..V..FFIIAMAIFASS-g...........
H3SFE4_9BACL/88-408                  .....................................................sl---PDFVDLLLP-GGEKLTTGA.VLQALGKFLMQEVILNGKLILTIVILAVFSMVLETLQSAFE.R.NAV.S...KIAYAVSYMVIIILAINSFHVAIGYAKEAISGMIHFMMAMVPLLFTLLASMG........NLVTVSVMHPLIVFMVHLIGTLIYT........GVFPLLFFST...LLHIVSALS.D..KYKVTQLANLLRNISIGLLGVLLTVFLGVISVQGATSSVTDGVTVRTAKYITGNFVPVVGRVFSDAADTVISASLLVKNAVGLAGVVILLFICAFPALKI.VTLALIYNVSSAIMQP..L.G.DTPAA...ECLKTVGKSMIYVFAA..LAA..VG..L..MFFLAITILLTAG............
R6DNF8_9FIRM/55-367                  ..............................................tadfdsmfg-----------------VTPKK.IWSLTKKLITGNIEAPTRSVVRLIAVIILIAIFECFAP--E.D.TKI.K...TVVGIVGTLLCIISVISPLSTAISSAVSSIAVGEKLMLALIPVLAAVVTATG........NPTLAASFQSIAFAGAQIISGISNG........YIVPIVGAVM...ALDITGSIM.P..SFKLGGITSLIKKTVTAVLTFVSTLFVSFLGIKGALANAADTVASKGIKLVISSAVPVVGGALSEAYSGIIGSLVLVKSTIGIFGIAAVALINLPSCLQL.LFWVFALRFSAAIGEL..F.N.QQNIA...ELLRALASSLTLLNVV..LLF..NA..V..LFIISTALILV--ik..........
A0A1W2CKR6_9FIRM/49-367              .......................................lmdgaeidqgedlggg-------------------IAG.ILQNAGRELESILKGSLRSGVLLLSVVLLCAVAGSLYEGTA.S.KTA.A...NFVPTAGTLAVTAIAVGDIHTLIGLGLETISQIENFSKVLLPTLAAATAASG........SVGGAAARQMATVLFSDVVLTAIDR........LLMPLVYAYI...AAQAANAAI.E..NNLLGRVAGMLKWAVTTILTMLLICFTGYLTVSGAIAGTADAVTIKAAKFAMSGAVPVVGGIISDAAETVLVGAGVLRNTVGVFGMLTILAICIIPFLRL.GVQYLMYKLTAAMAGT..V.G.DDRVV...RLIDGIGGAFGLVLGM..TGA..CA..L..ILLISIV------ssvka.......
A0A075KGW6_9FIRM/60-379              ....................................................nsd-----TIHGIAT-QGLNVSWQH.LRQSIIANFFHEITVSTHLMGKLLFLAVLCAMLQNLQNSFE.K.SSI.S...LLAYSVCFIFMSSIALTAFYNTLKLASQTVGYMVGFMEALLPLLMSLLAGVG........AITSASLFTPLMLFVISSMSVIVKD........VVLPLLFLTA...ALECLNFLS.D..TYRLSNLASILKQSGMIILGFSMVIFIGVITIQGTAGSIADGLALRTAKFATATFIPVVGKMFADTVELVMGASLLLKNAVGIFGIIVVSMICILPLIKI.LSLILVIKISGALVQP..L.G.DEKMA...KCLDSIGNNLFLVFGA..VLT..VA..L..MFFLDITMILAAG............
A0A101XSJ8_9BACL/97-418              ....................................................isq---GQLVSS-FTPGATSFPLIS.QLQGLLRYFFYALYSDTRLIGSIVVLTVLAAILETMQSAFA.S.ESV.S...KIAFFAVYLVLFVIALSSFHVATSDANQAIGTMTSVMYGSLPVILSLIVASG........GLTSAAAFHPLIIFIVNTMSVIVQH........LVMPLILFTT...VLSIISVLS.K..QYRVSELAGFLRTTALTILGVGLSAFLGIMSVQGQLARVADGVSLRGAKYVASNLIPIVGKALSDASESIAGASILVKNATGFASAVVLLLICAFPAIKI.LALSVIYNVSSALLQP..L.G.DTPII...SLLSTMGKSLTLVFAA..LAA..VG..L..MFFFSLVIAIST-t...........
R5Q7A8_9CLOT/1-88                    .......................................................----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..----------------------------------------------------------------------MSCSNILKNAVGIVGVVIIISICIVPIIKL.MALMGVYYLGSALCQP..I.A.DEKIV...KLLEKIGATFKLLLAI..MSS..VS..V..MLIIGITLVIKI-s...........
A0A1X9MH05_9BACI/66-350              ...................................................sqkg-----TFMEFVS-GEKQFSMKE.WGVGLIRFLLHELLVNGKLLGSLILLTIFCMILQSLQNAFE.Q.HTI.S...KVAYAITYMVLMIIALNSFHVAITYAADAINNMIHFMIALLPLLLAMMAAIG........SVTSAALFHPLIIFLVNTSGLLIQH........FVLPLLFLSA...VLSIVSTLT.D..HYKVTKLANFLRNFAVGTLGVFLTIFLGVISVQGAATSVADGITVRTAKFIAGNFVPVIGRMFTDAADTVLSASVLLKNTIGIAGLGILLMLCAFPALKV.LSLAIIFNLSAAVLQP..L.G.EDR--...----------------..---..--..-..-------------s...........
A0A101VQD8_9FIRM/64-383              .......................................................FSLSKIFED-LRNGELSLMPDD.IGLSILKAILKEVVVNGPLIAKLLVLAVICAIINQLQLAFI.-.GNV.S...RFAQMLVYLVLLGLVITSFSMAVEIGNNAIDKMVSFMQAILPVMFTILIAMG........NITSAALFKPVIMGSLVFLATVMKN........VVLPLFFLSV...VLRLFNNIS.P..HFKLSKFANLLEFGGKLSIGIVLTVFMGIMTMQGVTGGVADGVTLRTAKYSVDL-IPVVGKFFKDAVEIVIGSGLLLKNALGVVAMLAIILIILAPVIKI.IAMMFTFKIAAALVEP..L.G.EKDLA...DSLQDMSKGLLYIFAA..VAS..VG..M..MFFLTITIIIGAG............
Q0AZG6_SYNWW/67-387                  .....................................................kt--VKELLLD-FSQGQLDLKIQD.IMGGILQLFFKEVRANSGLMAKLLVLSVLTALLVNLQNSFS.-.SGV.A...QISYLSCYLALGAIALGSFRLVLEIGHQSINNMVAFMMGMLPQMLVLTAGLG........NINASAMLFPILMTTATAFANAIKN........VVFPLIIMSA...ILSLLNHMS.I..SLKVEKLASFFGQMARVSLGFCLTIFAGFITLRALYASVLDKVALRTTKFVTDNAIPVVGKILSDTIEVTAGYVVMLKQALGFLGVLIIIGIIALPLIKV.AAIALIYKITAAVVEP..L.G.DAKTA...AILDIMSAHIFLMLAA..LAS..VG..L..MFLIMISIVAGM-s...........
R9JDN7_9FIRM/56-376                  ......................................................l-DMKGVWKSIVQ-GKIIEAAEI.LWDGIKGKLVSELAGMKNVFASILILGIVSALFANFSDVFQ.N.HQI.A...DISFYFLYLLLISVLMKAFLAAADIAGQAVGNIVLFIQMFIPTYFIAVGAAT........GAVTGTVYYQFTLVLAYGVEKIIFS........FLIPLIYSYV...LLALMNGIW.A..EERLTLLLDFLKKGIGAVMKVAMGAITSLSLFQSMIAPVLDSLRTSAVRKAIGA-IPGIGNLAEGVTEMVIGSAVLIKNSIGLLLLLLLLAVCLIPLAKL.LLIAGIIKGSAALVGI..V.S.DKRVS...GCTDRVGDGSLMLFKA..AFT..AV..S..LFMITIAIVAYT-t...........
A0A1U7LXQ1_9FIRM/1-92                ....................................................mwl----------------------.----------------------IFGIGAIVFALLNVTTAIK.N.KNA.E...RYRFLSLSLTALTVCAFYFDGASRVIKEDWSGLMDIMPTMSKALWVLVILSI........AVNSVSIFKK---------------........----------...---------.-..----------------------------------------------------------------------------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------krl.........
A4IQS8_GEOTN/61-380                  ..................................................ekgsl-------ADFLS-GERQWSPAE.WLKALTRYLFYELQVNGKLLGTLILLAVFSTVLQSLQNAFA.Q.QEV.S...KIAQAVIYMVLLLIALNSFRLAADYALGAVQTMSHFIIALIPLLLALLASSG........GVVSAAFFHPIILFLMNTTGTVVEY........VTLPLLLLAA...LLAIVSTLG.D..RYKATQLADLLNKVALGLLGIILTVFLGVMSVRGATTAVADGVALRAAKFVTGNFIPVVGKLFTDAADTVVAASMLLKNAVGLVGVAILLMIALFPAVKI.FAIVIVYKLSAALLQP..L.G.GGPVL...SCLNIISKSIGYVLAA..LLI..VS..L..MFFLSLTVMVMAG............
A0A1U7PMA0_9BACI/5-292               ......................vhtaaapvirlfqavlvlcaaglvadflfpafr----------------------.-----------------------------------------.-.---.-...EWTRVLLFIAAGTMALGPAVEALRLLDGLTGKMAGLFLGVYPLLTAGMASAG........GALTIAGWNPAVFLFVQGAVVFGGK........WLIPLLTASF...LFDYLSRLV.P..DVPFTRMAEMIRVTVIGAVSVIAACYTLFITSTGIMAWAGAGAAGEPLKVLLRQNIPLVGSFVTDALGVFGKYSAGTAAIAGSWLIGTILVICLIPAAQV.LLTAFFYKWLAALSEP..F.A.NEELS...GLFDDLGKTMFVLCGI..TFI..IA..F..AVFYTVLLAV---ili.........
A0A1Y4U482_9FIRM/76-396              ......................................................l-DFGETVRAVIT-GDLSVSADL.LGRLISDQLFHALEVNRESLIHMLLIAVVAAMFANFADVFQ.A.RQI.S...EISFYILYMLMIALCLGAFQSAAAWVEDGISLLTGFMKALCPVYFIAVSLAK........GSMTAAAFYNLALLVILLVEVFMGK........LLLPALHVYM...MIKVLNYLS.Q..EEYLSRLIELMETLVSWTLKTLLALVIGLNTIQGLLAPAVDSVKRSVLTRGVEA-IPGVGDAIGGTAEVILGTAVVVKNGIGIAGVIICFALCVVPLVQA.AVMVLMYKLAAAVLQP..I.S.DKRLV...GCIGGMADACQLLMRL..IFT..AG..M..LFLLTVAIVAATT............
W4V491_9FIRM/2-142                   .....................................................di----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..-------------------RLILTVFVAIVSLQGSLGAVVDGVTSKTAKFAISAFIPVAGKYLADAADAVIGCTLLIKNAVGVAIMIGILVICLLPLLKM.LAVILLYRMSCVLLEP..L.A.EGRII...KCISDVANSMTYILGI..AAA..VA..F..MFLMTITALILA-s...........
R5TYT9_9FIRM/79-398                  ......................................................l-TFRELVRQLMQDGEY-TDKRT.LVRQVFDRAFGDVAEGKQLFVQILILTAACSFLQNFIHVFE.N.SQI.S...KTGFYLYFLLLMGLLLRSYLLIHGILEDVLGQVIDFMEALLPAFCMTMVFCS........QKVTAVGFYQLSLIVIYLIDRVLLY........IVIPAIHVYV...VLQMLNCMT.E..EKLISRMTVLLKRGLIWVMRLLLAGVTGMNVIERMIAPSVDNLKKMSVTQTISM-LPGLGNTAQAVGNIFFGSAVVIRNGIGTAAMIVLVCLALGPLLKM.LVFSVFYKVAGALSEP..F.S.DKRIC...GCIDCVGDGALLLFRA..LGT..GI..L..LCMITIAVVVT--a...........
R6KTY7_9FIRM/83-402                  .......................................................FSMKDALIK-LTKGEQAFSKEA.VQGVVYRFFFYRLEQERGLLVKLLLLVLFAAVFSSFADVFE.N.EQV.E...NISFFVVYLLVFTLLTDSFSEMSLSLEKTIDWMTEVMKGLAPAFYMTVCASS........GAASAAVFYEGVLILVWLIQWLLAT........VILPASSLYV...LLQLVNSLS.K..EEMLGKMAEFLNTAISWSLKTLLATVVGLQIIRNLVAPVMDNLKRGLLGRAAGA-LPGVGNAVNMVTELVVTSAVLIRNCLGVVILVVFVLAGAGPMLHY.GVLSLLYRFLSAVSQP..I.S.DKRMV...SALSAMGEGCTLLLRI..VFT..AE..V..LCMLAFLVLMA--g...........
U2ALR4_9CLOT/46-366                  .......................................................IDFSSLLGQILS-GNAKEAFAG.LAASLKNGMLAEMAGMKNLLLTLLIIGVLSALFTVVMQSFD.N.HQI.A...DIAHFISYLLMLFVVLRTFTQAADIAGELLGRILLFVRLFVPTFMLALGLSA........GAATAAGYYQLILLLIYGVEQVLKS........IGLPAVNIYM...MLVVMNGIW.E..EERLGMLVELLQKGVAGFLKFLLTCITGIGLLQSMVTPVLEHLKLNAAGKALSA-IPGLGGLAEGTAQLLIGSAVLVKNGLGVAAFLLLLALCIGPFARL.LLYAGILKLCAALLGM..T.A.DKRIT...GCVNKAGDGLLLLLKI..SYT..AC..A..CFLIMFAIITC--la..........
A0A1M6LMI0_9CLOT/68-389              .......................................................INIKSMIISMLK-GNTRYQLNE.IIKNIIKLLFKEIVINSRLLAQLIFISILCALLKNLSNSFG.G.SIS.G...EIAFYGCYLIIMGLAVKSFMVAMHVGQVAIDNMVSFMQALIPVLLTLLVAAG........SLTTSAIFKPIIVASIGITSTTMKD........VVIPLVLFTA...ILSIINNFT.S..KVQISKLSSLIKQGCIALIGLILTVFLGIMSIQGVVTSTSDGIAMRTAKFAVDSFIPIVGGFMSEAVDTVLGCSLLLKNAVGAVGLILLLIIVSYPIFKI.VSIMIIYKIAAALVEP..I.S.DSKIV...NCLNDMSSAVTVLFAT..VIS..VT..I..IFFIGVTAIIGA-a...........
A0A1W6WDR2_9FIRM/74-387              ................................................snfqsvg----------------DINPKT.FFSAVFGLAGTEGKGPLHAAGSCLGIILLCALVNSMKLSFG.D.RPL.G...GVADVVAALCICVGIVEPVINVLVRASSVIHTACGFTLASVPVGAAVLAAAG........RPASAASMQLLLTTAGNAVQLLSAC........VFAPAMKICL...AMAIVSSIS.P..DVNLLGLFRCFSKAVKWLLGLSMTLFTGILAMKQLTADGADTLAGRAARFVVSSAVPVVGGTLSDAMNTVTGCIQMLRSGVGAFILLALLVMFLPVLISS.LLWMMMLQICAAVSKV..F.S.LQEVA...GLLQACSSVLEILLAI..LLC..SM..T..VLIVSSTVLLNM-g...........
A0A1G6B3R3_9FIRM/62-370              ..................................................dsvsg-----------------LSIGS.ILSGIFKLFVGDLSAPAGMLGKLLAAAVLCTLAQSLS--VG.R.SDL.T...DIYRMLGALAAVLAVTDGISQCISVTVDCLNRLTVFMLSYIPIYAGITSASG........SLAAGTSFYGTNLFLCECITFAAKS........VITPLLSILT...AISAVGAVN.P..DVKLWNAAAAVKKAIYWLIGIMMTVFTGVLTIQNAVGSAADSARSKVIRYAASSFIPIIGGSVSETYSAVKGSLGIIKAGTGSVGVLIIAVIVLKPFLML.LAARAVLALGKLCCEI..L.G.QDGMA...QFAAAINSILAIAMSI..IIT..VS..I..MFIISTCIIMLT-s...........
A0A1V2MDE8_9FIRM/63-386              ......................................................f-NLKNEISLILS-GQKEFNLAV.MLEFIKDRILGEFFMYISVIVRFILIVLLCHLLNHLSSAFE.S.KNT.T...KIAFFVCNIVILYSIMESLVLIVEVAQNTINTLQGIMLIMLPTLLAFMATSG........YIATSAALSPVIIGALNLMVFIIQT........ILLPSVVIVI...ILQIINNMS.EtaEFKFNKFIALYYRVSKWALRTIFVLSLTIMGLYRMSLPFTDATMKKVGLTLSTKFIPILGNAVSGAVDIIIQISGMIKNAFGIGVIILIVLVIATPLLKI.FVYICMFHIAGAFIET..M.G.DKKMS...KTATDIGKGCEFIMSC..VGV..VS..I..LSILTLVVCMSV-g...........
A0A235F900_9BACI/81-401              ..................................................sqkgs-----FM-EFVK-GEKNFDLKQ.WAGGFVRYMFHELFVHTKLLGTLILLTVFSMLLQTMQNAFN.Q.PAV.S...KAAYGVIYLVLVILALNSFHVAMTYAQETIDEMMGFMIALLPLLLALMASVG........SIAAAAFFHPVIVFLVSTSGLLVKN........FVLPLLFLSA...LLSIVSTMS.E..HHKVSQLASLLRKVAAGTLALFFTVFLTVMSVQGAATAVTDGVTIKAAKFVTGNFIPVVGRMFTDAADTVMSASVLLKNTVGIVGMAMLLIMAAFPAIKV.LALAFIYSLAAAILQP..L.G.GGSII...ECLSIIGKSVLYIFAS..LAT..VC..I..MFFLAVTLIVAAG............
A0A265ND71_9BACI/63-383              .................................................ldktsl------YE-FIK-SNGELSLKS.VFSGFLKFLFHELILNGKLLGSLIMLTLFSIILQTMHNAFE.K.SAV.S...KIAYFVVYIVLIFIALNSFYLAVSYTKEAIDTMSSFMIALLPLVLGLMGTFG........SVISVSFFHPIILFLIPLSGVLIST........FILPLLFLSA...LLLIVSSLN.D..NYKVTHLANLFKTVALGTLGVFLTIFLGVMSVQGAASAIQDGVAMKTAKFITGNFIPVVGRTFTDAADTILSASLLLKNAVGIVGLIFIVFLALFPAIKI.FAIAVIYKIAAAVLQP..I.G.EGPVI...TSLNTISKYIIYILAC..LLA..VS..F..MFLLAIVIIVAAS............
A0A1M7M2J2_9FIRM/66-386              .......................................................FDFKDYVGKLISSGE-GISAKG.AIGDLFTAFTKEFDANRSALFKLIMIAIVAAVFTNFTNVFN.N.NQV.G...ETSFYITYLLLFTTITGTFATATAVASGAISAVLSFMKALIPTYFMSIAFCS........TKATTLVFYESALVLITIVDVVLVR........VMIPLVNIYM...VITLVNNLA.K..EDFLSKLAELLESIIKWSMRTLFIAVVGFNTIQGLIVPASNSLKKSLAIKFTKA-IPGIGNSLNSVAETVMGAGTLIKNAIGVTGLVVIVLICVIPLIKL.IITMLIYKVGVAIVQP..I.S.DKRVI...TCISGAANAAGLLVYV..VSI..AA..V..LFMVTIAILAATT............
A0A229UXL2_9BACL/79-399              ..................................................nktpt------LMELLT-GTKQIDMSS.IFSAIFRYFFHELMYNGKLLASIVVLTMFSMLLETLQSSFE.K.NTV.S...KIAYAITFMVLMIMAINSFSVAIGYAKTAISDMIHFMVAVIPLLLTLLASMG........NVVSVSVMHPLIVFMIHAVGTAIYL........IVFPLLFFSA...VLHIVSSLS.D..KYKVTQLANLLRTISVGCLGVFVTVFLGVISVRGASSAVADGVTIRTAKYIAGNFVPVVGRMFSDASETVIGASLLVKNAVGLVGVVIILMLCAFPALKI.MALAFIYNISAAIMQP..L.G.DNPMI...ACLETIGKSLIYVFAA..LAV..VG..L..MFFLAITILITAG............
A0A1Y4FDB4_9FIRM/71-390              .......................................................FDLEETIRGFMT-GEVPFTKEA.AGQMLQQILFSQWDEEKGIFLQILLLVLAASLLGNLSRAFE.G.GQI.G...EIAFYILYLLLFVFLVESFSSLSLHLENRLLMIQTFMQALAPAYFIAVTAAS........GVSTAVVFYQMALFLIWLIQWALVN........LLLPTANLYV...LLKLVNYLS.K..EEMLSKLAELLKTFISWGIRTMLGIVIGMQVIQGMVTPIMDSLKRSALGKTAGA-IPGVGNAINAVTEIVLTSAVLVRNCMGVTFLVVLILWGITPIIRY.GITSLLYRLLAALVQP..V.S.DSRIV...GCLTTMGEGCSILLQI..LFT..AQ..V..MCMLTIAILTV--s...........
A0A1Y0IVG7_9BACL/81-402              ..................................................eikgh-----FLELILQ-GELGVVFKG.VLMGLLKFLFHELFLNSRLLGTILVLAVFAALLESMQTAFE.A.NNV.S...KIAHAICFLVLMILAVQSFAAATSYAKDAIQTMVDFMIASIPMYLALLAATG........GLASAAMIHPLIVFLINVIGDLIMY........VVFPLIFFSA...ILTLVSQIS.S..RYQVTQLANLLRGTAVWVLGVFFTIFLGVVSVQGAAGAVADGVSIKAAKYVSSNFVPVVGKLFSDAADTVVGASLILKNALGVTGAAVVLLICAFPALKV.LSLALIYNVSAALMQP..L.G.DSPII...RCLSTIGKSLILVFAA..LAT..VG..F..MFFLAITVIIAAS............
A0A1I6T210_9BACL/99-419              ...................................................nvps-----FAEMIMP-GGEGLKLTT.VLAGLLKYVLHEILYNGKLLVTIVILTVFSMMLETMQTAFE.R.NAV.S...KVAYSITYMVMIVLAVNSFNVAIGYAKDAITGMIQFMLAMVPLLLTLLATMG........SVVTVSVLHPLIIFMINAVGTVIYT........FVFPLLFFSA...VLHIASAVS.D..KFKVTQLANVLRNFSVGLLGVMLTVFLGVISVQGATGSVTDGVTMRTAKFITGNFVPVIGRTFSDAADTVMSASLLVKNAIGLAGVVIILFLCAFPAIKI.ITLALIYNVSAAIMQP..L.G.DSPIV...SCLQTIGKTLIYVFAA..LAA..VG..L..MFFLAITIVLTAG............
R7CH18_9FIRM/88-408                  .......................................................FSVREALMNIIN-GEDPVSKET.VRSFLYSLFFSDIENEKGLILKLLLVIFIAAVLAEFADVFG.N.GQV.G...SISFYIVYLALFTMLMENFSRLGSTLTNWLLGLTDFMKVLSPAYFMTVAAST........GSSTAAAFYEGILLMIWAVQWLLAN........LFLPAVNLSL...LLKMVNYLS.K..EEMLTKMAELLDVAVNWGLKTLLGAIVGLQIVRNMVSPVMDAMKRSAVGKAASA-IPGIGNAVTAVTELVLTSAVMVRNSFGAVIVILLLLIGAGPIIHY.GSLSLVYRFLAAIAQP..I.S.DKRVV...GALSTMGEGCAMLLKL..LLT..AE..V..LCMLTFLIVVV--sv..........
F7NJX4_9FIRM/61-379                  .....................................................pd-----TLRKIAD-QGLSLDWNN.LWREIGRRFFSEISQNLNLMGKLLFLAVLCALLQNLQSSFE.S.STV.S...LLAYGICFIFLITLVLAAFYQITAVTRSSVEYMVGFMQALLPLMMSLLAGVG........ALTSAALFTPFMLFVISSVSVVIKD........IVLPLLFLAA...VVDCINYLS.D..KYRISNLAGLIKQGGMIVLGLTMVLFIGIITVQGVIGGVSDGLTLRTAKFATATFIPVVGKMFADTVELVMGASLVLKNAIGVLGVLVIATLCFMPILKL.VSLIVIVKSTGALIQP..L.G.AEKMA...QCLENLGNNLLLVLGA..LLT..VA..L..MFFLSITMIIGAG............
R5YD18_9FIRM/66-386                  .....................................................ic--FQDIVETLMQ-GNLQETGMK.ILSYVKDQISYEFRANKTNLVHILFIAITAAVFTNFSNALQ.N.KQV.G...EISFYILYMLLITMSLNSFRIAISGIEEKMENILEFMKVLCPGYLLSVVFAA........GSSSALMFYNFILVLIYLVEIVVFR........FLLPIINLYI...MIQVMNYML.E..EEVLSEFAELVKKGIQWSLKSLIGIVIGVNVVQGLLGPAMDTLKKSAWTKSLTA-IPGIGNTFGSVTDVIFGTAVLIKNGIGMAGAIVIVGICLMPIIQT.ALLTFLYKLVAAMIQP..I.S.DSRIT...GCISSVSEGYELLLQI..IIT..TM..I..LFLITIAVVAAA-a...........
F5LLQ1_9BACL/75-392                  ....................................................psf-------SDLIT-GAKTFDFSN.LWKGALKYLFHEIVVNGKLLVSIVILTVFSMLLETLQTSFE.R.NNV.S...KVAFVVSYLVLLIIAVNSFQVAIEYANGAISSMIQFMIALMPLLLSLLASSG........GITSVAILHPLIVFMIHTIGTVIYV........FVFPLLFFSA...VLHIVSSMT.D..KYKVTQLAKLLQKIAIGTLGVFVTVFLGVISVQGSMGAVTDGVTLRTAKYIAGNFIPIVGRLFSDATETVLGASLLVKNAVGLTGVVIVILLCAFPAIKI.LVLALIYHICAAVMQP..L.G.DSPII...ACLSTIGKSMVYVFAA..LSA..VG..L..MFFLALTIMITAG............
K4ZFR9_PAEAL/96-416                  .....................................................sm---PDFVDLLLP-GGEKLTVSN.VFKAIGKFMLQEVFMNGKLIVTIVILVVFSMVLETLQTAFE.R.NTV.S...KIAYTISYMVIIILAINSFQIAIGYAKEAITSMINFMMAMIPLLLTLLASMG........SMVTVTVMHPLIIFMVHMVGTLIYV........GVFPLLFFSA...LLHIVSSIS.D..KYKVTQLANLMRSISVGLLGVLLTIFLGVISVQGATSSVTDGVSIRTAKYITGNFVPVIGRAFSDATDTVVSASLLVKNAVGLSGVIILLFLCAFPAIKI.LTLALIYNASAAIMQP..L.G.DSPVL...GCLKTIGKSMIYVFAA..LAA..VG..L..MFFLAITILITAG............
A0A1G9QU13_9BACI/73-393              .................................................sqkgsl-------YDFVK-GDKKFTFKD.WTQGILKFLFHEFVVNGKLLGSLILLTIFSMFLQSMQNAFE.S.STV.S...KVAYSIVYMVLVILALNSFHVVIEYTNETIGSMISFVLSLIPLLLALIASSG........GIISAAFFHPVILFLMNISGMFMQY........VILPLLFLAT...LLSIVSTMS.D..HYKVTQLAQLIRNWSIGLMGLFLTIFLGVISVQGASTAITDGVAIRTAKFVTGNFIPVIGRIFTDAADTVVSASGLLKNSVGIAGVAILLIIVAFPALKI.LMIAFIYKFAAAILQP..L.G.GGPVI...KCLDIISKSVIYVFAA..LGI..VS..L..MFFLSITVIVAAG............
F4A173_MAHA5/71-391                  ......................................................d--IGALLKDMLR-GRIPFDVWQ.IIKNLVSGLFKEVWQNIGLISNVLIIAIAAGILNQLQSSFD.S.KSA.G...EMAFYACYILIIMVVIQSFNQMMSYGQEALSNMVLFMQVFAPTMYTLLMASG........AVSSSVMFQPLMALLVGMVGTFVKD........VVLPLLFLSA...ILTLVNHIS.D..KAPLGKLADLLKNICSWALKLTFIIFSAVVIIQGITAGSFDSVSFRTAKFAVDNFVPVVGRALSDSMATVVSYSALIKSAIGVIGLIILASICLFPAIKI.AAVALVYKFAAALIEP..I.A.QPRIC...QCLNSIGDILIMLFTL..VFS..VA..V..IFFIAIAMLIG--in..........
R9BY30_9BACI/83-403                  .................................................sqkgsl-------YDFMV-GNKSFDLQG.FFHGMLQFAFHEIIVNGKLLGSLILLTIFSVMLQMLQNSFE.K.SSI.S...KVAYAIVFMVLIILALNSFHVAITYASDAISNMTNFILALVPLLLALMAASG........GAISAAFFHPVILFLMNTSGMLIEY........IVLPLLFLST...LLHVVSSLS.E..QYKVTQLANLLRNISIGILGIFLTIFLGVISVQGASSAITDGITIKTAKFVTGNFIPVIGRMFTDATDTVINASLLLKNTIGIAGVVILLLLVAFPAIKI.LMISFIYKFAAAILQP..I.G.GGPVI...KCLDVISKSVIYVFAA..LAI..VS..L..MFFLSITVIIVA-s...........
A0A024QAX8_9BACI/65-384              ...................................................ekts------VYEFIK-DQGSISLKN.ILIGFVEFLFHELILNGKLLGSLFMLTLFSIMLQTMHNAFE.K.STV.S...KIAYFVVYIVLIFLALNSFYSAVTYAKDAIDSMSSFMIALLPLVLGLMASFG........NVVAVSFFHPIIIFLIHACGLIISS........FVLPLLFLSA...LLVIVSSLN.E..NYKVTHLANLFKTVGLGTLGVFLTIFLSVMSVQGAASAIQDGVAMKTAKFITGNFIPVVGRTFTDAADTILSASLLLKNAIGIVGVLIILFIALFPALKI.FAIAIIYKLAAAVLQP..I.G.DGPVI...TTLNTISKYIVFILAC..LLA..VS..F..MFFLAIVIIIVA-s...........
A0A0B0HLJ1_9BACI/45-177              ................................................sqkgsfw--------QFIN-GEKQLSLSE.WLQAFMKFLLYELMANGKLLGTLILLTVFSLFLQSLQNAFS.H.HAV.S...KVAHAVVYMVLMIIALNSFHVAVTYAKEAIQTMTSFMIALLPILLALMASSG........GVVSVAFFIRLCCF-----------........----------...---------.-..----------------------------------------------------------------------------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------l...........
A0A161J763_9BACI/67-387              ..................................................sqkgt------FIEFVK-GEKDFSLKG.YMLGLLKFMFHELAVHGKLLGTLILLTVFSMLLQSIQNAFD.Q.SAI.S...KVAYGIIYMVLIILALNSFHVAISYATEAIDNMLSFMIALIPLLLALMATVG........SIASVAFFHPVILFLVNTSGLLIKN........FVLPLLFLSA...LLSIVSTMS.E..HHKVTQLAKLLRNISMGALAFFFTVFLGVMSVQGATAAVADGITIKTAKFITGNFIPVVGRMFTDATDTVMSASILLKNSVGIIGALLLLLLAIFPAIKV.LILAFIYSMAAALLQP..L.G.GGPIV...ESLGIIGKSVMFIFAA..LMT..VS..I..MFFLAITIIIAAG............
D9TQB4_THETC/59-380                  ......................................................t-DVKTYIINVLN-GKETFSIKD.IISNILKILFNEVKSSLDIFIQLLLLAIISAVLTNLENSFG.N.DGI.S...QIAHIAVYAVLVIVAIKSFTSILNIGRDAIDSMVNFMQAILPILITMLASVG........AFASASFFQPALIMVVEFTAKEIKD........FILPAILFMT...VVKVISRIS.D..KFTLDKLADFFKTICTAAISILLSIFIGVITIQGITSSIADGAISRTTKYAVGAFLPVVGSILSDSIDTIMSASLLIKGAISTFGLISIIFIAIIPIIKI.FSVMLIYKFSAAVIEP..I.A.DKKIV...DFICDLTTSIAYVFAA..LVS..VT..V..MMFLSITAVINA-s...........
A0A1M6L591_9CLOT/74-396              ......................................................l-DVEEFVEGLNDKDGFDLEKNK.IIRAAKKVLLKEIAETGKLMGVIVVIAIVCSLLKHLQDAFK.E.NRV.S...DIAYFTCFASMIVVISKSFYISISIASNAVNGISDFMYAIVPVMIVLFASIG........NVTQAIFMDPILIASINICITIISK........VIFPMITLSF...VLSFVNNLS.E..DYKIGRLSSIIKSSVLWIQGIMMTIFVTILTIRSIASATMDDVTIKAAKFAVDSAVPVVGKTLSDAISTMAGYTLLLKNSIGTLGMVVIILVMLSPIIKL.FCISGIYKVTGALLQP..I.S.DKRLT...DSIDSVGNCITLILAC..VIC..TT..V..MTFIMVAVLTAT-g...........
A0A1Y4RV07_9FIRM/45-281              ..........................................qsvdlavgtglee------------------GLES.LLERFGSLIGGSVGRAVRSGVLLLVTAALCGLAREVGESLG.Q.PGG.L...DAAALTAAVAVTAVAVSDVRSMVGLGREALDGMNQFSQVLLPTMAAAAAAGG........APSTAAARQLATVLFSDLLLTAIDE........VLLPMVYAYV...AVCAAHAAL.G..NDGLKRLASLLKWGVTTALTAILLVFVGYLTVSGAIAGTADAMALKAAKMTISGMVPVVGGILSDAAGTLLAGAGV------------------------.----------------..-.-.-----...----------------..---..--..-..-------------l...........
M8DJW4_9BACL/68-387                  .................................................qapgfl-------QLLMQ--QGDFSLSG.FLKGFGKFVFHEILMNGKLLSSIIIITVFAMILETMQNAFE.R.NTV.T...TVAYSIAYLVLMVLAINSFHVAITYAKEAISDMSDFMLAMIPLVIALLASVG........NLASATMFHPLIIFLINTSGILISY........VIFPLLFLSA...MLSIASLFS.E..RYQVTQLASLLRNIAMGALGSFLTIFLAIISIQGATSAVADGVTLRTAKYITGNFIPIVGRMFSDAADTVLNASLLVKNAVGLAGVLILLLLCAFPALKI.LILAMIYNLSSAVLQP..L.G.NSPII...AALGAIGKNLIFVFAA..LAT..VG..L..MFFLAITIIIAAG............
A0A1Q5XNW1_9BACL/89-409              ....................................................ktp----SLMDMLLP-GDNGLSFKS.VMSGLTSYMWHEVLFNGKLLVTIVMISVLSMILETLQTAFE.R.KSV.S...KIAYMLCYMVVLVIAVNSFNVAIGYAKDAIDHMSDFMMAMIPLLFALLASMG........NIVTVSVTHPLIVFMIHTVSTLIHT........VIFPLFFFSA...VLHLVSAMS.E..KYKLTQLANLLRNVGAGLLGVLLTVFLGVISVRGITSSVTDGVTLRAAKYITGNFVPVIGKMFADATDTVISASLLVKNAIGLSGVIIILFLCAFPAIKI.LVLALIYNVAAAVMQP..L.G.ETPIV...TCLQTIGKSMIYVFAA..LAA..VS..L..MFFLAVTIMLTAG............
R7R722_9FIRM/32-352                  .....................................................vh--IVDMMQEILQ-GNWVMEPMM.FWKYIHTYILGYTTEWKKLFISILVLFILCSVITSFLGAFQ.N.TGA.A...QTAEFLFLLCQLVVLITALQETKSIVTQTMEHMLEFLKLAIPSYMICIAAAG........SGLSASVFYKLLLGFICLIEGIVVA........GCVPAVEAYM...LIGVAESLM.G..EDRFRGIMEMIKKGILWVLKGLIVLVSGSGILQAIITPVIDKSNLTFMQKSAGA-LPGIGDIAESITSVTIMSANAVKSSFGVTILLILILIIIIPILKV.FMILGTIRLATALGSI..A.G.GQRML...KCTQYLTDAGFLLLRM..LVT..LS..A..LFFVSIAAITKAT............
A0A255IQG6_9FIRM/65-386              .......................................................INLKSFVKDLIK-GDKSILDLF.DKENIKIILFDELKASLRVAAIIIVLALLSSILKSLENSFS.S.GAV.S...QITTYIIFITMVSLTLIGFKDVLSICNTTIDNTVGLMQVIMPILITFLVLIG........FPITSTALNPIFIGGVTFINVIFKN........FLFVSITIAF...SILIINNLS.K..NMKLKKLSSFIKQINIVSLGAMFTIYLGLVSVQGLYVTSIDKFSIKTAKFAIGNFIPVVGGFVSDSVDILLSSSELIKNVFGGIGLVFLVGICLLPVIKI.LSVVIVYKAAAIVVEP..I.G.EENMS...TFLNEVANLMVIMLVS..IVA..IM..I..MFFVTVAILTSI-s...........
L0EEQ1_THECK/91-411                  ..................................................evpgf------MDLIMP-GGKKLDIGA.ALTGIIRYLLHEVIYSGRLIGTIVLLTVFCMILETVQSAFE.R.GAV.S...KAAYAVAYMVLLVLAANSFNAAIGYARDAIGGMVQFMMAMVPLLLTLLASMG........NVVTVTVMHPLIVFMIYAVGALIHT........VVFPLLFFSA...VLHIASSLS.E..RFKATQLADLLRSIGVGTLGALFTVFLGVITVQGATGSVTDGVALRTAKFITGNFVPVVGRMFSDAADTVLSASVIVKNAIGIAGVVILLFLCLFPAVKI.IALAVIYRLSAAVLQP..L.G.SSPIV...TCLETIGKTMVYVFAA..VAA..VG..M..MFFLAVTIMLAAG............
A0A1H9ZML3_9BACI/65-384              ...................................................qktn------VYEFIK-NKDSFSIKN.TIKGALEYLFHEILLNGKLLGTLLLLTLFSVFLQTMHGAFD.Q.GAV.S...KIAYFVVYIVLIFIALNSFYLVVSYTTETIEAMSGFMIALIPLVLGLMATFG........NVISVAFFKPIIIFLINLSGVIVSK........FILPLLLLSA...MLLIVSSLN.E..NYKVTQLADLFKKVSLGVLGAFLSIFLGVMSVQGAASAIQDGVAMKTTKFITGNFIPVVGRTITDAADTVLSASLLLKNAVGIVGVAIVIFISLFPAIKI.FVIALIYKIAAAAMQP..I.G.DGPLI...TCLDTISKYIIYMLAC..LLV..VS..L..MFFLAIAIIVIS-s...........
R6NNX6_9FIRM/80-400                  .......................................................ISFYELIKELAT-GNFSCDGQK.LTQAVGRILWGELQDNKAILVTVLLLAISCAFLKNFSDIFH.N.TYI.S...EVCFFLIYMEMTVLLLQSYQMMSDIVVTAMNQIVDFMNMLIPVFGMSLAFSM........ANFTAAGFYQIAFIVVYIVQWGMLA........CLVPMTKLFI...MMEFMNYMI.E..GERFSRMCELMEEIIRWCLKCAIAATIGLNVVQTMVVPVIDRLKMSTVTKTLGM-IPGMGNITGAVSELMLGAGMVIKNSVGTAGVLILLLLVMFPLCKM.FLLSLMYKVTAAVTEP..V.S.DKRIA...GSMNGICLGCQLLTRI..LLT..SL..V..LFLVTIAMITAV-s...........
B8D2F1_HALOH/69-390                  ......................................................l-NIKELILGFMK-GDLDVSWAQ.IGGALLKYLGKEVTANFKILGQIIILAVMAAILNVFHNSFT.S.ETI.S...KTASMLIFMVLAILSLNGFKIAVEIGITTIDTMVSFMQALIPVLLTLLVSIG........AMTSAAVFHPITFMVISFLSSLIRT........IIFPMIFISA...ILNIVNNIT.S..EFKISRLSGLFKEFSMGMLGLSLILFTGIMVIQGGAAAVTDSLSLRTAKYLTGTFIPIIGGIFSDAVDLIVSCSLIIKNAINLFGMIVIVFMISYPLIKI.IALIIIYKIAGAIIQP..I.S.DGRLV...NILDNLGNTLVLIFLA..VSG..VS..L..MFFIVLTILVGS-a...........
B0TEH8_HELMI/69-390                  .....................................................ln--PRTIMED-IRNGRVSLSIGE.VFRGVMGYLFQEVLANTALLGELIILAVVVAVLNHFQSSFE.S.GAV.S...KTAFAVGYMVLITIAIHSFYAAVQTGRGAIDDMVRFMQAILPVLLTLLTAMG........GFASGALFHPVIFGAITLISTLIKD........WIFPLILFSA...VLGILNHVS.S..QFKVKNLQNLIKDGYKLAMGLFITVFLGVISIYGAVGAVADGLTLRTAKYATDALLPVVGGLVADSFELIVNSSLLLKNGIGLIGLVIIAILCVLPSLKI.LALVLIYRLAGALLQP..I.G.DSPVA...DSLETIGGSLTLVFGA..VAA..VG..L..MFFLALTIVVGAG............
U5S0V0_9CLOT/84-406                  .......................................................IDVRDYVKSFLKTGSGNTSLKK.IIRALAMYGVREVAASLKLLVLLIVISLICALLTNLQRAFN.G.EQL.S...NIAYFACYSLIIIIMARSFYISVDIARSTIKEMTDFMVALIPILITLVAAVG........GFVEASIMDPIVIGAITISANLFMD........VIIPIISMSF...VLQFVNNLS.S..EYKIDKLTKLLNQVALWAQGIIMTVFIGIITVRGITSKTIDEVTAKTAKFAVDNFVPIVGKSLSDAISTVAGYSILLKNALSSLGLVIIVAILLFPVIKL.LIIVVAYKLTAALIEP..I.S.DGRLV...NCINSAGSSIVLIMAC..LIC..VS..V..MFFIMICIIAAAG............
F9VKS9_ARTSS/69-392                  ......................................................l-DPKEYVKSLMSHGNEKMSIGKtIFKNITSFIIKEVILVLKGVSTVIIIAVICSLIQNLQNAFS.N.QTL.S...NVAFYACYALLIIILSKTFLIGIDIAKETIKELNNFLLVLIPVLSTLLLSAG........GISQVATLDPIIILLTNIGPTFYLN........ILIPIILLGF...MLQFANNIS.N..NFKISNLIKHTNQIVLWAQGIFITFFISMLTIRGFTAESLDIVTAKTAKFAVDNFVPIVGKAISDAIATVAGYSILLKNAVSSLGLIIVIAIVLVPIIKI.FIMATLYRLTAAIIEP..I.S.DNRIV...SAISSVGDSLILIMSC..VIV..VS..I..LFFVMISIIASAG............
A0A1I7JXJ8_9BACL/96-414              .....................................................gg----SIVRSILDSGG--FNLHG.IAAGVVRYFLREVLDNAQLLGGILVLSVLAALLESMQAAFE.R.QTV.S...QVAYFVVFLVLLVLAIGSFTEAVGTAKHAIQSMTDFMLATVPLVVTVMAASG........SLVSAAFFQPLLLFAVHLISNVVFL........FVFPLIFFAA...VMDIVSALS.P..RYSLTRLAGLLRTGGVAVLGLCLSAFLGVTAVEGLGKGVADGVALRTAKFAVSTFVPVVGKAVSDAAETVASASLLVKNAIGAAGLVMVAFIALFPVLKI.LALSLIYHGSAALMQP..L.G.DNPMV...DCLGAIGKSMVLLFAS..VAA..VA..L..MFFFAICILLVS-a...........
A0A1Z5HXU4_9THEO/66-387              .......................................................ISISKVLDD-LRHGKLDLGLDS.FLKGLMRFLFRELLAQSSLLGKLVILAVLCAVLQSLLVSFE.K.GTT.G...QLAYMVAYLVLITIALSSFKLAIDTGREAVDRMVTFVHALLPVLLTLLAAIG........GMTTAALLHPFILISMGILSTLIKG........VVFPLIYFAA...ILNLVSEIS.T..RFKVSNLALLFRQICIGLLGLCLTLFIGLLSVQGVAGSVADSVTLRTAKFMTGTFVPVIGKLLSDAVEAVAGTSLLLKNAVGIVGAMTVLILSLFPVLKI.LALVMIYRVAAALVQP..F.G.DAQIA...NSLEAMANNLIFVFAA..TAA..VG..L..MFFTAISIIVGMG............
R6EKF6_9FIRM/26-346                  .......................................................ISVTDLMTQILQ-GDILGAVGC.LLKEVIREMSNSATGIRNILIWLIVLGILSALLIHFVEVFD.K.HQI.A...DLSFYFIYLLMGVILLQCFSGVLETARETVENIVLFVRLMVPTFLLTVGVAS........GPVTVGAGYQLMLLLIYGTEKILLG........VVLPLIYSYC...LLTMINGIW.V..EEKLALLADLLEKLIGWILKASLGVVTGISLFQSLITPVVDSLKNSAVEKAVSV-LPGIGNAADGVLELALGSAVVIRNSVGVLLLLLLVAGCAVPLLQI.LFTAGFIKCATAFMGI..V.S.DKRIT...NCTDRMGNAMMLLFRT..VGT..AL..L..LFMVTLALLA---igs.........
R6DZC2_9FIRM/38-359                  .......................................................FSLEKILESTLN-GESFFHNQE.LISGIKDLALYEIRNAMILGVEILIICVVIGLLKNLSASFG.S.KSM.S...DISMLVCTMVIIGISMNSFRIVYQLALDSVSVMVSTMEILTPILLGIMISTG........AVTSGSILSPVIIGSVTGFGVILKK........IILPALFVAT...ILGLINCLT.E..KDYVNKLGKLIRNASLIVTGLIIAVLTGIITIQGLITETSDSLLMSAAKYSLSTFIPIVGGFTSDTIELFLRCMGTIKNVVGVFAVITLVLIVVVPLIKI.LIIALIYKLTAAVTEP..V.S.ESKIS...DGLNEMGSCLISMASI..MFF..CA..L..LFIMFVSIILRI-g...........
A0A1M5CUK2_9FIRM/65-386              .......................................................FHFKEMVIKLVN-GELDLSPGE.ILKDLFSYLFREVVANSALLGKLVVLAVICVILQNFSTAFD.R.GTT.G...QLTHMVTYLVLVTIAIGSFALAVQTGREVVDKMVTFMQALMPVLLTLLVALG........GVATAAIFHPVILVSITLIGTLIKN........LVLPLVFFSA...VLGLVSDLS.P..RFKVSGLAGLLRGVAVGILGVMGTVFLGLLAVQGVAGAVGDGVILRTAKFSIDAFIPVVGGMFSDALEAVISSSLLIKNAVGIAGVVAVVMIMTLPLVKL.ISLAFIYKLAAALIQP..V.D.DSQVV...SCLSDLGNNIILIFAT..VAT..VG..L..LFFFAIAIMVGVG............
R5B3G5_9FIRM/56-374                  ............................................svadaaqpqsl-------------------LAK.LWAYVLHEGGGAVASAARNAALLLAIVFLSALCASLSV---.S.GAC.E...KVTQMAGTVAVAALSVTHVTSCITAGSEALATLRDFSKILLPSMCAAAAASG........AATSAAAKYXXSAAAKYAATSLFLDvllsaetaVLLPLLYLYA...GTVICGTTL.E..NDVLASLSGLLRKAFRLLLIGFASVFTLYLSLTGILTGSADAAAAKAVKTAVSAALPVVGSIVADAASTVTSSAAILRSGIGIVGVVSVAAVCVTPYLQF.AVHYVLYKLAAGIAES..F.A.DKRVG...RLIDGFADVYGFLLGM..VGV..AS..L..ILFLSIV------ssmka.......
A0A268SF02_9BACL/69-389              ...................................................ktps-----FMDM-LIPGNEGFSLKS.VFVAIGTFMLHEILYNGKLLVTIVMLSVLSMILETLQTAFE.K.NNI.S...KIAYSICYMVIIVIAINSFSVAIGYAKEAIEGMVNFMMAMVPLLFTLLASMG........NIITVSVTHPLIIFMIHLVSTLIHI........VVFPLLFFSA...VLHLVSSIS.D..KYKLTQLADLLRNISIALLGILLTMFLGVISVQGASSSVADGVSLKAAKYIAGNFVPIVGRTFADATDTVITASMLVKNAIGLTGVIIILFLCAFPALKI.LTLALIYNITGAIMQP..L.G.DTPIV...GCLQAIGKSMIYVFAA..LAA..VG..L..MFFLAITILLTAG............
R7G552_9FIRM/104-424                 ......................................................i-AFQEVISEILT-GDLKSSVKL.LTEFAGEQMFYLLQTGKKNLVHILLIAMIAAFMNQFAGTLQ.N.RQV.A...SVGFYMIYILLAALTVAAFDVVIQWVESGIRNITAFMGVFYPVYFLAVAVAK........GSVTGVAFYNLVLFLIYAVEIIIGN........VLLPMVRVYM...IIRVLNFLG.P..EDMLGKLSEFLELIIRWTLKTALACVIGANLIQGMISPAIDTVKRSTVLKGAEA-IPGVGNLLGGMTEVALGTALLVKNGIGMAGAVICIALCVIPLVQT.AGTALLYKLAAAVIQP..V.S.DERVT...GCVEAVGEGCQILLQI..VFT..VG..V..LFLLTIAIVAAVT............
A0A0B0IF88_9BACI/66-386              ...................................................sqkg-----TFMEFVR-GDKQFSMKE.WGMGLVRYLLHELLVNGKLLGSLILLTVFCMILQSLQNAFE.Q.QTV.S...KVAYAITYMVLMIIALNSFQVAISYAQDAISSMVHFMIAMLPLLLAMMAAIG........NITSAALFHPLIIFLVNTSGLLIQH........FVLPLLFLST...VLSIVSTLT.D..HYKVTKLANFLRNLAIGTLGVFLTIFLGVISVQGAATAVSDGITVRTAKFIAGNLVPVIGRMFTDAADTVLSASLLLKNTIGIAGLGILLMLCAFPAIKV.LSLAIIFNLSAAVLQP..L.G.GGPII...ECLSIIGKAVIFVFAA..MAV..VC..L..MFFLAITIMVAAG............
R7N6Z2_9FIRM/104-424                 ....................................................iha---DGIMKMLLD-GKVQEVLRL.FGQQIKGKLWGEVPFARQVFLYVLMLGISSSFFTGFADLFA.G.ARQ.E...KIAFYLLYMMLVGILVLVMTKISMITSQVFTLILDFVKTFIPVYFISVGAAN........GTGTAVVYYQVMLLVIYFVEAFVCK........VLLPIAYSYM...LLGILNGLW.A..EERLTLLLDLLKKAVLVSLKAVLFLITGLSLIQSMIVPVVDSFKNTAIHKVVSV-IPGIGGLTGGVTELLLGAAVLVKNSFGVFLLILLLSICLIPVLKI.GVLACSVKLSAAITGM..I.S.DKRIS...DCADHIGEGCFLVLRC..VFT..SI..A..LFFIVIAVVAY--sv..........
A0A1S2LU46_9BACI/60-379              ..................................................qkgsf------ME-FVR-GEKQFSLKE.WLLGFVRYFFHEIIVNGKLLGTLILLTVFSVILQNLQSAFE.R.NTV.S...KVANAIVYMVLLIIAINSFYIAVSYAQSAISSMINFMIALLPLLLALLASIG........SLTSVALFHPLIIFLVNTSGLLIKH........FVLPLLFLSA...LLSLVSTLT.D..HYKVTKLANLLRNISVGTLGIFLTVFLGVISVQGAVTAVADGITIRTAKFVTGNFVPIVGRVFTDAADTVMGASILLKNTVGIVGLAILLLICAFPAIKV.LALAFIFNIAAAVLQP..L.G.GGAII...QSLSIIGKSVIFVFAA..LAT..VC..L..MFFLAITIMVAAG............
I3EAC5_BACMT/72-392                  .................................................sqkgsl-------YDFIK-GEKKFSFEQ.WTTGFMKFVFHEFIVNGKLLGSLILLTIFSMFLQSLQNSFE.N.STI.S...KVAYSIVFIVLIILALNSFHVAITYSNDAIESMIHFILALIPLLLALIASSG........GVISAAFFHPVILFLMNTSGLIIKN........VVLPLLFLST...LLSIVSVLS.E..HHKVTQLAQLIRNWSIGLLGLFLTVFLGVISVQGASTAITDGVTIRTAKFITGNFIPVIGRAFTDATDTVISASVLLKNTVGIAGVVILLLIVAFPALKI.LMIAFIYKFAAAILQP..L.G.GGPVI...ACLDVISKSVVYIFAA..LAI..VS..L..MFFLSVTVIIAAG............
A0A1Y4ET95_9FIRM/65-375              ..................................................qalts-----------------ITPEA.LFSEIGGMAQENARGPLQAAASVIAVMLLCALCNGMKLSLG.E.KPL.G...GVIGMVGALCVCTTVVGPVVACIEHAAQVVQAAAGFLLACVPVLAGIMLAAG........QPVSAGSYNLLMMAVGNVISILSAS........ILVPCLNIFL...ALSIVSAIS.P..GVNLSGICNAFHKVVKWVLGFCMTVFAGLLTVHSIVASSMDETTAKAAKFVVSSFVPVVGSALGDALQTVTGCVKLLKSGVGAFGLLAGALIFLPVILQC.LLWMVTLNVCAGAGDV..F.E.LKEIT...SLLRAVAKAVELILAI..VLC..CM..T..ILTVSTAIVLLM-g...........
G7M113_9CLOT/107-429                 .....................................................ld--PAEYIKTYIKEGKGNLSLDT.LLKAVLSITFKEVKSVLALIISIVTIAIICSLLKNLQEAFS.S.ESI.S...QIAFYACYSLIIVLLSKSFIISISVAKDVISDVSNFMNALLPVLITMISLAG........GISQAATLDPIVLGAVVFIPKIYSN........VIIPMILMGF...VLEFANNIS.T..EHKITNLCKLFKQVIVWFQGILVTIFIGLLTIRGITSTTIDAVTLKTAKFAVDNFIPIVGKAFSDAIASVAGYSLIIKNAISSIGLVVIILILLHPLIKL.ILITFIYKLSAALIEP..I.S.DSRIT...KSIEAAGSSMVLIISC..VLT..VT..L..VFFVLISIMASSG............
R6TBX5_9FIRM/1-187                   ..................................................mdlll----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........--------------------RLIQE........LLLPLVYLYI...GALTAAACL.P..EGRLDAVAEGLKKVVTWLLTTALLLFTVYLSVVRIVAGSADGATVKVAKAAISGVVPVVGGILSEVSETVMAGAGMLKNTIGIFGMLAVLAACAYPFLQL.GVQYLLYKLSAFLAAA..V.G.PPGLS...KLIGGLGGAFGLVLGM..TGA..AA..L..LLLVSILASV---ga..........
R6YDH6_9CLOT/55-174                  .......................................................ISLNDFLTSAIK-GE--IDNKG.LLKQIIMLFGDEIVDVIYLLGSIIVVIIIHSILKAFTENLE.N.ESV.S...QITYYIQYILIVTLIMANFSTIISGIKDSIANLTGFINCLVPILLALMSATR........-------------------------........----------...---------.-..----------------------------------------------------------------------------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------ecc.........
A0A1T4P4C4_9FIRM/71-392              .....................................................lt--LNDVVNL-FTNGEFNLKFKA.IFTGMLKYLFKEIVVNFKLLGQLIILAVIAAVLKTFQNSFA.Q.QDI.S...RLVNSIVYLVLVIIALNSFKIAINVGVQAIDDMVSIMQALLPTLLTLLVAVG........NITSAALFQPITFLIVNLLSVLIKN........IIFPLILFSA...ILAVVNNIS.D..NFNISGLVKLISEINVGLLGAFLTVFIGVLVVQGTAGAVGDGVTIRTAKYLSGAFVPVIGGIFADALDMIIGGSLLIKNALGLLGVIIIFLFCTFSLIKI.IALIFIYKFAGAVIQP..I.S.DSKIV...TCLNDLGNSLILVFAS..VLS..VA..L..MFFITLTILIGV-a...........
A0A0V8HM88_9BACI/70-390              ..................................................sqkgs-----LM-DFIQ-GEKEFSMKA.WFSGVLKFAFQELVMNGKLLGTLILLTILSMFLQSLQNAFE.G.GNV.S...KVAYGIIFMVLIIIALNSFHVAIDYTQEAISTMINFIIALIPLLLALIAASG........GVVSAAFFHPVILFLMNTSGLLIQN........VVLPLLFLSA...LLSIVSTLS.P..HYKVTQLANLLRTWSIGLLGVFMTVFLGVISVQGATAAVTDGITIRTAKFITGNFVPVIGRMFTDAADTVISASVLLKNTVGIAGVAIVLIIAAFPAIKI.LMIAFIYKLAAALLQP..L.G.GGPVI...DCLDTIAKSVIYVFAA..LAI..VS..F..MFFLSITVIIAAG............
A0A0Q9LM94_9BACL/87-407              ...................................................hips-----FAQMILP-GGDGLKITD.VLQGLLRYLWHEVLYNGKLLVTVVMLTVFSMVLETLQNAFE.R.NAV.S...KVAYSITYMVLIIIAVNSFHVAMGYAKGAIESMIQFMLAMVPLLLTLLASMG........NVVTVSVLHPLIIFMIHAVGTLIYT........LVFPLLFFSA...VLHIASALT.E..KFKVTQLANLLRNISVGMMGVLLTVFLGVISVQGAAGAVTDGVTLRTAKFVTGSFVPVVGRMFSDAADTVISASMLAKNAIGLAGVIILLFISAFPAIKI.LTLALIYNISAAVMQP..L.G.DSPIV...SCLATIGKTMIYVFAA..LAA..VS..L..MFFLAVTIILTAG............
R6R0J5_9FIRM/60-362                  ..........................dapldalkklfhgsmaaalqetlcgstda----------------------.-----------------------LLFLLLAALLSFLTSETT.N.G--.-...ELLDLIAAGGCGVLLWSKLLTLAEQLCAQMGEWRGFLLGFLPVYAGVLTMGG........ETAAGSAASGFFLTILCFLAQCLTA........FVRPLLQCYL...ALSMACCIS.T..DHGLAAFCQSTGALLRQALRWAGKFLALLLGLQRVTALQLDRAALRTGQLLAGS-VPIVGQTLSDVSEAFLAGIQLLKSGLGLAAIAFLGAEFFPLYLGM.MLQLALLCGCSLFCSL..T.G.NTRCK...ALLDCFAEAVRCMAAA..TAL..FF..G..LFIMGTVF-----lflag.......
R7I6P3_9CLOT/65-384                  .......................................................FSFMDYMIDLVK-GKVSFSMES.VASQVKDAFFQEIKGNKSFWYQCLSIAIIAAFFSNLATIFQ.N.KMV.G...EVGYYIGYLILFTLLVSGFSKIFSVAEQLLMLFVFFMKALIPVYFMMAAASN........GSVAAAGGYQMALLAIGVVEFVIGK........IVLPAVEIYF...MLVLINHLS.K..EDKLSRLLELLEMGIKWAMKGMLGMIVGLNAVQGLLLPGIQKVRQNVILKTSEV-IPVVGDALSGITETVLSVAGLLRNAVGVAGVTAILLLAIVPVLKI.ISYSVIFRLEAVFLQP..L.G.EKNMC...DCFVGMAKTAEFLLYI..EVV..SM..L..LFCLTLLIVSY--s...........
T0C7M3_ALIAG/122-442                 ...................................................lsgg----SLVRA-IL-GNGGPSFTG.VVHGLLHYFFTELFDDAQLLGGILILSVIAAVLESMQSAFE.R.QTV.S...QVAYMVVFFVLMMLAVHSFIETMGAARHAIQTMNDFMIATIPLTITLLAASG........AVASAAFFQPMLLFVVHFISNIIFL........VVFPLIFFSA...VLDLTSTLS.T..RYQLTRLAGLFRGVGMGILGFAMSVFIGITTIQGLGKGVADGVVLRTLKFGVSTFLPVIGKAISDSAETVLSASLLVKNAVGVAGLVLLALIAIFPALKI.LAVSLIYGGSAALMQP..L.G.DTPMV...ACLSTLGKTLVLVFAC..VGA..VG..F..MFFFAICILLAT-a...........
A0A0A8X8K0_9BACI/72-392              .................................................sqkgsl-------YDFIS-GEKKFSLKE.WFKGILNFAFHEFIVNGKLLGSLILLTVFSMFLQALQNSFE.K.STI.S...KVAYSIVFMVLIIIALNSFHVVVDYTNDTISTMIQFILALIPLLLALMATSG........GLISAAFFHPVILFMMNTSGMFIQY........VVLPLLFLST...LLSIVSILS.D..HYKVTQLASMLRNWSVGLLGILLTVFLGVISVQGASSAVTDGVTVKTAKFITGNFVPVIGRVFTDATDTVISASMLLKNTVGLAGVAILLIIAAFPAVKI.LMVAFIYKFAAAILQP..L.G.GGPVI...TCLDIISKSIIYVFAA..LGI..VS..L..MFFLTITVIIAAG............
A0A173WIC7_9FIRM/33-332              ........................................lktlrgffpaelgdv----------------------.------------LREAVGGYAQVLLFLILSAVIALLLG---.E.RAD.G...TLLDLVCAGGCGVLLWEKLVALSDEFCVQIESWNRFLLGFLPVYAGVLTLGG........ESAAGASASGFFLTLLCFLAQGLAA........VVPPLLQCYL...ALSMACCVS.T..EAGLSGFCRALGGFLQKLLRWAGKLLAALLGLQRLSAWQLDRAALRTGQLLTGT-IPIVGETLSDASEAVLASVQLLKSGLGLAALLTIAAEFVPVYLGM.LVQLGLLSGCGVLCSL..T.G.NARGQ...ELLGCFAEAVRCMMAV..TAL..FA..G..LAVVGTALLFV--vg..........
A0A075JP38_9BACI/69-388              ....................................................ekk-----SVYDLIK-NQESFSIKD.SVIGFLEFLFYELILNGKLLGMLLMLTLFSIILQTMHTAFE.K.SAV.S...KIAYFVVYIVLIFIALNSFYLAFSYAKEAIDTMSSFMIALLPLVLGLMATFG........NLLTVSFFHPIIIFLINLSGLLTSH........FIMPLLFLSA...LLLIVSSLS.D..GYKVTHLAKLLRNIGIGTLGVFFTIFLGVLSVQGAASAIQDGVAMKTAKFLTGNFIPVVGRTFTDAADTILSASLLLKNAVGIVGLAIVLFITLFPAIKI.FAIALIYKIAAAILQP..I.G.DGPVI...SSLNTISNYIVYILAC..LLA..VS..F..MFLLAIVLLVAA-s...........
E6U548_ETHHY/61-371                  ...................................................qnvr----------------GFSLGN.VFGFLWQKLGDAASAPFKAIAAVFGILLLCALAEAMKNTFA.E.KSM.K...TVFEIVCTLSIAGVLAVPITQCISAAAATVRDSSTFMTAFLPVYGGLAVASG........HPTSGVISQGIVLVMAQVITQIAST........TFVPMVSIFL...AFCIIGSIA.P..GVNIGGLAGFARKIVNVGLVLSLTIFTAVLTIQGFIAQAADTVTMKTAKFVVSSAVPVVGGAISDALNTVVSCAGLLKNAVGAYAIIVFLAAYLPVLLEC.VLWMLAVEFSVALAEI..V.N.VGNVS...TLLKGVLDALKMLVAL..VVA..CA..L..AMIVSVCILLL--vs..........
A0A0A5GI60_9BACI/64-383              ..................................................rkgsf------ME-FIE-HKEELSIKD.WVTGLVKYLFYEFIVNGKLLGSLLFLTLFCMILQSLQNAFE.T.QAI.S...KVAYAIVYLVLIVLALNSFNLAVSYAKDAVDAMSAFLIALLPLLLGLMASFG........SLASVSFFHPVIIFLIHSSGMLVSN........IVMPLLFLSA...LLSIVSTIS.S..EYKVTQLASLLKNVALGIMGLFLTIFLGVISVQGASSAIQDGVAIKTAKFVTGNFIPVVGRMFTDATDTVLSASLLLKNTVGIIGVIVILSLALFPAIKV.LAVAIIYKFAAAIMQP..I.G.SGPVI...TSMEIISKHILYVFAA..LLI..VT..F..MFFLAIVLIVAS-s...........
A0A1R1D926_9BACL/88-408              ....................................................rip----SFMEMILP-GGGGLKFTD.MFKGLLRYMWHEVLYNGKLLVTIVMLTVFSMVLETLQNAFE.R.NAV.S...KVAYSITYMVLIIIAVNSFHVAMGYAKGAIESMIQFMLAMVPLLLTLLASMG........NVVTVSVLHPLIIFMIHAVGTLIYT........LVFPLLFFSA...VLHITSALS.E..KFKVTQLANLLRNIGVGVLGVLLTVFLGVISVQGATGAVTDGVTLRTAKFVTGNFVPVVGRMFSDAADTVISASMLAKNAVGLAGVIILLFISAFPAIKI.LTLALIYNIAAAVMQP..L.G.DSPIV...SCLQTIGKTMIYVFAA..LAA..VS..L..MFFLAVTIILTAG............
A0A1B7LIZ2_9FIRM/68-389              ......................................................l-SFKDLLVKLAQ-RDVHWQPAD.VFHYVLVYLFKEVVANAALLGKLVILAMICVVLQNLTAAFD.R.GTT.G...QLTQTVTFLMLVTIAVGSFALAVNTGRDVVDKMVGFMQALLPVLLTLLVALG........GVASAAVFHPVLLGGLTLIGTLIKN........IVLPLVFFAA...VLGLVSNLS.P..RFKISNLAGLLKTAAMGLLGIFGTVFLGLLAVQGVAGAVGDGVVLRTAKFSLDAFVPVVGGMFSDALEAVISSALLIKNAAGLAGVVAIFAIMALPLIKL.ISLALIYKLAGALVQP..V.G.DAPVV...DCLNDLGNSVITVFAV..VAT..VG..L..LFFFAIAIVVAMG............
A0A168M2R8_9BACL/69-389              ...................................................ktps-----FMDMLLP-GGEGLGIKN.VMSGLTSFFWHEVLYNGKLLVTIVMLSIMSLILETLQTAFE.R.NNV.S...KIAYSLCYMIVMVIAINSFSVAIGYAKGAIDNMIDFMMAMVPLLFSLLASMG........NIVTVSVTHPLIVFMIHTVGTVVRT........TVFPLLFFSA...VLHIVSSLS.D..KYKLTQMANLLQKISVGLLGVLLTIFLGVISVQGITSSVTDGVTIRTAKFISGSFIPVVGKMFADATDTVISASLLVKNSIGLAGVIIILFLCIFPAIKI.LTLALIYHVAAAVMQP..L.G.DTPIV...TCLQTIGKSMIYVFAA..MAV..VG..L..MFFLAITILLMAG............
C0EFZ2_9FIRM/69-382                  ................................................spssdki---------------ISFSIGD.FFSNLWGTITDTVKQPLGLLAISFGVMLLCALLESFKSTVD.-.SSL.S...NVFSMVAVLAVCGTVIQPVIRCIQMAADTITGAGNFMLCFIPVFTGIVTASG........MPVSGLGYNTALFATIQVISKIVST........VLLPFLGIFL...ALSIVSAVS.G..QFKISKLTATVKKTVVWSVSLLLTIFIGIFSTQSMVAASADTVTVKATKFMVGSFIPVVGGAISDALNSVQGCLGLMKSSIGAFGILACVFTFLPAILTV.LFYMLVLKISSAAGSL..F.G.LSGVT...EIFDAVYDALSILMAF..LIC..YS..L..LTIVTTTLMISM-s...........
A0A1I5U740_9FIRM/70-390              ......................................................n--ARDLIKKILT-GEFSLNLRD.FWIHITRIFYREVMANLGLMAKIIALAVVCGVLKNMQDSFQ.S.VSA.A...EVAYFVCYMVVMLMVIHSIMSAMEIGRRAVDAMASFTQSFFPVLLALLVSVG........GITSSALLNPTIGLLVGFMGMVLEH........VMFPLILASV...VIIMINHIS.D..KVQLNRLSSLLKNVCEWALGLIFTVFVGALTVQGVMAASIDGISIRTAKFAVDTFVPVVGKMFAQAVDMVVNCSLLIKNAVGLMGLLVIASICLYPVLKI.LCVMAIYKLASAVLEP..V.T.DKRIA...DCLNDIGNMMIIIAIT..VAG..MA..M..VFFLAITLVIGVG............
R5HPX0_9FIRM/58-379                  ......................................................v-SFSGLVEELMQDGVSTAWGEH.VFSAIKTSLVGEIAANRKMLLEIVLLAFCFSVLKNFAGAFH.A.SYI.S...ELCFLLVYCVMAVMLLQTFLLFQEVVSKSLESCVEFMKVMVPTFCLSMMFAS........NVSSAAGFYQTAFLVIYLVEWLFLN........LLMPLIHIYV...LLEMFGHFV.P..EERFSNLTELFSEVINWGIKIAGVLVLGLNVVQNLIGPAKDRMGHGIFAKTASV-IPGLGNAVGSVTELLLGAGIVMKSCVGTAGLVVLVLISLVPLLKA.LCLAFFYKLAAAVTEP..V.S.DKRIS...GCLKGLANGGMLYVKL..LGY..SV..L..LFFVTIALTAAA-s...........
A7GSK7_BACCN/63-383                  ..................................................sqkgs-----FM-EFVK-GEKEFSIKE.WMIGLLKYLFHELVANGKLLGTLIMLTIFSALLQSLQSAFA.K.SSI.S...KIADAVVYMVLIIFALNSFYVVMTYARETIQTMVDFILALLPILLALIATGG........GVVSVSFFHPIIVFLMNTSGLLMNY........IVLPLLLLAT...ILSIVSTMS.D..QYKVTKLSKLLQKVSVGIIGIFLTVFLGVLSVQGTATAVADGIAVKTAKFVTGNFIPVVGRMFTEAADTVISASGLLKNTVGMIGLVILCLIVAFPAIQI.FCIAFIYKFAAAVLQP..V.G.GGAII...QCLDIIGRSIIYVFAC..LAI..VS..F..MFFLSITIMIAAG............
R5L5E1_9FIRM/57-376                  ......................................................l-NFRHILDEIMS-GNVLDAIKE.CSNVVYQKTVGDFTMVEKALGNLLLIVILSAFFTNFANVFS.N.EGI.S...STGFYICYLIVTTMLMTLFENFCLIATDFVRLLLEFLCGIVPAYFLSVAITG........Q-VAAAGFYQLTLVIISVAQFIFLR........VLVPMIKVYV...TINLINNIS.K..EDFLSKTSDLLKNAIAFINKTVVGIVVGLNIIQALILPAVDGVKNNAIRKVVGA-LPVVGDGSDAVCGILLGSVNLIKNTIGGFAIIVIIMLCGVPFIKI.QLYSISMQIAQAVVQP..V.A.DKRMI...NSISCVVMGIKMLAKV..IIG..AS..M..LFIISIAIICIVT............
A0A2B2CED5_9BACI/72-392              .................................................sqkgsl-------YDFIS-GEKKFSLKQ.WGLGIVKFAFQEFVANGKLLGSLIMLTIFSMFLQSMQNAFE.K.SAI.S...KVAYSIVYMVLVIIALNSFHIAISYTNEAIGSMISFVLALVPLLLALIAASG........GLISAAFFHPVILFLMNMSGLFMQY........IILPLLFLAT...LLSIVSTMS.E..QYKVSQLAALLRNWSIGLMGLFLTVFLGVISVQGASAAVSDGITIRTAKFVTGNFIPVIGRMFTDATDTIVSASVLLKNTVGIAGVGILLIIVAFPAIKI.LMIAFIYKFAAAILQP..L.G.GGPII...TCLDIISKSVIYVFAA..LGI..VS..L..MFFLCVTVIVAAG............
R7FFD7_9CLOT/77-396                  .......................................................IDINEILNSAIK-GE--IDNTT.IYKKILNLLGTEVQTGSKSLACILAIIIIHSILKSISESLE.N.DNI.S...KLIYYVQYIAIITVIMTNFSDIINLVKTTSTNLVGFMNTLIPVLISLMLYTG........SISTTSILEPIILFMINFIGNLIEN........VLIPVILIIT...SMSIISKIS.D..RVQIDKISKFLKSTTIWFLGIVLTIFVGVVSLEGTMASSVDGITAKTAKALVSSAVPVVGKILGDVVDSVLGCGLILKNAVGFVGVIVIIGICILPILKL.TVLTFSYKLIASVSEV..I.A.DGKIV...KLLDEVADIFKILLAI..LVT..IS..F..MVIIGTTLLIRM-s...........
A0A1H9S6I7_9BACI/1-296               .....................................................mm----------------------.--DEMLQTLLQPVKEVIQTFTYILLFGLVFVCLEWLIPAS-.-.---.K...RLLKFLFIMIICFYCLEPAIRTLDMIQALSNQLVTLFLGMYPLLTAGIALSG........GAFLITLWNPMVMVFASFTTVLAEK........VLIPSIMAAF...IFDVITRIH.P..ATSFSKMSDLIRMTLVGTTSIILVLYSFFMTLNGVFTWSVSGAVNESAKRLISNNIPFVGSLLTESISTMKSYSASASVVTGNAVLFSVLVLVSIPTIQT.ILIAFLYRLLGAILDP..F.I.DGNIS...GLLDDIGRTLFVLSVI..SVL..IA..F..AFFFTIILTM---lfa.........
R6YK70_9FIRM/60-379                  .......................................................FSLSDYVERVCQ-GDCELSFDT.ITEYIKEGAVSQWDANKTLVFRLLIYAVLSGVFLNLTGSLY.E.KQL.G...ENGFHMLYFLVVTILLSAFYAVFSVAKEVLWQVLSFMKTLVPAFSLALTWSS........GSATSFAFYQATLATIGVAETLMYY........LFLPVIQIYF...LLRVLNPLS.-..GGKFDKLAALLESIVRVGTKIILGIMLGHQGIKGLLMPALDQVKRGAVFRAAES-IPGVGNVFGGVADTIVGSGILIKSAIGVGGIIAIALICLLPLLKL.GLFTFLYRVIAAFSQP..V.A.DRRLV...AVFQGSADSGKLLFQL..VFM..AA..V..LFLLTLTIIIAAT............
A0A150Y9C6_9FIRM/65-191              .......................................................IEFTELVETLLS-GDVTGALAM.AGRGIGGTVFSVLSENKTAMLHILVIALIAAVFANFSQVFA.A.GQA.A...DTGFFILYLLLITLLLQTFEVMIDSVTKSLTLLTDFMQALCPVYLMAAAVVT........GSGSS--------------------........----------...---------.-..----------------------------------------------------------------------------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------ldf.........
A0A1D7XKN5_9CLOT/90-412              ...................................................ldpi----QYIKEYIKNGEGNFSIKS.LSKALTSILFKEVRSVLKLIISIVTIVIICSLIKNLQNAFS.N.DNI.S...EIAFYACYALIIMILSKSFIISIDVAKEVILNITDFMAALLPVLITMIAMVG........GLSQAATLDPIILAAVIFIPRIYSN........IIIPLILMGF...VLEFANNLS.N..DHKIINLCKLLKQCTLWMQGIIITIFIGVLTVRGITSKTIDAVTLKTTKFAVDNFIPIVGKTFSDAISAIAGYSLIIKNAISSIGLLIIVLILLYPIVKL.VLMTVIYKLAAALIEP..I.S.DSRIT...NSVAAAGNSMTLIISC..VLS..VS..L..MFFILIALVASSG............
R7BT38_9FIRM/98-418                  ......................................................d--LKATLKALVN-GQTQSFYQN.FLNLLSKSAGRYFLSFLPSFMTIVVICLLKNMLCSLTGDFL.N.TST.T...EVVHTVCYSAIVIVLMSGSVGIIKTVSDTINALTTFANAIFPVLLTLLSSLG........ATVAVSGYSPLVAVLCSFVMKLVGS........VILPAFVACI...VFCVVGNVS.K..TVKLDKLSKLIKSASTWLVGIAFGLFATFLTVQGVTGGAVDKFGFNVAKFAVSSYVPVLGGYLSDGLDLLTASVVLVKNALGYVGAIVLCSIVLFPIVKV.VVFSLTLKLTSAVCEP..L.G.DTRTS...NLLFAVSKNTNLLITA..LAG..VA..F..AFFLLVMLMISS-c...........
V6IVC6_9BACL/75-392                  ....................................................pdf-------KSFVH-SNKQGFFKK.LINGLLHYFLNELVVSSKLLGTLILLTVFSTLLQTIQSAFE.H.KAV.S...KVAYIVVTLVLMILLLNSFRLAINYTNDTVSAMSHFLIALIPLIFALTAATG........GMASVAFFHPLVIFLVNASGWLISS........FVLPLLLMSA...LLAIVSTLS.D..HYKLTRLSELMKNVALFTLAGFFAIFLGVISVQGAATSISDGLMVKSAKFFTGNFIPVVGRMFTEAADTVMGASVLLKNTIGIAGLLILICITLFPLLKI.LSLAFIYNLAAAILQP..L.G.SGPVI...DCLVIMAKSIFYLFAS..LAV..VS..L..MFFLALTIIIASG............
A0A1C0A9I7_9FIRM/65-385              .......................................................ISVKDIIKL-FSKDGFRIKIIE.ISKGILKYFLDEIWANSKLLGQLIVLAMMVAVLKTFQS-ND.S.AQV.N...NLANGIVYLVLVIIALNSFKVAIGIGKDTIRDMVDIMQAILPILLSLLVSMG........NVTSAALFHPISFLIVNSLSTFIIN........ILFPLIFLAT...ILDIVNNLS.N..NFKVTGMAGLFKKGVASILGLITTIFLGTIVAQGTIATVSDGVTIRTAKYLTGSFIPVVGGFLSSTLDMVIGGSLLIKNALGVFSVFIIIVFCSFSVIKI.LALVFIYRLSAALIQP..I.S.DDKIV...DCLNRLANNLLYIFAS..VAI..VG..V..MFFVVIIIMVGA-a...........
V9WBD7_9BACL/71-391                  .................................................sktptf-------SDMLL-NGMQLKLPD.IFKGIFKYLFHEIIVNGKLLASIVILTVFSMILETLQSSFE.R.NAV.S...KIAFVISYLVLMIIAINSFQVAIEYARSAIQSMMDFMVACTPILLTLLASMG........NITTVAIMHPLIIFMIHAVGTAVYF........IIFPLLFFSA...ILHIVSSLT.D..KYKVTQLANLLRNISIGLLGIFITVFLGVISVRGSMGAITEGVTIRTAKYISGTFIPVVGRLFSDATETVIGASLLMKNAIGLAGVVILILLCAFPAMKI.LTLALIYNASAAVMQP..L.G.KSPII...KCLQTIGKSMLYVFAC..LAA..VG..L..MFFLAITIIITA-s...........
A0A238ZU59_9FIRM/62-383              .......................................................INIKEFMFRTIR-GESTITFND.IIRGSTRFLFREVIANWKLLGQIIVLASICAVLRNLQSAFE.N.EVV.G...KLAYNVCYLVIISITIKSFMIAINIGKETIDLMVSFMQALMPVLLAMLMAMG........GLTASAFFSPILLGAIGFVGTLIKN........LILPLILFSA...VLAIVNNLS.S..KIQVTKLAGLLKQAAAVILGFILTAFVGVISIQGITAATVDGVTIRTAKFAVDKFVPIVGSFLSDAMDTVIGCSLLVKNAIGAIGLISIFLLCLMPMIKI.LALIIVYKLCAAIIEP..I.S.ENGLV...DCLNGMSNSLVLLFAT..VSS..VA..I..MFFITITIIVSTG............
A0A1C0ZWD3_9BACL/74-392              ..................................................ppsfm--------ELLL-GTKGISMKS.IFKGLLSYVFHEIIINGKLLASIVILTVFSMILETLQSSFE.R.NTV.S...KLGYTITYMVLIIIAINSFSVAIGYAKTAISSMIQFMIAIMPLLLTLLASMG........NVTSVAILHPLIVFMIHSVGTAIYV........FVFPLLFFSA...VLHIVSSLS.D..KFKVTQLANLLRTVSLSMLGVFVTVFLGVISIQGSAGAVRDGVAIRTAKYITGNFVPVVGRLFSDATETVIGASLLVKNAIGLVGVVILVMLCAFPAIKI.LTLAFIYNLSAALMQP..L.G.DSPII...ACLQTIGKSLIYVFAA..LAA..VS..L..MFFLALTIMITM-s...........
A0A1S2LWG6_9BACI/61-380              ..................................................qkgsf------ME-FVR-GEKEFSLKE.WLFGFVRYFFHEIIVNGKLLGTLILLTVFSMILQTLQTAFE.K.NTV.S...KVANAIVYMVLMIIAINSFYVAITYAQTAISSMINFMIALLPLLLALLASIG........SITSVALFHPLIIFLVNTSGLLIQH........FVLPLLFLSA...LLSLVSTLT.D..HYKVTKLANLLRNISVGTLGIFLTIFLGVISVQGAVTAVADGITIRTAKFVTGNFVPVVGRVFTDAADTVMGASILLKNTIGVVGLAILLLISAFPAIKV.LTLALIFNLAAAVLQP..L.G.GGAII...NSLSIIGKAVIFIFAA..LAT..VC..L..MFFLAITIMVAAG............
W6NDC2_CLOTY/81-403                  .......................................................IDFKEYVKNFMKSGDGKISVKK.IINACIMYLLRELAASIKLLAILVIIAIICALITNLQRAFS.S.EGL.S...NIAYFACYSLLIIIMARSFYIGVDLARSTIKDLTDFMMALVPILIMLLTTVG........GVVEATVMDPIVIGTINISAQIFMN........FIIPLICMSF...VLQFVNNLS.S..EYKIDKLTKLLNQSALWAQGIIMTIFVGIMTIRGVTSNTIDQVTAKTAKFAVDNFVPIVGKSLSDAVSTIAGYSLLIKNSLSSVGLVILILVLIFPVIKL.GILIILYKLTAALIEP..I.S.DSRMV...NCINSAGDSLTLITAC..LIC..IS..T..MFFIMIAIIAASG............
A0A0J1FDB0_9FIRM/123-442             ......................................................f-SLTGLLAG-LKQGKLDLKPQD.IMRSLLTFLTGEILKTAPLIGKFLVLAVLLAVLQQLQEAFD.-.GSV.G...KLSRFLSYLVLLSLAMAAFQSVLATARGALDQMVGLMQALFPAMLTLLLAMG........SFATAALFRPMVMASLTFLATLFKN........VVLPLFFLAA...VLRLFNQIS.E..QFKLNKLAGLIEFGGKVSLGLVMTLFVALMTLQGVTGGVADGVTLRTAKYSVDL-IPVVGKFFKDSVELVVTSGLLLRNALGVVAFIALLIICLGPLVKI.LAMMFVFRLSAALIEP..L.G.EQSLA...NALQDMAKSLTYIFAA..LAS..VG..V..MFFIAIVVVVSSG............
Q3AAL2_CARHZ/51-372                  .....................................................vd--LKREVLAIFR-GEKEISFAE.IWENLKGTLLAEIRGNIKILLKLFILAIILSLLRQLENSFS.S.GSI.A...QISQAACYLAFMLLALQSFTLALKIGRDAVEGMVGVALSLLPASLGLIAAAG........AVTTSALLSPTLFGVIGILGSVIKN........LVFPLLYLSI...LVEIAAGIS.D..RFSLDKLIKFAQQLSIGLVGLMLSLLLGVGALETVAGGVADNFILKTARFATGTFVPVVGKVLTDAVEAVAGTVYLLKNALNALGIVILFGVVTAPAVKI.LVLGGLYKFAGAVLEP..L.G.EENYV...KTLTGMGNALLLIFGV..LAI..LS..L..FLFFLFAVLISAG............
R5LFC9_9FIRM/45-365                  .......................................................FDFEDCVREIIK-GDFDTGFSG.LLDMFSSAIFSELANEKAIIIKLIVVGLTAALFSNIAFTVL.S.GKI.S...ETGFYITYLALIVCMLSGYTIVAEIVKNTMDRLSSFMEAVTPVYILSIGFST........GESTATAFYQVVIMVITLIEKVLIN........FIIPMIYTYM...IIGLINNMA.N..GTLFTKAGELIKTIIEWTLKSLMTFVIGINVIRSLINPIVDSMKVGTMWKVMQS-IPGIGNTLNSVSSVVFASGTLIKNGIGISAMIAILVICFIPVVKT.SVIAISYKGVSAILEP..V.S.DKRIV...NSINTIHISFCLMLKT..LLY..AT..V..FFILTIAIICAST............
A0A1A5XTS7_9BACL/70-389              ...................................................kapg-----FVQLLMQQGE--LSITG.FLKGMAKFFFHEILMNGKLLSSIIIITVFAMILETMQNAFE.R.NTV.T...IVAYSIAYLVLMVLAINSFHVAITYAKDAITDMSDFMLAMIPLVLALLASVG........NLASATMFHPLIIFMINTSGLLIST........IIFPLLFLSA...MLSIASLFS.E..RYQVTQLAALLRNIAMGALGSFLTMFLAVISIQGATSAVADGVTLRTAKYLTGNFIPIVGRMFSDAADTVLNASLLVKNAVGLAGVLILVILCAFPALKI.LVLALIYNLSSAVLQP..L.G.NSPII...SALGTIGKNLLFVFAA..LAT..VG..L..MFFLAITIIIAAG............
A0A1I1TCB9_9BACI/69-388              .................................................ektsiy--------EFVK-DNGAFSIKN.VFLGVIEFLLHELILNGKLLGTLFMLTLFSSILQTMHTAFE.K.SAV.S...RIAYYVVYIVLVYLALNSFYLAVSYANDAIESMSGFMIALLPLVLGIMATLG........NVITVAFFHPIIIFLINVSGVLVSK........FILPLLFLSA...LLLIVNSLN.D..NYNVTNLANLFKNVGMGTLGVFLTVFLGVMSVQGASSAVQDGVAMKTTKFITGNFIPVVGRTFTDATDTILSASLLLKNAVGIVGVVIVLLVAIFPAIKI.FAIALVYKLASAVLQP..I.G.DGPVI...TTLDTISKFIVLVLAC..LLA..VT..L..MFFLSIVILVAA-s...........
A0A2D1SV23_9BACL/1-296               ................mdyflsmfsqpiqsiltsiaftalyiflyllliavipqq----------------------.-----------------------------------------.-.--T.-...AIIEQLFILLFIAMFAQKIMDAFLVLSELITVLQSFFILMIPIISTMLIAVS........TIFTFIAWNPVIIMVIHFLLFICTK........LLIPSLLIAL...FLDVCTKIY.P..AISFSKAADLIRSSALSIIVASVLALTSILSFSGVAFFQLNDAVKSPIKKLVEQNIPLIGNLIVEGLSLFQKTQSTISTIFGISFLAIVWSAAFYPAMTL.LLHALMFKFIGALVEP..F.S.NTRIS...SLFDDVGKTLMVLCAValLLG..FS..I..IFIVMLCIVL---mq..........
R6D1X6_9CLOT/1-115                   .....................................................ml----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..---------------------------------------------KTSKFLVGSFIPVIGGTISDAVGAAKGCVQVLKSVVGSFGILVAVLSFLPALLEV.CLWYLAVRVLAWVGLM..L.D.AKEVS...SLLSSIAQTFSILLAM..IGC..FM..L..LVLVSTTLMLMMT............
H5XSJ2_9FIRM/64-383                  .....................................................fs--LIRTFEE-LKSGELSLKPEN.LGKTLLSVLGHQVLGTAPLIGKLLILAVLGAVLGQLQVAFG.-.GSV.G...KTAQVMTYLVLLSLAITSFKESLDIATGAIDQMVGLMQTMFPVILTLLVTMG........NLTSAALFKPLIMGSLTVLATIIKT........VILPLFFLAA...VLKLFNNIS.E..QFKLSKLAGLFEFAGKVALGGIMTVFIGVMTVQGVTGGVADSVVFRTAKYSADL-VPVVGKFFKDAVELVITSGLLLKNAVGIVALLAIIIICLGPLIKI.LAMILVFRISAALIEP..L.G.EKPLA...DSLQDMSKSLIFILVT..VAS..VA..V..MFFMAVAVAVGTG............
A0A1T4WHQ3_9CLOT/54-376              .....................................................le--PKEFVEEFIKSGNSKISFKK.VSQALLTYTFKDVVALFKSMAILIVISIVCALLNNLQNSFS.K.NDI.G...NIAYFACYALMIVIISKSFYGAASVAKDTIIKITDFMAAIIPVLMMLLATVG........GFTQATIMDPIIITVINISSRIYIN........IIIPIIFMSF...VLQFVNNIS.E..EFKINKLTKLLSQIALWAQGIIMTIFIGVLTIRGITSKTIDQVTAKTAKYAVDNFVPIVGKALSDAISTVAGYSLLLKNAISGLGLIIILLLVIFPVFKI.LAMSFVYKLTAAFIEP..V.S.DSRIV...SCLTSVGDALILLMSC..VIS..IS..T..MFFIMITIIASAG............
A0A060LZ34_9BACI/69-389              ..................................................sqkgs------LTDFLT-GEKTFDLKE.WFIGFIKYLLHELVLNGKLLGMILLLTIFSYILQSFQSAFE.Q.HTV.S...KTAYAVTLLVLCMIAMNGFHSAMTYAIEAIDAMIHFSIALLPMLLALMASLG........GLSSSALFHPVIIFLVHTSGILVKT........FVLPMLFISA...VLGIVSTFT.D..DYKVTRLANLFRILSLGLLGVFMTVFLGAVSVQGTTAAAADGLTLRAAKFIAGNFIPVVGRMFTDATDTVMSASLLLKNTIGMSGLVMLLAICAFPALKV.LSIALIFQLSAAVLQP..L.G.NGAII...DCLAIIGKAVLYIFAA..MAL..IG..F..MFFLAITIMVAAS............
A0A1G8JL15_9BACI/87-405              ...................................................rgdl-------SDFLQ-GERQFNPAD.WGQAFLRFLLNEITANVTLLGTLLLLTVFTMVLRALQNAFE.H.AAV.S...KIAYSVTFTVLIIIAMNSFYVAMSYAQEAVESMVNFLIALLPMLLALLAMTG........AASSAALFHPLIIVLVNTSGLLIER........LVLPLIFVSA...LLHVISTMS.E..KFQLSKLATLIRNVAMAVLGAFLTVFLAAISVQGATAAVTDGVTVRTAKYIAGNFVPVVGRMFTDATDTVIGASLLLKNTVGVAGLAILFIIIAFPALKI.LALAVIFQMSAAVMQP..L.G.GGPLG...DCLSIFAKTVLFIFAA..VAV..VS..L..MFFLAITVIITSG............
A0A1U7M9H5_TISCR/51-371              .......................................................FNVKDIVKKIVK-GEKIIDSEA.IKKNIADIFLKEIKIALGLLSKILIISIISSILNNLQNSFE.N.SSV.S...ELSNIITYIMIAILVITSFNDIIEMAKLSIDKMISFMQVLLPLLLSLLVIGG........GPNTKIIFHPMILSTVNIIGIMIKN........FIFPLIYFSF...IISILSNIS.E..RAQFKNLTDVARKVIIFTITGFFTIFIGLLTIYGLS-SKIDGISIRTAKFAIDNAVPIVGKFLSDSVDAVIGSIGILKNGIGIMGLMVLGLIILLPMIKM.AVILLVYNLTSAIIEP..I.A.SKNIV...KFFEDVSKSITLILIS..TMS..LG..I..MFFITITIIVEA-g...........
A0A1I3QAP5_9BACL/70-388              .............................................nlpslfdlll-----------S---EKWSMKE.VLAALGRYLFHEVIYNGKILGTIIVLAVFCMILQTLQTAFE.Q.NQV.S...KVAYAIVFMVIIILAVDSFYIAVDSAKQAIQHMVDFMLALIPLMLTLLGTMG........NFGSVTLFHPLIIFMIHMIGTIIYL........FIFPLFFLST...ILSIVSSLS.E..KYKVNQLAGLLKKIGITLLGGMLTIFLGVLSIQGVTAAVTDGVTIRTAKYITGNFVPVVGRTISEAADTVVSASLLVKNTIGLAGVIILLLISAFPAIKI.LSLAFIYQFSAAIMQP..M.G.NSPII...ESLSTIGKTFVYIFAA..LAT..VG..L..MFFLAVSIIIASG............
A0A0J6FYV7_9BACI/63-383              ..................................................sqkgs-----FM-EFVK-GEKKLSLKA.YLLGLVKFLFHELLVHGKLLGSLILLAIFSILLQNMQNAFE.H.KAV.S...TVAYGITYMVLIILALNSFHVAIQYTENAIANMMGFLLALIPLLLALMASVG........GVASVAFFHPIVLFLVNTGGLLIQK........FVLPMLFLAA...VLAIVSTIS.E..HYKVTQLSNLIRNIAIGTLGVFFAIFLGVISVQGATTAVADGITIRTAKFVTGNFIPVVGRMFTDATDTVLSASVLLKNTVGLAGVVILLMICAFPALKV.LSLVLIYNIAAAVIQP..L.G.GGPII...QSLNVISKSILFIFAA..LAI..VS..L..MFFLAVTIIIASG............
W4VCU7_9BACI/1-173                   ......................................................m----------------------.--KGFLRYFLYEIVENGKLLATLMLLTLFCLLLQTIQNAFE.N.QVV.S...KVAYAIVYVMLIIIALKSFQLASSYVLETVEMAKNFLIALLPLLLGLLASLG........HLVTISFFHPIIIFLIHASVFIISK........IVLPLFLISA...ILQIVSTIS.P..EYKATKLANLIKNIAISLMGDFV-----------------------------------------------------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------ncvfrsyl....
X2GMT5_9BACI/1-297                   .....................................................mq----------------------.--EQLLSFFVDPFFLLLKMTLILCGYVIITLIVNMLLPEFE.K.G-T.R...ILFFLIVLATIGPVVVNSFQLIDEIA----QGLSHIFTAFYPILTSSFLLSS........SITAIASWQPFLLFFVQVLTIISSK........WLIPGVLFAI...VFDVCSVIV.K..EISFTRIAELIRFTIMSIVSASVICYIILMSASGVAAFSVNKAVAEPVKKLIEENIPVVGSFIVDSFSMFQHMTQFSTSISSISAFIAVITVSFIPTVQL.VVSAYSLKLLAAILEP..I.A.FDDIC...KLLDHVSKSLFTLCAV..SFL..IAfsF..MFSCFFLIV----fvq.........
A0A268IJ33_9BACI/71-391              .................................................sqkgsl-------YDFLK-GEKKFSIKE.WFSGFMKYMFHEFLVNGKLLGTLIMLTIFSMFLQSLQNAFE.Q.STV.S...KVAYSIVFMVLVIIALNSFHVAIEYTTDAIQTMTSFILALIPLLLALIASSG........GVISAAFFHPVILFLMNISGTFIQF........IVLPFLFLST...LLNIVSTLT.D..HYKVTQLGNLLRNWSIGLLGLFLTVFLGVISVQGASTAITDGVTIRTAKFITGNFIPVIGRMFTDATDTVISASVLLKNTVGIAGVAILLLIVAFPAIKI.LMISFIYKFAAAILQP..L.G.GGPII...KCLDIISKSVIYVFAA..LAI..VS..L..MFFLSLTVIIAAG............
Q5KX97_GEOKA/62-380                  ...................................................kgpl-------TDFLS-GDKQWSPAE.WLKALARYLFYELQVNGKLLGTLILLAVFSTVLQSLQNAFA.Q.QEV.S...KIAQAVVYMVLLLIALNSFRLAADYALEAVRTMSHFIIALVPLLLALLATSG........GVASAAFFHPIILFVMNTTGTVVEY........VTLPLLLLAA...LLSVVSTLS.D..RYKATQLADLLNKASLGLLGLILTVFLGVMSVRGATAAVADGVALRAAKFVTGNFIPVVGKLFTDAADTVVAASMLLKNTVGLVGAAILLMIAIFPAVKI.FAIVIVYKLSAALLQP..L.G.GGPVL...SCLNIIGKSIAYVLAA..LLI..VS..L..MFFLSLTVMVMAG............
D9QRW2_ACEAZ/75-396                  .....................................................lt--LDDMISL-FTNGEMDFKFKG.IITGLLEYLFKEIVVNLELLGKLIILAVISAVLKSFQNSFA.E.ENI.S...RLVNSIIYLVLVIVALNSFKVALNIGQETIDNMVSFMQALLPTLLTLLVAVG........NVTSASLFQPITFLTVNLLSVLIKN........IIFPLLLLGV...ILSIVNNIS.D..NFDVSGLADLIREVNISLLGSFLTIFIGVMVVQGAAGAVGDGITIRTAKYLSGAFIPVIGGMFADALDMIIGGSLLIKNAIGILGVIIIFLFCAFSVIKI.AALIFVYKFARAVIQP..I.S.DSKIV...ACLNDLSSSLILVFAS..VLS..VA..M..MFFIMVTIIVGV-a...........
A0A078KNP9_9FIRM/64-383              ..........................................kagiksgdkdtla----------------RFTPAN.IFGALIDAVKSAAKSPLKAIAAVTGILLACALLATLKNSFA.E.SSM.H...NVFNVVTALCVASVILVPITQCISFCATVIKQSSTFMLAFIPVYTALAAASG........HPASAIATQSLLLGSSEILSQIVST........TFVPMADIYL...AFCVIAAVS.P..QINITGIAEFIKSAVSWALGLCLTIYTGILTVQGAIASATDNVTIKAAKFVVDGSIPVIGGAISDAMNTVISCAGLLKTSVGAYAIVVLILAFLPPVLEC.VMWLLATDISLAVANI..L.N.ISNMN...GMLKAIKEALKLIIAL..VIA..SA..L..TFVISVSVMLL--lg..........
A0A0V8QFD7_9FIRM/59-379              .......................................................FDLGSYIQKIFS-GEESFSLDS.IWGYLKEGLVKEFEKDRNQLLRVVVIAVAAAVFTNFSNVFK.S.NQV.A...DTGFYVAYLLMFSVLAASFFEISKTASLVLESLADFMKALAPAFFTTVTMAS........GAGTSLLFYQIALVVIWLVEMVLLK........LILPLIHIYF...VLHLLNHLM.E..KDVLSKTTQILEEGVNWSLKAMLGLVAGYNFIQGIMLPAADELKRSGLMRAATA-IPGVGNAIGSVAETVLGAGVLVKNAVGLGGIMALLLLMSGPVGKL.FCYMLFYRLGAALVQP..V.S.DKRIL...ECMSGASVAAKLLLLT..VCT..GG..A..LFLLTIAIVMSAT............
W4PXL7_9BACI/66-386                  ...................................................sqkg-----TFMEFVR-GDKQFSMKE.WGIGLLKFLLHELLVNGKLLGSLILLTVFCMILQSLQNAFE.Q.QTV.S...KVAYAITYMVLMLIALNSFHVAITYAQEAISSMVHFMIAMLPLLLAMMAAIG........NITSAALFHPLIIFLVNTSGLLIQH........VVLPLLFLST...VLSIVSTLT.D..HYKVTKLANFLRNLAIGALGVFLTIFLGVISVQGAATAVADGITVRTAKFIAGNLVPVIGRMFTDAADTVLSASLLLKNTIGIAGLGILLMLCAFPALKV.LSLAIIFNLSAAILQP..L.G.GGPII...ECLSIIGKAVIFVFAA..MAV..VC..L..MFFLAITIMVAAG............
A0A1N6PHJ1_9BACI/41-354              ...............................................tqfdlssf-----------------FSIDH.WLSMIKSYFFFEVKESAESLALIFLLAIIASVLKTVGQALE.T.QTV.T...RTAEAAVLIPIFILTMSTFRMAVESVSAAVEQMTVFMMAFMPILIALLTISG........AVASAALFPPLLLFMMNASGLLIDQ........IILPCLIFSV...VFSLVGLLS.D..HYKADRLASLLRTISVSLLSAFMAVFLAVLTMRGMTAAAADGLTVKTAKFITGTFVPVVGRMMADAADTASGAALLIHNTAGAAGIGLLLLTALFPVLKL.MVLVLLYKAAAAALQP..L.G.DSAAA...SLLDVIGKTLSFMLAS..LAL..VS..F..MYFLFMAAVVSAG............
A0A263BVQ8_9BACI/63-383              ..................................................sqkgt------FYEFVS-GEKKFSIKA.WFQGVLSYLFHEILANGKLLGTLIFLTVFSAILQSFQNAFE.R.HSI.S...KIAYAIIYMVIIILALNSFHVAISYALTAITNMMSFIIALVPLILALMASTG........NVISVAFFHPLIIFLVNMSGLLIKN........FVFPLLFLSA...ILSIVSTLT.E..HYKVTQLAQLLRNISIGALGVFITIFLGVLSVQGATTAVADGITIRTAKFVTGNFIPVIGRMFTEATDTVLSASILLKNTIGLIGVSILILIAAFPAIKV.LSLAIIYKLAAAILQP..L.G.AGPII...DCLSIISKSVIYIFAA..LAI..VS..L..MFFLTITIIISAG............
R7ZDK6_LYSSH/1-297                   .....................................................mq--------------------EQ.LLSFLIDPFFLLLKMTLILCGYVIIILIVNMVLPEFEN---.-.-GT.R...ILFFLIVLATIGPVVVNSFNLIDQIA----QGLSHIFTAFYPILTSSFLLSS........SITAIASWQPFLLFFVQVLTIISSK........WLIPGVLFAI...VFDVCSVIV.K..EISFSRIADLIRFTIMSIVSASVVCYIILMSASGVAAFSVNKAVSEPVKKLIEENIPVVGSFIVDSFSMFQHMTQFSSSISSISAFIAVITISFVPTVQL.VVSAYSLKMLAAILEP..I.A.FDDIC...KLLDQVSKSLFTLCAV..SFL..IAfsF..MFSCFFLIV----fvq.........
R6P452_9CLOT/64-374                  .....................dfatmldsspkaifslmaeitegclkaplagamk----------------------.----------------------AVAAVMLISVCGGF---FP.N.DERsR...AVMGCVCGCFLMLSVFSGGVSTVKAGVSAISACAVFEKALIPVLAGVMTASG........NPAAAVSVQGAAFAAAETLTALAEN........FFLPLIGVTA...ALGAVGAML.P..TLRLSAVSDLIRKTVSSVIGICAAMFSGLLSIKCVIAGSADSLTARGVKLAANTFVPVVGGALSEAYSSVAGSLALMKNAVGAYGAIALFFIAAPPAVQL.ALWALAMRAASAVAEL..L.G.CAQQA...EMLKNIGYVFAMTNTL..LIL..CA..A..VLMISAGTV----lvik........
A0A024P6B1_9BACI/62-381              ..................................................htndf-------REFIQ-SEGSVESSD.WFSGILEFFLHELLLNGKLLASLLFLTLFSTLLHSVQSAFE.N.SVV.S...KIAYMVVYLVLLTLALESFRHVIEYTLGAIERMSSFMIGLIPLLLGIMASFS........HLMSISFFHPIIIALVQSSGLLVKY........LLIPLFASSA...LLLIVGSLN.E..TYKVDQLAELLRKAGMAIMGVFLTVFLGVISVQGTVTAVQDGITMKTARFVTGNFVPVVGRLFTDATDTILGASLVLKNTLGIAGVVILLGIAVFPAIKV.LAIAIIYKIAAALLQP..L.G.DGPVI...QAMDVVSRHILYIFAA..LLM..VS..M..MFFLVIVIMVAAS............
B0PBE0_9FIRM/125-440                 ..............................................teidykqll----------------TLSPSQ.FFGSVWELVIQRLRAPLTVFASVLGTVLLCALLDCLKTSLW.E.GSL.S...TVFTAVSVVCIAAAVVSPITDCITTTVAAIHDYSNFILSFIPIFSSIVTVGG........QAVTATTYTAFLFAACQVVSQIAAN........MLVPLMGIYL...AFCIVGNLA.P..GIDITSVAKTIKSTVCWALGLLLTLFVGLLSLQTMVASGSDTVASKTAKFLIGTFVPVVGSALSDAFVATQGYMKLLKTTVGAFGILAALLTFLPVLLQT.ALWYFTVNITSAVGEM..L.G.VKQVA...SILKSASATLGVLIAV..ILC..FA..L..LFVISTSLVLMV-s...........
A0A1Y4M9Z6_9FIRM/51-361              ..............................................vygesldeg-------------------LQG.LVETGKGEMFGIVRAGVRSATILFVILLLCGLAQTVYDAGG.G.EEI.P...-VVSLAGALAVTVAAVADMSSLLGLGCTAMERMTAFATVLLPVVAGATAATG........AIAGAAARQMAAAGFSSLLMNVIQR........VLLPMVYGYV...AASVAWAAL.G..NPGLKQMAGWLKWVATSVLVVLMMVFVGYLSMSGVVSGSVDAMSMKVAKFAISGAIPVVGGILSDASETILASAGILRSSVGVFGMVTILGICLVPVLQL.LVHYLLYKLVAALAAT..I.G.QSRVC...GLVEQIGGAFGLIMGM..TGA..CA..L..LLLVTLV------ssvsa.......
J7IN72_DESMD/64-383                  .......................................................FSLVRMFED-LRSGKLSLKPEN.IGNTLLTLLGHQILGTGPLIGKLLILAVLGAVLGQLQVAFG.-.GSV.G...KIAQVMTYLVLLSLAMTTFKEVIDIATGTIDQMVGLMQTMFPVILTLLITMG........NLTSAALFKPLIMGSLTVLATVIKT........VILPLFLLAA...VLKLFNHIS.E..QFKLSKLAGLFEFVGKISLGVIMTIFIGVMTVQGVTGGVADSVVFRTAKYSADL-VPVVGKFFKDAVELVITSGLLLKNAVGIVALVAIIVICLGPLIKI.LAMILVFRISAALIEP..I.G.EKALA...ESLQDMSKSLILIIVS..VAS..VA..V..MFFMAVAVVVGSG............
U2DCH5_CLOS4/69-383                  ............................................dltgesalsfl------------------DLPK.LLGSLWESIKTTAKEPIRILALIVVTILVCAMAESMKSTFF.S.ESL.S...PVVSVVAALCIAVSVVAPVYRLIQDLNQTLLSTNQFIATFAPIYSTVAATSG........QPLTATAYSGVLMLVVQGVSAICSS........TIVPLLGLML...AFSVTGAVQ.S..DLRVSAISGGLKNAVVVVLTLLLTIFCGVLSMQSFVTSASDNLAMKTGKLLIGNMVPIVGGVVSDALSSVYGCLKVVKNGVGVFGIAAVVVSFVPLLLRC.LLYKATLWAGAFFCDM..L.G.VSSVR...DTLKSIGNCLTIAVAL..LFT..YA..L..LVIITTVIVMM--g...........
R9NDZ7_9FIRM/81-400                  ......................................................i-DADELLFMIME-GKFLEAFTM.LTGWIREALAGEMEGIRRIFIYILVLGVVSALFSGFSDLFV.G.QQV.A...QAGFYFLYIFLMVIMTRVFLFVSQIAVSAVENIVLFVKLFIPTYFVAVGAAQ........GAASAVYYYQMMLIIAYLVESFLNT........VLIPFIYSYV...ILALLNGLW.A..EEKLSLLLEILEKGIVMALKVSMGIVTSLSLVQAVIVPVASQLKISAMRKAISA-IPGIGGVAEGVTELVMGSAVLIKNSMGVLLLVLIFGACILPLLKI.VVVTATVKLGAAVTGI..V.S.DKRIA...SCTNRVGVGCFLLFRC..VFT..SM..A..LFIIVIAVVS---yt..........
A0A089IS13_9BACL/87-406              ....................................................tps-----LMDMLLP-GDKGLSLQG.VLSGLLGFMWHEVLYNGRLLVTIVMVSVLSMILETLQTAFE.R.KTV.S...KVAYTLCYMVVLVIAVNSFNIAIGYAKDAIDRMIDFMMAMIPLLFALLASMG........NIVTVSVTHPLIVFMIHTVGTLIHT........IVFPLLFFSA...VLHLVSALS.E..KYKLTQLANLLRNIGAGLLGVLLTVFLGVISVRGITSSVTDGVTIRAAKYITGNFVPVIGKMFADATDTVISASLLVKNAIGLSGVIIILFLCAFPAIKI.LVLALIYNVAAAVMQP..L.G.ETPIV...VCLQTIGKSMVYVFAA..LAA..VS..L..MFFMAVTIMLTAG............
R5YSV4_9CLOT/23-342                  ......................................................l-DINEILSSAIS-GK--IDNTK.LWTGTLKIFGKELQNAITILGSIILIIIINSILNCITEGLE.N.KSI.S...QIAFYVQYILIVTIVLTNFSDIISLIKESIQNMTSFTNLLIPIMMTLIITTG........SVTTATIIQPILVFMISLIGNFINN........IAIPIVLVST...ALGIVSKIS.N..KVQIDRLAKRLKSSTIWIIGVILTLFVTLVSVDGTLSSSVDAVTSKTAKAAVSNLIPVVGKILGDAVDSVIGCSSILKNAVGIVGVIIILAISIGPIIKL.LLFMAIYYIGAAICEP..I.A.DEKVV...KLLDTMGDTFKILLGL..MFS..MS..T..MIIIGTTLIVKI-s...........
A0A1V2YI91_9FIRM/60-381              .......................................................FDLQEEVMLILS-GQKQFSLQS.VLNYLLDALFGEIYAYISIIVRFILIIVLCHILNNLSTAFE.S.KNT.T...KVAFFVCNIVVFYSVAQSLVLVVELAHQTIDNLTSLMLVILPTLLAFMATSG........YIATSAALSPVIVSGLTAVSFVIQY........FLLPSVVGII...ILQMVSSMS.D..EFKIDKFIGLFYKYSKSFLKLIFVLSMAIMGIYKMSLPYVDVTLKRVGLTLSAKFIPILGDAVSGAIDLIIQMSGMIKNAFGIGVILWIVILIAMPLVKM.FTYILLYHFAGAIIEP..L.G.DKRMA...KMATDIAKGCEFVMSC..VGV..VA..I..LCIVALVICMSI-g...........
D4W1Q6_9FIRM/30-345                  .............................................yldksnllkv---------------ENFNIVG.FFKSIVEYAMYELNVSFSQFKMILIFLLVIALFQNIQTTFS.-.TRY.E...KITNTVLKLILIVQLFGLFVFYHDYTLDILTRYMDIVVAVFPILLSMITITG........ALWNHALFQPAVVFLINVSYFFINA........VSLPLTVIGT...IFGFVNQIG.I..EDLYSRLTNFINKIALWTLGGYFAFFLTLMSIQNVTLSFADGLFFRTTQTLMNY-IPVIGSRFTDTVVSIISTLSIMRNSVGLLSIITLVIFVSFPIVKL.GIATILFRLLTAIIQP..L.V.SKDFI...NVLDIFNTGVMNLLVI..TII..IA..V..MFIFTFFIILYS-s...........
R7G461_9PROT/69-389                  ......................................................s-SVSRLLKKLIK-GDGIGDYDS.VFKYLFSLIFSGIKENLLVFVSLFVILVVCSVTGCFGS-EK.L.EGV.G...ELTRLIGFSIVACIVASFGVTVVESAKSACEKLVKTVQGCFPFLLAFITASG........GTAQSAVYSPSTLFIQNFITSFICK........ITFPCVTTML...ALSIISNIN.K..EIKIKGFIEFLSGFMKWVTGLVGAVFTVFTAVKGFSAGVVDGIGIRTLKYAVGSSIPLVGGILSGGADVILSAFILTKNAFGIFMLILIFGAVISPIVET.AALTLSLRLLGAITQP..I.T.DERTY...FFIKSCVSALNHALAG..LVL..VA..V..MYAVNVLVMIAA-s...........
A0A0A5I3V8_9BACI/66-385              ................................................rkgsfme---------FVE-HSDSVSIKS.WIMGLGKYLLYEFIMNGKLLGTLMFLTLFCMILQSLQNAFE.N.QAI.S...KVAYAVVYLVLIVIALNSFHLAVSYAKDAVEMMSSFMIALLPLMLGLMATFG........NLMSVSFFHPVIVFLIHTSGLLVSN........IIFPLFFLSA...LLSIVSSIN.D..QYKVTQLAQLLRNAGLGLIGVFLTIFLGVISVQGASSAIADGVAMKTAKFVTGNFVPVVGRMFTDATDTVLSASLLLKNTVGIVGVIIILALALFPAIKV.LAVAIIYKFAAAILQP..I.G.GGAVI...QSMETISRHILLVFAA..LLV..VT..F..MFFLAIVILVAA-s...........
C4ZD09_AGARV/59-377                  ......................................................l-SFSDIVDAILA-GDQK-AGEK.ICEYIYELFFYEIAAVKPVIINVLCYTILFMVFSRLI-FWR.Q.DYV.Y...NVSFLFMYASVISMLMASFFVLSDVAKGCIDVLLTYLTALVPAYATVLLASG........KGFSASGFYMLAFVLIYVVEWLIKL........VLIPGIHLFL...VLEVLNHVS.S..EKKLEKLAEFIESAVTKIMKASIKIVAGIGIVQAMIAPAKDKISESLILKSFQA-IPGVGRLGQGAGEIMLGCAMLIKNSVGMAAIIVLFFIVLTPLVKT.LIFSLMYRLLSAALQP..V.S.DNRIV...EGIEAVARAGNLYYIV..IRD..AS..I..LFFIVIAIVCAST............
G2G099_9FIRM/64-383                  .......................................................FSLTRIFDN-LKTGKLDLRPEN.LGQTLLAILGREVLGSAPLIGKLLMLAVLGAVLAQLQVAFG.-.GSV.G...KTAQVMTYLVLLSLALTSFREALSVATGTIDQMVGLMQTLFPVMLTLLISMG........SLTSAALFKPLIMGSLTVLATIIKT........VVLPLYFLAA...ILRLFNHIS.E..HFKLSKLAGLLEFAGKLSLGVIMTVFIGVMTVQGVTGGVADSVVFRTAKYSADL-VPVVGKFFKDAVELVITSGLLLKNAVGIITLLAIIVICLGPLIKI.LAMIFVFRISAALIEP..I.G.EKALA...ESLQDMSKSLINILVT..VAS..VA..I..MFFITVAVVVGTG............
R6FWF5_9CLOT/67-389                  ....................................................ldp---VSYIKNYISTGKGNLSFSK.ICDAAFSLLFKEVKTVLSMCIIIVVIGIICSLIKNLQSAFS.S.ESI.S...EIAFYACYALMIIVLTRTFIISLDLAKDIITQISGFMSKLLPILVVMLGVAG........GFTESATMDPIVLGTTIIIPKIYLN........IILPLILITF...VLQFTNNIS.T..EPKISNLCSLVKSSVLWIQGLILTVYIGLLTVRGITASTIDAVTLKTAKFTIDNFIPIVGKTFSDAIASVAGYSLIIKNAIGSVGLLVLILIILYPIIKI.FLSSIILKISSSLLEP..I.A.DKRIT...KAVFSAGDSLILILSS..VLC..VS..L..MFFVLIAMMVSAG............
A0A1H1BHE4_9BACI/65-384              ...................................................ekts------ISEFIK-DNGSFSIKN.TLWGFIEYFLHELIMNGKLLGLLLMLTLFSMVLQTMHAAFE.E.STV.S...KIAYFVVYIVLIFLALNSFYLAVSYAKEAIDTMSGFMIALLPLVLSIMATLG........NVITVSFFQPIVIFLINLSGVLVSK........FILPLLFLSA...LLLIVSSLN.D..NYKVTHLANLFKTVGLGALGMFLTVFVGVMSVQGASTAITDGVAMKTTKFVTGNFIPVVGRTLTDAADTILSASLLLKNSIGIVGVLIIVLIAVFPALKI.FAIALIYKLAAAVLQP..I.G.DGPII...TSLNTISNYIVYILAC..LLA..VT..L..MFFLAIVILVAA-s...........
R5NLQ4_9FIRM/55-374                  .......................................................INFKEIVNDFML-GDANGGLKA.IWTYVKDVLFDEIINNFRVLKKILYISILAAILTNFMKVLK.N.SQV.S...DTGFIVCYMVIISLVITSFTALSALAYMTIKRMTEFMKALIPVYMVSVGVSD........GQVYAASYYQMALVVITIIDICCLK........LLLPIIDIYV...VLSIVSNLH.S..EDYLSKACTLIKNITSFSVKAMLSVVMAINVIRQMFSPVSDGIRNTTVTNVLGI-VSGMGNSAGNIASLIYGTGNILKSAIGGAGLIVLMMIVLIPIVKI.VIFVFSYQFTNAFLQP..V.S.DDRII...KCMEGISEGAILMLRI..VFS..VS..L..MFVITIAIVCM--g...........
A0A1I7H646_9CLOT/72-394              ....................................................ldp---VEYIKSYIKTGKGNISLSD.LIKAVINLLFKEVNSVLSLAISIVVVAIICSLLKNLQGAFS.S.KGI.S...EIAFYACYAVVIMILSKSFLIAISVAKDVICNISDFMAAILPILVTMISLVG........GITEAATIDPIVMGAVIIIPRIYQN........LIIPLILISF...VLEFTNNLS.G..EHKISNLCKLVKQSIVWIQGIIMTIFIALLTIRGITSNTIDAVTLKTTKFAVDNFVPIVGKAFSDAISSVAGYSLIIKNAVSGIGLIVIILIILYPIAKI.VLMSFVYRISASLIEP..I.G.DKRIT...SVVSAAGDSLILLLSC..VLS..VS..L..MFFVLIAIMANAG............
A0A136WEU2_9FIRM/45-364              ......................................................t-SFSSLVRDIIS-GEFSFTFKD.LPHTIGNMAFGEFKTQGRLLTQLLLVVILSAVLKQLSGSFH.G.KSV.G...EMGFYVCYMVLIVVIITSFYSIASVVVERIDQTCKVFLGMLPIFLVLSVSGG........NFTQTALMGPTIMGGSTVLSFAIKG........IIVPAILLAV...AMEMADHIS.E..KPMLSRFAELFRQGIAWALKGTAIVFMLLLSLQKVGGGAINGLAAKTAKIAVGS-IPVVGDVMGGAVETAAAVAGTLKSGTLAAAAIFLLLLCIPLLVKL.AVILLVFKITAAAAEF..I.C.EERLV...DCISAAGDYTALLLGV..VFL..TE..G..MFLFSALLLL---gg..........
R6QXF8_9CLOT/61-373                  ................................................setsils----------------SVSISD.VFGEITNIALNEATSPFGAIPVCIGIIILCSLVEGFKVAL-.V.SSM.G...GVGSTVGTLCVVACIVVPLCGVIQETCEIIKGACGFMTLYIPIMGGLMLSAG........EAISGTSYCTAMMTAAQTISALSAN........LFLPLLNIFL...GVSVMSSIS.P..RMRLSSLCDMLYKICKWTMTFCMSVFVSVLTFQSVITTRADGAGGRALKFAVSSFVPVVGGALGESLASVRGGLKLLKSGSGVFMIFGIAFMFLPVLIRC.LLWIFSLNISASIGDI..L.G.TDSVC...KLLRSASKVVSTITAV..LLC..VM..T..VFILSTVLILII-g...........
A0A1H0JRC3_HALAD/62-381              ..................................................htnnf-------REFIE-SESSVESSD.WFSGILEFFFHELLLNGKLLASLLFLTLFSTLLHSVQSAFE.N.SVV.S...KIAYMVVYLVLLTLALESFRQVIEYTLGAIERMSSFMIGLIPLLLGIMASFS........HLMSISFFHPIIIALVQSSGLLVKY........LLIPLFASSA...LLLIVGSLN.E..TYKVDQLAELLRKTGMAIMGVFLTIFLGVISVQGTVTAVQDGITMKTARFVTGNFVPVVGRLFTDATDTILGASLVLKNTLGIAGVVILLGIAVFPAIKV.LAIALIYKIAAALLQP..L.G.DGPII...QAMDVVSRHIFYIFAA..LLM..VS..M..MFFLVIVIMVAAS............
D4LE94_RUMC1/58-369                  ..................................................pqsvl----------------TLSPKE.LLCSMWNTFRAQLAAPLRLFFTLGLVVICSAFTSGLGDTIS.D.RGL.S...GAYGFLVAMVAVSVLLTPMEQCFFMVSDTMESGSRFMLSFAPVLSSILAAGG........GVVSASVYQLAVFSLAELAVQLTCM........YLMPLLRILL...ALGIMDAVH.P..DFSFGSIIRGVKRVAQWGLGLVMTLFVGLQTVQGMVSASADTVATKATKFMLSSCVPVVGGAVSDAYTTLRGSVGVLRSGVGGVGILALGAMVLPPILLL.GLYRLSVLAAGTLAEL..A.G.VRSLS...KLLHSLEQVLSLALGM..LCT..FV..F..LLLLSTAIVIIAG............
U2NQH8_9CLOT/60-381                  ......................................................l-NISDYIKNYISKGDGGVSTSD.LVKITFSVILKESKTVLKLLISVVVMAIICSLLKNLQDAFG.-.GSH.S...DIAFYACYAILIILLSKSFLVSIDLAKNTINGLTDFMMALLPVLVFLIGSVG........GITQAATMDPILMGAVTIVPRIYVD........FIIPMILMSF...VLNFVNNIS.N..EHKINNICKLFKQVTLWVQGILVTTLIGLLTIRGITSNAIDAVTLKTAKFAVDNFIPIVGKAFSDAIASVAGYAVLLKNSISSLGLLIVFLTILIPILKL.VLISFMYKLSSALVEP..V.C.DSRIT...NCIAAAGDYVVMIISC..ILS..IS..L..MFFIMVSVMAST-g...........
R6NKY7_9CLOT/65-384                  .......................................................IDINEILNDAIK-GE--VDNST.LLKKILNILGKEVTTNIKSLVSILAIILIHSILKSISESLE.N.NNI.S...KLIYYVQYILIVTVIMSNFTDIIKLVQDTTGNLIGFMNTLVPLLITLMMYTG........SITTSSVVEPIILFMINFIGNIIQN........LIIPFVLVLT...SLVIISKIS.D..KVHIDKLSKFFKSGIVWFLGIVLTVFVGVVSLEGTLSSSIDGITAKTTKAVVSSAIPVVGKILGDAVDTVLGCGIVLKNAVGLVGVVIVIGICIMPILKL.FVLSVSYKLLSTVVQP..I.A.DEKII...DLLEQIGDIFKIFLGI..LCA..IS..F..MLIIGTTLVLKI-s...........
R6B820_9CLOT/1-92                    .......................................................----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..------------------------------------------------------------------MDTVMSCSNILKNAVGIVGVIIILSICIIPIIKL.TTLMAVYYLGSALCQP..I.A.DDKIV...KLLGQIGGTFKLLLAI..MCS..IS..V..MLIIGVTLVIKI-s...........
D3E6L2_GEOS4/76-396                  ....................................................ktp----SLMDMLLP-GGDGLSFKG.VMSGIGKYLWHEVLYNGKLLATIVMLSIMSLILENLQTAFE.K.STV.S...RVAYTICYMVVLVIAVNSFSIAIGYARDAITQMIDFMMAMLPLLFALMASMG........NVVTVSVAHPLVIFMVHTVGTLIST........IVFPLLFFSA...LLHLVSSLS.E..KYKLTQLGNLLRGISMGVLGVLLTVFLGVISVQGLTSSVTDGVTIRAAKYVTGNFVPVVGKMFADATDTVISASLLVKNSIGLAGVIIILFLCAFPAIKI.LTLALIYNVAAAVMQP..L.G.DSPIG...TCLQTIGKTMLYVFAA..LAA..VS..L..MFFLAITILLTA-a...........
A0A1I6PSL0_9BACI/58-376              .................................................sfhlha---------YLT-GTSTFSLKD.YVMSLVPLFFSEVKNTVTILYRIMIYLILSMFVSDFFYSHL.S.TMA.Q...SVISFTLKLLLIKECLTIFHLIENVLSTTVETMYGFIIVLLSSVSGLSLILQ........PLSMMQSLKPLQLLLLPLSFQIFKQ........IIMPLIHFQC...LMALLGELF.E..LLPLQPLAKKMGDWLHFGLSLLLKIYFSFLMLSSSFRFFQTRLSLMQEKHLFSQLYTLTGHWFQETAEMSFLTLGVLRDALGVYGVIALALVVMTPLIKM.TAVYIVLTVFEAMIQT..L.S.QSTLV...AHVTVLNRTILISIRA..LVV..FG..F..LFIGNILVVII--fa..........
T0N8Z9_9CLOT/54-376                  ......................................................m-SPKEFVDAYMKDGQGAFKGKK.LTTIALSYIFKEVVASFKIVGGLIIIAVVCSLLNNLQSAFS.N.ESI.S...NVAYFACYAVLITIIAKGFYVGVDLAHDVILDISNFMAALMPVLITLLASMG........SFTEAMVMDPIIMAACSIGANLYAT........VIIPMICMSF...VLDFVNNIS.D..RYNVDKLTDLIRKCALWSQGILLTVFVGIITIRGITTSSLDLVTTKTAKYAVDSFIPVVGKTLSDAIATVASYTMLLKSSVSVLGVIVLIGMVLVPVIKI.VVMAFMYKLTAALLQP..V.S.DKKIT...AVIDSAGGSLILLSTC..LLS..VT..I..MFFIMITIIAST-g...........
D4KWW0_9FIRM/58-379                  .......................................................ITFSELVKELLYQEKPGALYQQ.IGPWLMGQLCESVCENRKILVEVVLLAVCFSVLKNFAGAFA.S.SYV.S...DLCFILVFCVLAVLMLQSFLTFREIVCGVLEKSVDFFQIFIPTFSIAMLFSA........GESIASGFYQTAFLIIYLIEWLFLT........ILVPMIHIYI...LTVLINYFF.E..EEKFANMMELIGGLIGWAIRSAGIIVLGLNVVQGIVAPAKDRLLYGTAGRAMAM-IPGIGNTVNGVSELLLGSGIMIRNCVGAAGLIVLIILVAVPMVQA.GCMVLFYKIAAAVVEP..V.A.DKRIA...GCLKGMAQGGMLYLKL..MGY..CV..M..LIFLTIALTVAS-s...........
A0A2A8SER3_9BACI/63-383              ..................................................sqkgs-----FM-EFVK-GEKNFSIKE.WMIGLLKYLFHELLANGKLLGTLIMLTIFSALLQSLQSAFE.K.SSI.G...KIADAVVYMVLIVFALNSFYVVMTYARDTIQTMIDFILALLPILLALIATGG........GVVSVSFFHPIIVFLMNTSGMLMNF........IVLPLLLLAT...ILSIVSTMS.D..QYKVTKLSKLLQNVSVSIIGIFLTIFLGVLSVQGTATAVADGIAVKTAKFVTGNFIPVVGRMFTEAADTVLSASALLKNTIGIVGMVILLLIVAFPAIQI.FCIAFIYKFAAAVLQP..V.G.GGAII...QCLDIIGRSIIYVFAC..LAI..VS..F..MFFLSITIIIAAG............
A0A0C2VK39_9BACL/55-373              .............................................trqdllsllt--------------NPQDSFSE.WLSGIVRYVFHEIAVNSHIILWLLIILMIGSLLQTIQQSFS.R.EGI.A...AVSSVAMTGLLLMVVIESVSICVGYITDTVALMADFMYALLPLYLAMITLSG........GVTTAAVSHPLLLFIVQFSHWLMQH........LLIPLFVLSI...LLDIVDTVS.T..SFSTAKMAALCRQIGIWLLGVVVMIYLTIFSIQGVTTSVADGVAAKTVKMIAGQFIPFIGKVVADTTDLVLASSVLAKNAVGLAGALMLGIMILFPAIKI.LVVAFMYRICAVIMEP..L.G.HAGMV...QAVDAVSKGLFHLCAA..LVL..VS..I..MFLLGIVVLLFV-s...........
A0A1Y3W8I6_9FIRM/65-384              ......................................................i-RFADVLETFME-GDVSGALQL.AGKGLLGTLFSVLSENRQAMLHILVIALIAAVFANFSHVFA.A.GQA.A...DAGFFILYLLLITLLLQTFEMMMDAVTSGLQLLTDFMQVLCPVYLMAAAVVT........GSATSVVFYNLMLFLIFLVHNVVCY........LILPLIHVYL...MIRLMDELS.P..EPFLGRFAELVETVISWILKTMLVGIVGMNLIQGLISPVLDQVRRSGLQKGLES-IPGIGNTIGGMTEIIVSALTLIRNGIGVAGAVICVVICLIPVIQI.AVMALLYKLTAALLEP..V.S.DKRVV...GCIAGAGDGAVLLLKT..VYT..SA..V..LFLITIVIVAA--v...........
A0A1Y4TGH4_9FIRM/58-359              ...........................edpwrairdilpgdlaqtmrdsvagyaq----------------------.----------------------VLLFLLVVLLLS----FFA.Q.EGR.A...DLLDLAAAGGSALLCWTALAALAQTVCEKLEGWRMFLLGFIPVYEGVLIAGG........EPTAAAAAGGLFLTGLCLLAQLLCS........WVPPLLHCYL...ALSTACCIS.T..EAALATACRSVGQLFRKGLGWAGRAFGALLGLQRVFTVQLDRTSQQLGQLLTGT-VPIIGQSLSDAAGTVLSGMQLLKSGLGFGAIAVLA-AEFLPLYMIlLVHAALLFGCELLCSA..A.G.ISRCA...ALFNCLREAVQGLAAA..TAL..VF..G..MAVLGTALLFAM-g...........
A0A1Q8Q7K2_9BACI/40-354              ..............................................tedlsvsdf-----------------FSIEK.WVDAFQAYFIFEVTEHAQLLSTIFLLSILASVLKTMGHAFG.H.QTV.S...KTAEAAILIPVFILAMNTFRMAVESASGAVENMTVFMTAFMPVLIALLALSG........AVASAALFPPLLLFMMNVSGILIDQ........IVLPCLIFSV...MFSLVGLLS.D..HYKADRIASLLRTLSVSILSAFMTVFLAVITMRGMTAATADGLTVKTAKFISGTFVPVVGRMMADAADTASGAALMINNTAGAAGIGLLLLTALFPVVKI.MVLVLLYKVAAAILQP..L.G.DSAAA...SCLDMIGKTMSFVLAS..LAL..VS..F..MYFLMMAAVVAAG............
N1ZI06_9CLOT/61-380                  ......................................................p-SFKDCVMNAITEGKL-IDFEY.LFSIFVQKLAGEITTQISMIKKILFIVLLSAILKNVNTSFQ.L.KSV.G...ELGFYVCYMVLIVVITATFYSQTDMVNNTIKSIETFFKAMMPVFMTLSIASE........GYGQATVTAPAIMAGAAILTNIVCY........GILPAIVMVT...SLEMINNIS.E..KPMLNRFTKLFQGVISWGMKGIAFLFMALLSLQKLGGSLLNQGIGKTAKAVVTS-VPIVGDVMGGAVDTAAALTEMIRGGTLIATVVFLALLCAVPLIRL.AIMILIYKIMAAVSEP..I.C.ESRLV...KCISGAGDFSVLLFGA..LFL..VE..C..MFLFSAILLL---tf..........
Q24UY2_DESHY/63-382                  .......................................................FSLAKFFDD-LRQGNINLHPVE.IGKTLLALLGKEILESAPLIGKLLILAVLTAVLQQLQSAFS.-.GEV.G...KMAQILAYLVLMGIALATFQIAMNLASDSIQTMTGFMQTLLPVMMTMLVAMG........NLTTAALFKPIVLGSLTFLATLIKT........VALPLFFLAA...VLKLFNHIS.S..EFKLSRLAGLLEFTGKLSLGIILTVFIGVMAVQGVTGGVADGVVLRTAKYSADL-IPVVGKFFKDAVELVVTSGLLLKNALGIVAIIALALICLGPVVKL.VAMILVFKISSALIEP..L.G.QKELA...DTLQEMSKSLIFIFAS..VAS..VA..I..MFFMAIAVVVGSG............
A0A1H7ZP06_9FIRM/61-376              ..............................................dkidyktll----------------TLSPTD.FFKALWQILLTQLRKPLVILASITGVAVLCSLVEGLNVSIG.Q.RSL.D...TVFNVVAILCICTAVVNPIVECIRSAAAAIQSCADFILSFIPVFVSLVAVGG........QPVSATTYNTFLLLTSEVISKITAN........QLVPLVTIYL...AFCIVGALT.P..SMNLSGAASTAKSIVTWALGLLVTVFVGLLGIQSLVASGADTVAMKTGKFLIGSFVPVVGKALSDALTTAQSCVKLLKTTVGAYAVAVASLTFLPSLLQT.IVWYFAVNLGSTVSDV..L.G.AQQIG...KVLKACATALSLLLAI..IAF..VA..L..LFIISTTIMLVV-g...........
R6HEY8_9CLOT/64-376                  ..................................................dfnki---------------MDINPES.VIENILDTAKKKLPGPLKSVSMILAVILLNAIFTALKISIG.E.KSL.S...AVLGVVSTICICMIIVAPIVEFIGHVAAIIKGATAFLLCYIPVMVGIMVASG........QAISSVAFSSMMVALGDIITQLSSG........FLVPLLNIFL...TVSVVCAIS.P..RFKFSGLCELFSKVIKWILGFSMTIFSGLLTTKSLIGATVDSVNSKTMKFVLSSFVPIVGSALGDAFLTVQGCVKILKSGVGAFFIIAVGFVFLPAVVEC.AVWVLAVNTCAVAGDI..F.E.LSNVS...ALLKNIGKVVSTLMAV..ILC..IM..T..ILIISTVVVLNV-g...........
A0A150YMP1_9BACI/1-295               ..........................................mdtlinvfrepis----------------------.------------------NIIFLIAVVSLYTLVFLIIEAFA.P.S-A.K...SWLESLFIILLVLTIGELVIEAFRIMREFAEILSAFFLALIPVLTSAMIVLQ........SILAFVAWSPLVLFLLQMLMHITNK........VMIPALLAAL...LFDFCSRFV.Q..GISFKKLADLLRMTSMSLIAASSLALSLILTISGVAFFAVDSSVTTPLKKVVEQAIPLVGSIVVQGFSMFQKFQGTATTITGFTMISAFSVASFYPAGTL.LLYAFSCKLLAAITEP..F.T.SSNVS...GLIDDIGNTLFVLCAI..AIL..LA..I..TFIFIWLLL----fvim........
K6D6Y6_BACAZ/70-390                  ...................................................sqkg-----TFMDFVK-GDKQFSAQE.WVNGLIKFILHEFLANGKLLGTLIMLTIFSLVLQSIQNAFE.H.QAV.S...KIANAIVYMVLIILALNSFHVAISYAETAIQNMTNFMIALIPLLLGLIASLG........SLASVAFFHPIIIFLVNTSGLIIKN........ITLPLLFLSA...VLSIVSTLT.D..HYKVTQLAGLMRNIAIWLLGTFLTIFLGVISVQGAAVSVSDGLTIRTAKFVTNNVVPVFGRTLTDAADTVLSASVLLKNTIGLVGVAIILILAVFPAIKV.LILAFIYKVAAALLQP..L.G.GGPII...QCLDIMSKSVIYVFAA..LAI..VS..I..MFFLAITIIVSAG............
A0A168P5H3_9BACL/71-391              ...................................................ktps-----FMDMLLP-GGEGLGIKN.VMSGLTTFFWHEVLYNGKLLVSIVMLSIMSLILETLQTAFE.R.NNV.S...KIAYSLCYMIVMVIAINSFSVAIGYAKGAIDNMIDFMMAMVPLLFSLLASMG........NIVTVSVTHPLIVFMIHTVGTVVRT........TVFPLLFFSA...VLHIVSSLS.D..KYKLTQMANLLQKISVGLLGILLTIFLGVISVQGITSSVTDGVTIRTAKFISGSFIPVVGKMFADATDTVISASLLVKNSIGLAGVIIILFLCAFPAIKI.LTLALIYHVAAAVMQP..L.G.DTPIV...TCLQTIGKSMIYAFAA..MAV..VG..L..MFFLAITILLMAG............
R5MQD4_9FIRM/64-374                  ...............................................idydslis-----------------ASPRK.IITCIIDIAKGKLKEPVKTLGIVLSIAVVAAVVGSFAPSKT.A.EKY.-...-SVGTVCSFLIVSALTVPLASTLSSAASSIALTADFMKGYIPVFAGTVAASG........MTLTSASYSALELAAAEAVSQLSSM........FFVPLTGLIM...MVTLLSSVS.D..NVNSAKIISLLKKIISIVLGVLSTVFVGLVTIKGALASSADSVSVKGIKLLAGNTIPIVGGAIGDAYTSVLGSLNLIKGTVGAFGIFAIAAVNIPVITEM.LLWMIAVNICSALCGL..L.G.EENAA...KVLDGVSGVLSLTNTI..TVF..SA..V..VFILSTGIILS--l...........
R5GTS9_9FIRM/1-169                   .....................................................mg----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...-LSVTGAIH.P..ELNISKLAEMIKKVSVWGLSLLMTVFMSILSAQTFVNNAADSVLIRTAKFAVSNGVPIVGGTISDAVNTVSASLSLLHSGIGTYGIIAAAVIILPSLITV.VLYRLALSAAEAMGSV..F.G.IKELS...ELFRAAGWVMSIIMAV..IVC..FL..L..LNTISAVIMLAIG............
A5I315_CLOBH/59-381                  ......................................................i-NAKDYVKNFMEKGESQISVNK.AAKAITTYVFKEIAASLKLIALLIMVAIICALLNNLQKAFS.N.ETL.S...DIAYFACYALIIIILARSFYLGVNIARDTINKMTDFMMALIPILVMLIASIG........GIVEATMLDPIIIGTINISANIFSK........FIIPLICMTF...VLQFVDNLS.E..DYKINKLTKLLNQVALWTQGIVMTVFVGVVTIRGITSKAMDQVTVKTAKYAVDNFVPVVGKCLSDAISTVAGYSLLLKNSISSLGLIVIVAMLLVPVIKL.LIMAFMYKMAAALIEP..I.S.DSRLV...NSIGAAGDSLILILSC..LIC..VS..V..MFFIMIAIMASAG............
A0A1S2MF38_9BACI/60-380              .................................................nqkgsf-------MDFVR-GDKQFSLKE.WMSGFVRYFLHELIVNGKLLGTLILLTVFSMILQNLQTAFE.K.NAV.S...KVANAIVYMVLLIIAINSFYIAINYAQSAISMMINFMIALLPLLLALLASIG........SLTSVALFHPLIIFLVNTSGLLIQH........FVLPLLFLSA...LLSLVSTLT.D..HYKVSKLANLLRNISVGTLGIFLTVFLGVISVQGAVTAVADGITIRTAKFVTGNFVPVVGRVFTDAADTVMGASILLKNTVGIVGLAILLLICAFPAIKV.LTLALIFNLAAAVLQP..L.G.GGAII...NSLSIIGKAVIFVFAA..LAT..VC..L..MFFLAITIMVAAG............
K8E077_9FIRM/65-386                  ......................................................l-NFKELVVQLLK-GNLNWQATD.LLAGLFKLFFKEVVANASLLGKLVVLAVICAVLQNLMASFA.K.GTT.G...QLAYAVSYMALISLAVGSFALAVNTGREAVDNMVHFMQALLPLLLTLLAAMG........GIASTAIFHPVIFGSITAISTIIKT........IVFPLIFFSA...VLTILSNLS.E..KFQVSRLADLMKTLALGVLGLCSTVFLGLLAIKGVAGSVTDGVAIRTAKFATDAFIPVVGGMFSDALDAVVGSSLLIKNALGMAGVIIIFFLTALPMLKI.FAVAFVYKLAGALIQP..V.G.DQQMA...ECLTALGKSLITVFAA..VAT..VG..L..LFFFALAIVVGMG............
B2TRP2_CLOBB/90-412                  ....................................................ldp---VQYIKEYIKNGEGDFNIKS.LSKALTSILFKEVGSVLKLIISIVTIVIICSLIKILQDAFS.S.DNV.S...EIAFYACYALIIMILSKSFIISIGVAKDVILNIADFMAALLPVLITMIAMVG........GLTQAATLDPIILAAVVFIPRIYSN........IIIPLILMGF...VLGFANNLS.N..DHKITNLCKLLKQCTLWMQGIIITVFIGVLTVRGITSKTIDAVTLKTTKFAVDNFIPIVGKTFSDAIASIAGYSLIIKNAISSVGLLIIVLILLYPIIKL.VLMTVIYKLAAALIEP..I.S.DPRIT...NSVAAAGDSMTLIISC..VLS..VS..L..MFFILIALVASSG............
A0A0A2TK70_9FIRM/63-382              .......................................................FSLARMFED-LKSGTLDLRPEK.LGQSLMGILGREILNSAPLIGKLLILAVLCAVLGQLQAAY-.G.GEV.G...KIARIMTYLVLFSLALTSFREALGVATETIEKMVGLMQTLFPVMLTLLISMG........NLTSAALFKPLILGSLTVLATLIKT........VVLPLFFLAA...VLRLFNHIS.E..QFKLSKLAGLLEFAGKLSLGVIMTVFIGVMTVQGVTGGVADSVVFRTAKYSADL-IPVVGKFFKDAVELVITSGLLLKNAVGIIALLAIIVICVAPMVKL.LAMILMFRISAALTEP..L.G.EKALA...ESLQDMAKSLTLIVVT..VAA..VA..I..MFFMTVAVVIGTG............
R6EVN4_9FIRM/95-415                  ......................................................r-TFRDVLDPLLS-GEFETAWEM.AKQYLYDQFSFEFRSNKKQLVSMLLLAVTAALFSNFASALQ.N.KQI.S...RISFYVLYMLLITLCLNTFRVAMSGIENRVEVLVDFMRVLCPGYFLAVAFAS........GSSSALMFYNLVLILIYLVEVLILK........FLLPMIHVYI...MVQVMNYML.G..EDLLTELGELLKKLILWILKTLLALVVGINVVQGLLGPAIDGLKRSAVTKTVEA-IPGIGNTFGSMTDVVLGTTVLIKNGIGMAGAVILLAGCLVPVVQM.AVLTFFYKLAAALVQP..V.S.DKRIT...GCISSVSSGYELLLKV..LCT..VL..V..LFLLTIAVAAAAT............
A0A0A8WHC0_PAESO/62-383              ......................................................v-DLKTFVKDLIS-GKKTMLDLF.NKEGFKVFLFEELKASLKVASIIFVLALLSSILKSLDNSFS.S.GAV.S...QVTTYIVFIVMVTLTLVGFKDVLNICNNTIDSMISLMQIVMPILITFLVVMG........FPITSTVMTPIFMGGVTFINIVFKN........FLFISITIGF...AVLVINNIS.S..SIKLKKLSSFIKQINLITIGAIFTIYLGLVSMQGMYVKSLDGFAIKSTKFAIGNFIPVVGGFVSDSFDIILSSSQLIKNLFGGVGLIILIGICLIPIVKI.ISIILVYKASAMIVEP..V.G.EENIS...NFLNEISNLMAIMLGC..IIA..IT..I..MFFVTIAIVISI-s...........
A0A089K6L2_9BACL/90-410              ....................................................ktp----SLMDMLLP-GEDGLSFKS.VLSGLTRFMWHEVLYNGKLLVTIVMISVLSMILETLQTAFE.R.KSV.S...KIAYMLCYMVVLVIAVNSFNISIGYAKDAIDRMIDFMMAMIPLLFALLASMG........NIVTVSVTHPLIVFMIHTVGTMIHT........IVFPLLFFSA...VLHLVSAMS.E..KYKLTQLANLLRNIGAGLLGVLLTVFLGVISVRGITSSVTDGVTIRAAKYITGNFVPVIGKMFADATDTVISASLLVKNAIGLSGVIIILFLCAFPAIKI.LVLALIYNVAAAVMQP..L.G.ETPIV...TCLQTIGKSMIYVFAA..LAA..VS..L..MFFLAVTIMLTAG............
A0A1Y4IQC5_9FIRM/21-341              ......................................................l-DFGDMVMRGTE-GGQLFSWES.LAGFLQDTFFKELLQQRQMWVHILILAVAAAFLVHFADVFQ.N.RSV.S...QISFCMIYMLLFLLLLTSFQNSMGIAEQVMDHMRDFMTVLAPAYFLAMTLSA........RVTSAGVYYEFILLLISAVRWLAEA........FVLPCVEIYV...LLTLVNGMS.G..EGRLGRLTELVEMLVGWSLKAVLAAVMGFHMIQGLITPAADAFRASSVSKGIEM-VPGVGDVGGSVTDLVLGSAMLIKNGVGAAALAVLILLCLVPLAKL.GVIMAAYYLLAAILQP..V.S.EERIT...GCLTGMGHAVRLLFQT..VFT..VL..V..LFLLTIALATAA-s...........
A0A117SH48_9FIRM/58-379              ......................................................v-NIKELVLGLFK-GNTFENLKE.LGKGIVNYFFKEVISNFSIMGRLLILAIFCAILQNLHNAFE.E.DAI.G...RLAYGICYILIIIMAVKSFDDAMKIGVHAIDTMVGFMQALLPTLLALLAAVG........GISSSAVFQPLLFSSITLITTLIKV........FVMPLILFSA...VLSILNNLS.D..SINISKLASLLKQTAIGALGLVLTAFTGVITVQGIASASIDGATIRTAKFAVDNFIPIVGSFLSDAFDAVVSCSMILKNGIGIAGFIVLLLICSFPLIKM.FSIVLIYKVTSALIQP..I.L.DNQIV...QCLNDMSNAILTLLTC..VLA..VA..V..MFFMALTVIMGVG............
A0A221MCA8_9BACI/64-383              ..................................................ekssl-------YEFIK-NNGSFSVKN.TLLGLVEYLFHEIIVNGKLLGLLLMLTLFSVLLQTMHTAFE.R.SMV.S...KIAYFAVYLVLLFIALNSFYLVFSYTKDAIDAMSSFLIALLPLILGLMATFG........SLITVSFFHPIIIFLIFASGVLVSN........FVLPLLFLSA...LLLIVSSLT.D..SYQVTHLASLLKSISLGVLGVFLTIFLGVLSVQGAASAIQDGVAMKTAKFITGNFIPIVGRTFTDAADTILSASLLLKNSVGIVGLICIVLIALFPAIKI.FAIAFIYKLAAAVLQP..L.G.DGPII...TSLNVISKHIMYILAS..LIA..VT..L..MFFLAIVILVVAG............
A0A1G9CI99_9CLOT/65-386              ......................................................i-EFKAFIINVLK-GESTISFNE.LLKGSVRFLFREVIANWRLLVQIIILASICAVLKNLQSAFE.N.EVV.G...KLAYNVCYLVIISISIKSFMIAVHIGKETIDLMVSFMQALMPVLLAMLMAIG........GITTSAFLHPILLGAIGFVGTIIKT........IILPLILFSA...VLTIVNNLS.S..KIQVTKLASLLKQSAAVILGFVLTAFVGIISIQGITAATVDGVTIRTAKFAVDKFIPIVGGFLSDAMDTVIGCSLILKNAVGAIGLISIFLLCLMPMIKI.LALIIVYKLAAALIEP..I.S.ENGLV...DCLNSMSNALILLFAT..VSS..VA..I..MFFMTITIIISTG............
A0A075LKU4_9BACI/68-387              ..................................................ekgsf------VDF-IK-QQGDISIQS.WLKGLFEYLLYELLLNGKLLGILILLTLFSSILQTIQTAFN.K.GSI.S...KVAYLIVCMVLLTLLLNSFRLSVNYAMEAINGMSDFMLALIPLLLGLMASFG........SLSAVAFFHPIIVFLIHASGLLIAK........VIIPLFLMSA...LLHLVSTIN.K..EYPVTQLADLLKNIGLWLLGIFFSVFLGVISVQGAVSAVQDGVAMKTAKFVTGNFIPVIGRMFTDATDTVLSASLLLKNAIGIVGVLIVLAISLFPAIKI.LAIALIYKIAAALLQP..L.G.DGPII...KSMQVMSKYILYIFAC..LLV..VA..F..MFFIAIVIIVAS-s...........
A0A1M4XMH8_9CLOT/62-384              ......................................................l-NLKEYIKHYMETGEENLSFKS.LTKIVGTYFIKEVRVTLKLMISLIVLAIISAMIRNLQDSFS.N.DNI.S...NVAFYACFAVMIMLLSRSFLISLDLAKETIQGLADFMIVLLPVLTLLLSTAG........GITQAASMDPIVLGSVILTPRIYID........IIIPLILMGF...VLVFVNNLS.N..DHKINNICKMFKQIVMWLQGIIITIFIAILSIRGISANTIDAVALKTAKFAVDNFVPIVGKAFSDAITTMAGYSLVLKNAVSTVGLIVIIVLVLFPILKM.ILMIFTYKLSAALVEP..I.A.DKRIV...SCIEFASESLTLVMAT..MLS..LS..V..MFFIMIAIMANSG............
A0A1V2M8P4_9FIRM/63-386              ......................................................f-NLKNEISLILT-GQKEFNLAV.MLEFIKDRILGEFFMYISVIVRFILIVLLCHLLNHLSSAFE.S.KNT.T...KIAFFVCNIVILYSIMESLVLIVEVAQNTINTLQGIMLIMLPTLLAFMATSG........YIATSAALSPVIIGALNLMVFIIQT........ILLPSVIIVI...ILQIVNNMS.EtaEFKFNKFIALYYRASKWALRTIFILSLTIMGLYRMSLPFTDATMKKVGLTLSTKFIPILGNAVSGAVDIIIQISGMIKNAFGIGVIILIVLVIATPLLKI.FVYICMFHIAGAFIET..M.G.DKKMS...KTATDIGKGCEFIMSC..VGV..VS..I..LSILTLVVCMSV-g...........
A0A1L3MQ38_9BACI/76-396              ..................................................sqkgs-----LLQF-LS-GEKELSFQE.WMKALLKILFHELIANGKLLGTLILLTIFSMLLQLLQNAFN.Q.STV.S...KVAYALVYMVLIIIALNSFHVAIEYTNNAIQSMTNFILALIPLLLALMASSG........GLASAAFFHPVIIFLMNTSGLLIQN........IVLPLLFLSA...LLYIVSTLT.E..QYKVTQLAGLLRNISIGLLASFLTIFLGVISVQGASAAITDGITIRTAKFITGNFIPVLGRMFTDATDTVISASILLKNTVGVIGVAVLLFIVAFPAIKV.LSLAFIYKFAASILQP..L.G.GGPVI...ACLDIISKSVIYIFAA..LAI..VS..L..MFFLSLTVIIAAG............
A5Z6N4_9FIRM/59-378                  ......................................................i-DYKYILKK-LRDGDVLLVLKE.IGRTAYEKTIGDVSLIEKTLVNLLLITIIASFFTNFANVFS.K.NGI.S...DTGFYICYMVTVAIMVTMFEEFSIIAAQLVKLLLKFVGGIIPAYFLSVAIVG........Q-AAAAGFYQLTLVIIEVCQFVFLK........ITLPAIKIYM...AISLVNNIS.R..EDFLSGTTHVIENFINFVNKTMVGIVTGLNIIQGLILPSVDMAKNTTIKKFIGT-LPVIGDGADAVTGMLLGSANLIKNCIGTFGIIMIILICFVPYMKL.QIYSASIQIFTAIIQP..V.A.DRRII...ESLNCLCKGIRLLIRV..VIS..SG..F..LFVISIAIICMTT............
A0A1V4SJ02_CLOHU/114-435             ......................................................f-NPEEILSDAAK-GDFKFSIQG.LLNRIIRYLLEEVFLNINVLLKIVILAIICAILKNLQNSFL.G.ESV.G...ELAFFVCYIVIVSVLMVSFSSAMNMCFSIIDSMVTFMHAIIPLLITLLVSAG........NLTSAGVFQPVLIMLVEVGATVIKN........FFIPLIFLVT...VLNIVNNIS.D..KVQLTKLSGFMKQICTWGLGLILTVFIGIVSIQGSMGAVVDGVTSKTAKYALGTFIPVVGKYLADAADTVVGCTLVIKNASGVIAMLGIIIICLAPLLKI.LAMIILYKLACAFVEP..I.S.DRKIT...NCLNDMAGSLTYILGV..TAA..VA..V..MFLIAITVVISTT............
R7LRU6_9CLOT/71-390                  .......................................................IDISDILNSAIK-GE--IDNSN.IYKKILSKLGNEVQNGVKSLACILAIIIIHSILKSISESLE.N.DNI.S...KLIYYVQYIAIITVIMSNFSDIITLVKDTTTNLIGFMNTLIPVLISLMLYTG........SITTTSILEPIILFMINFIGNLIQD........ILMPIILIIT...SISIISKIS.D..RVQIDKISKFLKSSTIWFLGIVLTIFVGVVSLEGTLASSVDGITAKTAKAIVSSAVPIVGKILGDVVDSVLGCGLILKNAVGFVGVIVIIGICIMPILKL.TVLTFSYKLVASISEV..I.A.DSKIV...KLLDEIGDIFKILLAI..LVT..VT..F..MVIIGTTLLVKM-s...........
A0A2A7MGJ5_9CLOT/80-402              ...................................................ldpi----DYIQTYIKEGHGTISFEV.LAKAFLSVLFKEVRTVLKLCFSIVIIAVLCSLIKNLQESFA.S.ESI.S...EVAFYACYAIIIMILSKSFIVSISVAKDVINNISDFMSALLPILVTMIGLTG........GAMQVATLDPIIIVCVVFIPKLYAD........VIIPMILMQF...VLEFANNLS.K..EHKIGNLCSLLKQCIVWFQGAIVTIFIGILTIRGITSSTLDAVTLKTAKFAVDNFIPIVGKAFSDAISSVAGYSLIIKNAISSIGLLIIIIIMLYPITKL.VLMTFIYKLCGALIEP..I.S.DSRIT...KSLEAAGKSMTLITSC..VLT..VS..L..MFFVLIAIMASSG............
A0A1H8NB71_9FIRM/60-379              ...................................................enlt------IQE-MAAKGIHINWQQ.WWKNLMARFFQEIAANVHLSGKLLFLAVLCAILQNLQNSFE.R.SNV.S...LLTYSICFSFLAVIALTSIYNVLELARQTVAQMVDFMQALLPVLISLLAGVG........AVTSAALFSPVMLFLTSMVSLLVKD........VVLPLLFLTT...VLECVNYLS.N..TYRLDNLASVFKQGGMVVLSLALVVFIGVVTIQGVSGSVSDGIALRTAKYATATFIPVVGKMFSDTVELVMGASLLLKNTVGILGVLAVLMICVWPLLKI.LALIVVIKLTGALIQP..M.G.DDRMA...KCLDMMGNNLLLIFGA..VLT..AA..L..MFFLGITMIIGVG............
A0A1Q9Q576_9BACI/72-392              .................................................sqkgsl-------YDFVK-GEQKFTLKE.WGSGVLKFLFHEFIANGKLLGSLILLTIFSMFLQSIQNAFE.N.STI.S...KVAYAIVYMVLVILALNSFHIVIQYTNEAIGTMISFVLALIPLLLALIASSG........GIISAAFFHPVILFLMNISGIFMQY........IILPLLFLAT...LLSIVSTMS.D..QYKVTQLAQLLRNWSIGLMGLFLTIFLGVISVQGASAAITDGVAIRTAKFVTGNFIPVVGRIFTDAADTVVSATGLLKNTMGIAGVAILLIIVAFPAFKI.LMISFIYKFAAAVLQP..L.G.GGPVI...KCLDIISKSVIYVFAA..LGI..VS..L..MFFLSITVIIAAG............
R6WL62_9FIRM/22-335                  ...............................................taltdeyg---------------TETDFSR.VFHVIRDSLGEYLKTVTKSVLLLLSVVILSSVFSSYCG--G.T.GTL.Q...SALSYASVLAVSCVVFSMLKSVFTFAADTLSSLCRYMTAFLPVAASLYTLGG........SVTTGVAGSSALLAFLSIAGGFVSD........FLFPLMQGGF...ILALAGALP.N..TNALRSVANLAKSALTTLLAFVFSIFGMVMYLQTVITAKADSFAFRTVKFASGAFIPVIGNMLGDAARTVSASAGVVRATVGGAGIITLLAVTLPSVIFT.LLYKLGILLSAMLARA..L.G.CENES...RLLYDINSILAVLLAI..QLG..VS..V..MFIIAVALFIR--ig..........
A0A0C7N702_9THEO/102-423             .......................................................FSFQEILAN-LRQGKLPLDPAA.AGRGLLKYLFHELLASGALLGQLLILAVACAVLQNLQAAFS.E.GTI.S...TLARGVAFLALITLALTSFTLAVRTGAEAIDRMVSFFQSLIPALISLLAATG........GITASTLLQPVLIYTVTLTGTIMHN........VLFPLLYLTA...CLTVVGRIA.D..RFQVSKLAGLLKQAAMVALGLMMTVFTGVLSVYGIAGSVADGVGLRAIQFATDAFLPVVGGMLSDAVETIAGTTLLLKSAVSLVGVVIIFFLAAFPMLKI.LSLVVVYKVAAAVVQP..F.G.EEQLA...DALDGIGGALTMVFAC..VAV..TG..L..IFFLAVAVIVVL-g...........
D4JTH8_9FIRM/54-367                  ................................................tpqsids---------------EALSVDK.VISNVTGMLWESIKSPLKLLISLISVTLLCSIANVFADNT-.S.GNL.K...TVFSLVSVLACSTITVSAASDSLTAASKTLESGSVFLASFIPAFAGILATSG........HVSSAAMFNTVVMGGAQGYMQLASK........ILMPVSMSIL...GISLAGSVC.G..ELKLETLAQAVKKTVIWILGLIMTVFVALLAMQSFITVPSDNVGIKAARFTVSNGVPFIGGAVSDSLSVMYGGIGIIRNNFGVFGIITGGVLILPSIISV.LCYKLAFSLAASFSDL..F.G.ISQLT...GLMKCAEGVSSIITAM..LVS..FL..L..MAVISISLMIFM-a...........
R4KNB9_9FIRM/80-400                  ......................................................t-DFKALVTGLAT-GQISMQPTE.VFNQCINYLFREVVANSALLGKLVVLAVICAVLQNITGAFE.K.GTT.G...QLTHMVAYLVLVTIAVGSFGLAIQLGREVVDKMVIFMQALLPLLLTLLVAVG........GIASAAIFHPLIFITITAFGTIIKN........VILPLIFFAA...VLEIVSGLS.K..HFQVSRLAGLLKGVAMGLMGLLSTIFLGIMAIQGVAGAVGDSVTFRTAKFATDF-IPVVGGVFSDALEAVIRSSLLMKNAVGIAGVLIIIMILVIPLVKI.IAIALIYKIAGAVIQP..V.G.EERIS...DCLNGLGNSLITVFAA..VAT..VG..L..LFFFALAIVVGL-g...........
R1CBS0_9CLOT/65-386                  .......................................................INFKQYLVSLLK-GEQVLSNEE.ILKVIFRLVCSEIVTNAGLIAKLIILAIICAILTNIQSAFE.N.NTV.G...ELSYYVCYLILIAIVIKSFALGLEIGRSVIDDMVVFMQALLPVLITLLLAVG........GITSSALFHPLILGALNVISTMMKD........IILPLILISA...VIGIISKLS.D..KVQISRLAGLIRQGVVSIIGISLTIFLGVISIQGTATAKVDGVTIRTAKFAVDTFIPIVGGFLSDAMDTVVGCSMLLKNAIGIIGLIVLFIICAVPLIKI.ISLVIIYKITAVVIEP..I.S.DRRIV...DSLSEVSKSFVIVFAT..VAS..VV..I..MFFMAITIIISAG............
R5XR87_9FIRM/63-382                  .......................................................FSFQEALKKLIN-GEEAISKET.VQEFLRGLFFSGFERERELFAKILVLVILAAVFTNFASVFE.N.GQV.G...DVSFYVVYILLFTLLMDSFYEKTRSLHHTISWIVEFMKALSPAYFMTVAASS........GALSAAVFYEGVLLLVWLIQWILLN........VLLPAAEIYV...LLRLVNHLS.R..EEMLGKFAEFLKTVVSWALKTLLGLVAGLQVVRGLVAPVMDSLKRSVIGKAAGA-LPGVGNAVNMVTELVITSAVLVRNCLGVLILLATVAAGAGPVIHY.GMLSLTYRFLAAVSQP..V.S.DKRMV...ECLSTMGEGFEILLKI..LFT..AE..V..LCILTFLIIMA--g...........
A0A081NWM0_9BACL/85-403              ..................................................apsfm--------ELLL-GAKDFGLGS.VFSGLFKYLFHELLYNGKLLVSIVILTVFSMLLETLQSSFE.K.NNV.S...KIAYAISFLVLMIMAVNSFSVAIGYAKSAITDMIHFMIAVVPLLLTLLASMG........NVVTVTVMHPLIVFMIHAVGTAIYF........IVFPLLFFSA...VLHIVSSLS.D..KYKVTQLANLLRNVSVGCLGVFVTVFLGVVSVQGIGSAAADGVTIRTAKYIAGNFVPVVGRLFSDASETVIGASLLVKNAVGLAGVVILLVLCAFPALKI.LALAFIYNVSAAVMQP..L.G.DNPMI...TCLETIGKSLIFVFAA..LAV..VG..L..MFFLAITIVIAAG............
A0A0S9CKI3_9SPHN/58-140              .................................................fgldpt----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..--QVDELDEQMKEQVAVTVARIGSGFIGKLITEGMIATVLKQVGVRLATKTAASYVPVIGSGVAAGL---------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------sfgmmklignkh
A0A1L8ZM36_9BACI/69-389              ..................................................sqkgs-----LID-FIK-GDKEFSLNQ.WFKGILKFTFHELIANGKLLGSLIILTIFSMFLQSLHQAFE.Q.GTI.S...KVAYAIVFIVLTILALNSFHVAIEYAKNAISMMTNFILAIIPLLLALISTSG........GITSAAFFHPVILFLMNTSGVLVQY........IVLPLLLLST...ILSIVSTLS.D..QYKATQLAQLLRNGSIGLLGIFMTIFLGVISVQGTATAVTDGITIRTAKFVTGNFVPVIGRMFTDAADTVISASVLLKNTLGIAGVAIVLIIAAFPAIKI.LALAFMFKFTAAIIQP..I.G.NGPVI...KCLDTISKNMVYVFAA..LAI..VA..L..MFFLSITIIIVAG............
A0A0Q9Y3P7_9BACI/68-388              ..................................................skrgt-----LVEF-VK-GDKSSSMQS.WVNGILAFIIQEISLNLKLLGTLMLLTIFSVFLQSLHNAFE.Q.GAV.S...KVAYSIIFMVLIIIALNSFRVASEYAIEAIDNMSQFIMALLPLLLALIASSG........GVTSSGFYHPILVFLVNISSLVIKN........GVLPLLFLST...LLSIANALN.G..EIKVSQLAGLLKKASVGLLGAFITILLGVMSLQGAASAVADGVAIKTAKFVTGNFVPVVGKMFTDAADTVLSASVLLKNTIGIAGVIIVLLIAAFPAIKI.LIISFIYKLSAALLQP..L.G.DGPVI...SCLNAVSNSMIYVFAS..LAI..VS..F..MFFISMTIIITSG............
A0A1Y4BZR2_9FIRM/47-358              ...............................................ddgldlee------------------GIQS.ILDTGSGQVAGVVRKALRSGVLLLSVVLLCGLAEGTC--AA.G.GST.V...DVVSIVGAMAIAAVAVADANSLIGMGREALEQMETFSKLLLPTVTAAVAASG........SPGAAAARQLATMLFSDVLITLITS........LLLPLLYLYM...AACVAYTAI.G..NEGLKRMAVTIKWVVTSVLSAVLILFVGYLTISGAIAGTADAAAVKAAKFTMSSMVPVVGGILSDAAETVLASAGILKNAVGVFGMLVVLGMCVVPFLQL.GIHYLAYKMTAALSAT..V.S.GGRVA...GLIDQIGGAFGLVLGM..TGA..CA..L..LLLISMVSAV---taaa........
V9G4B3_9BACL/74-393                  ....................................................tps-----LMDMLLP-GGDGFSLQQ.VMSGLGKYVWHEVLYNGKLLATIVMLSIMSLILENLQNAFE.K.STV.S...RVAYTICYMVVLVIAVNSFSVAIGYARGAITGMIDFMMAMLPLLFALMASMG........NIITVSVAHPLVIFMVHTVGTLIST........VVFPMLFFSA...LLHLVSSLS.E..KYKLTQLGNLLRGVAMGVLGVLLTVFLGVISVQGLTSSVSDGVTIRAAKYVTGNFVPVVGKMFADATDTVISASLLVKNSIGLAGVIIILFLCAFPAIKI.LTLALIYNLAAAVMQP..L.G.DTPIA...TCLHTIGKTMLYVFAS..LAA..VS..M..MFFLAITILLTAG............
M1YV77_9FIRM/62-381                  .................................................spglis---------LMLQQEKGFSLQG.VLNGFLHFLFHEITVNAKLLGMILLLTIFASILENIQSSFE.Q.TAV.S...KIAFIITFLVLMILAMNSFSVAMNYAKEAIKGMMDFMMAIVPLLVTLTISMG........NVAAGTFFHPFIVVLVHASGTLVYY........FVFPLLFFSI...LLQLVSHIS.Q..KYKLTRLAGLLRNIGLGTLGIFITVFLSVLSFQGTSTSISDGLALRTAKYMAGNFVPVVGHLFTDAAETVMGASLLLKNAVGITGVVLLLFMAAFPAIKI.LVISLIYQIAAALLQP..L.G.DHPMI...TALHDIGNGMMLIFGA..LAT..VS..L..MFFLSLTILIASG............
A0A223D742_9BACL/83-403              ...................................................ikgh-----LLDLILK-GELGVVIKG.LLGGLLKFLFHELFLNSRLLGTILVLAVFAALLESMQAAFE.A.NNV.S...KIAHAICFLVLMILAVQSFAAATAYAKSAIQTMVDFMIASIPMYLALLAATG........GLASATMIHPLIVFLINVIGDLIMY........VVFPLIFFSA...ILTLVSQIS.N..RYQVTQLASLLRGTAVWVLGVFFTIFLGVISVQGAAGAVADGVSIKAAKYVSSNFVPVVGKLFADAADTVVGASLIVKNALGVSGAAIVLLICAFPALKV.LSLALIYNVSAALMQP..L.G.DSPII...RCLSTIGKSLILVFAA..LAT..VG..F..MFFLAITVIIAAS............
R5DYG0_9FIRM/55-368                  ................................................lgdfskl---------------ANLSFEN.VMGEILSLALGNISSPLKGLVNITALLLLCSVISAYNGSLS.-.CDI.S...NSLNITATLCITCAAVVPAVGVIASTGSVICTASNIMLAYVPVMAVIMASSG........SVAGSASYYAVMIGAGEGVSQLSSK........IIVPLLNMFL...GLSITSSVS.P..SVNLSGFMSMISKSVKWLLGFAMTIFTAVLTFRQLISVSVDNVSTRAVRFTLNSFIPIVGSALSDAYKVVQGSIGLLKSGIGIIVILSVTIVFMPVILQG.VMWMFTLWIGKSTAEV..L.N.LNGPA...KLLENISSVFSTLIAV..LLC..IM..S..IYILSTAAVIML-g...........
A0A1R1CFT8_9BACL/76-396              ...................................................sktp-----TFNELLT-GAKDFQMST.ILSGIFRYFFHELVYNGKLLASIVVLSIFSMLLETLQSSFE.K.NNV.S...KVAYAIVFMVLMIMAVNSFTVAIGYANAAISEMIHFMIAIVPLLLTLLASMG........NMVSVSVLHPLIVFMIHAVGTGIYL........IVFPLLFFSA...VLHIVSSLS.D..KYKVTQLANLLRMISVGCLGVFITVFLGVISVRGAGSAIVDGVTIRTAKYIAGNFVPVVGKMFSDASETVIGASLLVKNAVGLVGLVILLILCAFPALKI.MALALIYNLSAAVMQP..L.G.DSPII...ACLDTIGKSLIYVFAA..LAV..VG..L..MFFLAITMLIAAG............
D7CKG7_SYNLT/68-388                  ......................................................v-SLKQWFIDFIQ-GKWELNVKE.VLGNLLRFFLGEVAANAGLLGKLMVLSVVTSLLVNFQAAFG.G.EGT.S...RISYMAAFMALMAVGIASFRYALGLGQQTVTDMSDFMVSVLPQMTVLVAGMG........GINTSTALFPLMMTACTACASAIQH........VVFPLVVFSA...VLHLVDTAA.D..TVQVQKLGKLLSSAAIVGLGLFMTVFVGLLGLRTVYGAVLDEVTLKTTQFATSF-FPVIGKLLSEALEYTLGYMAILKHALSIFGLVIVFGICIFPVLKI.GAIVLIYKLSAALVEP..L.G.DARTA...QALDIMAKHLTLVLAS..VVA..VA..L..MFFIMITVLAGIT............
R5TM23_9FIRM/61-344                  .......................................................MTFRDVVETLVS-GDLKKAGEQ.FTGFLFDQFFYELQTHRKLLVYLILIAVIAAVFANFSGAFG.E.RQA.S...EIAFYILYMLLIALCLNGFRLAVSEMEASLNFLLEFMKVLCPTYFLAVTAAS........GSVTSMFFFEVVLFLIFLAEAVILN........FLVPLVNVYM...MIQVMGNLT.G..EEFLSQFAELLEKLTGWTLKTMLACVIGINVVQGILSPALDSLKRSFVTKTVEA-IPGLGNMAGSVMDVVLGTAVLIKNGIGMAGAVIAAGICIIPIVKL.LLLAFLYKTVAAGTQ-..-.-.-----...----------------..---..--..-..-------------agddpr......
D5X7K3_THEPJ/80-401                  ......................................................l-ELRSLIGKIAR-GEFEFGFTD.ILTGLLKFLFHEIIANSKLLGELLVLTVICAVLQNIESAFE.Q.GTV.G...KVAWTVCYLTLFILALKSFGIALGIGREAISDMVSFMQATLPVLITLLTAMG........NLTSAALFHPLTVTVLSSISTLIKN........IVFPLIFFSA...VLGLTSNIS.E..RFQVSKMSGLMKQWSMALMGLFFTVFLGFLSVQGIAGSVADGVALRTAKFATGAFVPVLGKMFADALDAVVGTSLLLKNVVGLVGIIAIFFICIFPALKI.LSIMLIFRVAAAISQP..I.S.DTKLV...ESLNTMGNSLGLVFAA..VSS..VG..I..MFFFVIAIVLGTG............
A0A1Y6G1Z5_9BACI/71-391              .................................................sqkgsl-------YDFVS-GEKKFSFKQ.WGLGIVKFAFQEFVSNGKLLGSLIMLTIFSMFLQSMQNAFE.K.SAI.S...KVAYSIVYMVLVIIALNSFHVAISYTNEAIGSMISFVLALVPLLLALIAASG........GLISAAFFHPVILFLMNISGLFMQY........IILPLLFLAT...LLSIVSTMS.E..QYKVSQLAALLRNWSIGLMGLFLTVFLGVISVQGASAAVTDGVTIRTAKFVTGNFIPVIGRMFTDATDTVVSASVLLKNTVGIAGVGILLIIVAFPAIKI.LMIAFIYKFAAAILQP..L.G.GGPII...TCLDIISKSVIYVFAA..LGI..VS..L..MFFLCITVIVAAG............
A0A084JRZ3_9FIRM/65-385              ......................................................l-SFKTLMKDLMD-GKLNEVMGQ.VGKALKDLLVGEVRNSGHMMGQIMVLGIIGAVFSNFSSVFT.G.SQI.S...ETGFFVTYLLLFTYLAASFFTSVTITGNVVGQILDFTKVLMPAYFLAAAFAG........SSASAAASYEFTLFVIVVAQWLLGQ........VLLALIRVYA...LLVMAGHIA.K..EEMLSKLTELLEQVVSWSLKTLVGVVLGFHLIQSMVLPYVDSMKTGAIQKLIGA-IPGIGQGVNSVAQMVLGSGVLIKNTIGAAGIIVLLILSVIPLIKL.AVLMVLYQCVAALLQP..V.C.DKRIV...SCISEMAKGHKMLLSV..AAS..AV..I..LFVVTIALVCAST............
A0A1X7JIL1_9BACL/89-409              ................................................slpsfad---------LILPGGERLTMEN.ALKALGGFMLQEVLLNGKLIVTIVILAVFSMVLETLQAAFE.R.NAV.S...KIAYSISYLVIIILAINSFNIAIGYAKDAITSMIHFMMAMVPLLFTLLASLG........NVVTVSVLHPLIIFMIHIIGTLIYM........VVFPLLFFSA...VLHIVSTIT.D..KYKVTQLANLLRNISVGLLGVLLTVFLGVISVQGVTSSVTDGVALKTAKYITGNFVPVVGRVFSDATDTVISASLLVKNAVGLTGVIILLFLCAFPAIKI.LALSLIYNVSAAIMQP..L.G.DTPVV...GCLKTVGKSMIYVFAA..LAA..VS..L..MFFLAITILLTAG............
A0A0U1L2Y5_9FIRM/59-378              ....................................................taa-----TIKDIAT-KGLDFNWQT.MSTTVLSCLFKELATNIHLMGKLLFLAVLCALLQNLQNSFE.Q.SSI.S...LLAYSVCFIFLCVISLSAFYNGLTLARETVGTMVGFMEALLPLLLSLLAGVG........ALTSAALLTPLMLLVVSVTSVIVKD........IVLPLLFLTA...VLECVNYLS.G..TYRLSNLTGVLKQAGMMILGFVLVVFIGIVSIQGVAGSIADGLTLRTAKYATATFIPVVGKMFADTVELVMGASLLLKNAVGIFGVVAIALLCALPLIKL.LSLIVVMKIAGALIQP..M.G.DEKMA...KCLDAMGNNLVLVFAA..LLT..VA..L..MFFLVVTMIIAAG............
A0A096BJP8_9CLOT/63-384              ......................................................i-DVLEYIKSLLK-GERVFSFEE.VLKSLLTLIFKEIMINSKLLGQLLILSILCAVLTNIQSAFE.K.NTV.G...ELAFYVCYMLLIAIAMKSFVISMSLANKAIDEMVLFMQALLPILITLLLAVG........GITSAAIFKPIIFGSVSIMSTLMKN........VILPLIFFSA...IIGIISKLS.N..KVQISKLSSIIRQITTTLLGMLLTIFLGIMSIHGVATSKLDGVTIKTAKFAMDSFIPIVGGFLSEAIDTVVSCSLLLKNAVGVIGLVLIFIICVIPIIKI.VSLILIYKFTTVIIEP..I.S.DERII...QCLNEISKSLLMIFAI..ISS..VG..I..MFFIAVTIIVGAG............
A0A1V2A9M7_9BACI/39-354              .............................................dtdnlniadf-----------------FSLEK.WIDAIQAYILFEVTEHIRLLSIIFLLSVLASVLKTMGHAFG.H.QTV.S...KTAEAAILIPVFILAMNTFRLAVESASGAIENMTVFMTAFMPVLIALLTLSG........AVASAALFPPLLLFLMNASGILIDQ........IVLPSLIFSV...LFSLVGLLS.D..HYKADRIAGLLRTLSVSLLSAFMAVFLAVITMRGMAAATADGLTVKTAKFLSGTFVPVVGRMMADAADTASGAALMINNTAGAAGIGLLLLTAMFPVVKI.MVLVFLYKVAAAVLQP..L.G.DSAAA...SCLEIIGKTMSFVLAA..LAL..VS..F..MYFLMMAAVVAAG............
N2A2L6_9FIRM/69-388                  .......................................................ITFSQLVQELMS-NGVSFGFAS.IGETLKQAVFADYYENRSVLIQILMLALAFSILLQMTSSIQ.K.KYI.S...DLGFLGVYLILMMLLLRLFMLMTGSVENFFTKLVDFMRVLQPAFCLSMVFSS........GSISAGAYYQLLLLLIHLIDTVFAK........ILLPVVQVYM...VLQLVNYLT.-..QERFSGIAGLLADSVSWCIKLFTTALVGLNIVQGLLAPGIDGLKRSLASGAVRS-IPGAGQMINSMTEILAGSALLIKNSVGVAALLILIVISFLPLVKT.AVFMVLYRACAAFMEP..M.A.DKRFC...AAVSALGQSAALYLKL..MFY..AV..L..LFFLTTAIICAAT............
A0A165XSC5_9BACI/78-398              ..................................................sqkgs-----LM-DFIK-GEKQFSIKE.WAVGILKFLLHEILANGKLLGTIIILTIFSVLLQHLQNAFE.E.KNV.S...KVAYSIVYMVLVILALNSFHVAISYATNAINGMTSFLLALIPMLIALMASSG........GVASAAFFHPITIFLMNGSGLLIEK........IVLPLLFLSS...LLFLISTMT.D..QYKVTQLAQLFRSISIWLLGIFLTIFLGVISVQGATAAVTDGIALRTTKFITGNFIPVLGKMFTEAADTLFSASMLLKNTIGVIGVAILFLITIFPAMKV.LAIAFIYKFAAAVLQP..L.G.PGEII...SCLDIISKSIIYILAA..LIL..VS..F..MFFLSITVIIAAS............
A0A162RS61_9BACL/71-391              ..................................................ktpsf------MD-ILLPGGEGFGIKN.ILKGLTSYFWHEVLYNGKLLVSIVMLSIMSLILETLQTAFE.R.NNV.S...KVAYSLCYMVVMVIAINSFSVAIGYAKGAINQMIDFMMAMLPLLFSLLASMG........NIVTVSVTHPLIVFMIHTVGAVVHT........TIFPLLFFSA...LLHIVSSLS.D..KYKLTQLANLLQKISVGLLGILLTIFLGVISVQGITSSVTDGVTIRTAKYVSGSFIPVVGKMFADATDTVISASVLVKNSIGLVGVIIILFLCAFPAIKI.LTLALIYQLAAAVLQP..L.G.DTPIV...TCLQTIGKSMIFVFAA..MAV..VG..L..MFFLAITILLMAG............
A0A1Y3TN92_9FIRM/71-391              ......................................................i-EFGDVVTALMS-GDAEEAGGV.LLDFLSDVVSYEFRYNWHNLVYILLIAIAAAVFSNFSGAFQ.N.RQI.S...DISFYVLYMLLITLCLTSFQTAAQGLEGRLDSVVEFMRVLCPSYFLAVAFAS........GSVTSVFFYNVILLLIYVVELVIIR........FVLPVIHIYI...MIRVLGNLT.G..EDFLSESAELMHKVVAWILKTLLACVIGVNVVQGLLAPAIDTLKRSALTRTAEA-LPWVGNAMGGAAEIFLGTAVLIKNGIGMAGAVIAVLICLGPIVQL.ALMALMYKVAAALVQP..V.S.DKRIT...ACISGVSEGYELLVRV..IFT..VG..L..LFLLTIAVVAAST............
A0A0M1NXE1_9BACI/75-395              ..................................................sqkgs------FMDFVS-GDKKFSFDE.WIKGITKFIFHELLVNGKLLGSLILLTVFSMFLQSLQNAFE.Q.SSV.S...KVAYAIVYMVLIILALNSFHVAIEYTKDTIDLMISFLMALIPLLLALIAASG........GLVSAAFFHPVLMFLMNTSGILIQF........VVLPLLFFAA...ILSIVSTLT.E..HYKVTQLAQLLRNFAIGILGAFMTIFLGVISVQGASSAVADGVTIRTAKFVTGNFIPIIGRMFTDATDTVISASVLLKNTVGLSGVIILLLITTFPAIKI.LMISFVYKLAASLLQP..L.G.GGPVI...KCLDIISKSMIYIFAA..LAI..VS..L..MFFLSITVIIASG............
D4J412_9FIRM/106-426                 .......................................................VSFKAILKQLMT-GSLSEAGQL.LFQMIREQVAGGIYENQQLLFKIACFAVIGAIFTNFAMAFS.K.EQV.A...ETGFYLTYTLLMTLMMTSFMMTSAIVRDVLHSLTEFMKVLLPTFCTALTFTT........GSLLSGAYYELMMIAIAAADWLMSS........LIMKMIQVYV...LTALVNHIS.K..EDYLSKLSELLALLIRWSIRTVVGVILGINILQTMLLPAIDRAKETVAYKLISA-VPGVGTAMNTAVGAVIGSGVLIRNVLGMGSLLIILLICAVPVVRV.CMVLLSYKIVQAVIQP..V.T.EKRLL...EGMDAMTQGVGMLLHV..LVS..CV..L..MFILSLAVVCNA-a...........
A0A220U562_9BACI/66-385              ..................................................ekssl-------YEFIK-SNGDFSVKN.TVLGLGEYLFHEIIVNGKLLGMLLMLTLFSVLLQTMHTAFE.K.SMV.S...KIAYFTVYLVLLFIAVNSFYLVFSYTKDAIDAMSSFLIALLPLILGLMATFG........SLITVSFFHPIIIFLIFASGVLVSN........FILPLLFLSA...LLLIVSSLT.D..SYKVTHLASLLKSVSLGVLGVFLTIFLGVLSVQGAASAIQDGVAMKTAKFITGNFIPIVGRTFTDAADTILSASLLLKNSVGIVGLIVIVLIALFPALKI.FAIAFIYKIAAAVLQP..I.G.DGPII...TSLNVISKHIMYILAS..LIA..VT..L..MFFLAIVILVVAG............
R6UEN5_9CLOT/87-406                  .......................................................IDFKNIANELLN--KNDINHKN.LFTKLLEIFASEVSSAIKGTVTIFIIVIIMAILSNLE-LDN.K.SDI.T...RIAHLACFIVIATITVATFVQTVNMLKTTINTMGTLMQVISPFLLSVLIATG........KISTTGIIQPLLLFLASSVGFIVTY........FVIPLLSISV...AFNVICSIS.E..NIRLEKLSKFFSNVSLWTIGVVLTVFLGVLSLETSLSSSVDSLSVKTTQAAVSNFVPVVGKFFSDSFEVVVGATKIIGKTGGIIGILGIVIVGIIPIFKI.TSIMVIYMLLAAFVEM..ItT.DKLIL...KYLSGFVNVYKTMLGI..LIG..VV..I..LFVISTGIIL---nl..........
I0JNV9_HALH3/60-380                  ...................................................fnmk----NFREY-IQ-NEGSLKTSD.WFTGILQFFFQELMLNGKLLASLLFLTLFSTLLQSVQNSFE.N.PVI.S...KIAYLVVYLVLLTLALESFRQVIDYTLEAIDRMSSFMIGLLPLLLGIMASFS........HLMSISFFHPIIVALVQSSGLLVKF........LLIPLFTSSA...LLLIVGSLN.E..TYKVDQLAELLRKTGLAVMGIFLTIFLGVISVQGTVTAVQDGVTMKTARFVTGNFVPVVGRLFTDATDTILGASLVLKNTLGIAGVVILLGIAVFPALKV.FAIAIIYKMAAALLQP..L.G.DGPII...RAMDVVSRHIMYVFAA..LLM..VS..M..MFFLVIVIMVAAS............
A0A0M2PKL5_9BACI/77-397              ..................................................sqkgs-----LLQF-LS-GEKELSFQE.WMKAFLKFLFHELIANGKLLGTLILLTVFSMLLQLLQNAFN.Q.STV.S...KVAYALVYMVLIIIALNSFHVAIQYTNDAIESMSNFILALIPLLLALMASSG........GLASAAFFHPVIIFLMNTSGLLIQN........IVLPLLFLSA...LLNIVSTLT.D..QYKVTQLAGLLRNISIGLIASFLTIFLGVISVQGASAAVTDGITIRTAKFITGNFIPVLGRMFTDATDTVISASILLKNTVGVIGVAILLFIAAFPAIKV.LSLAFIYKLAASILQP..L.G.GGPVI...TCLDIISKSVIYIFAA..LAI..VS..L..MFFLSLTVIIAAG............
A0A089HTH6_PAEDU/134-453             ....................................................tps-----LMDMLLP-GGKGLSLQN.VLSGLLSYMWHEVLYNGKLLVTIVMISVMSMILETLQTAFE.R.KMV.S...KVAYTICFMVVLVIAVNSFNVAIGYAKDAIDRMIDFMMAMIPLLFALLASMG........NIVTVSVTHPLIVFMIHTIGTLIHT........MVFPLLFFSA...VLHLVSSIS.D..KYKLTQLANLLRNIGTGVLGVLLTVFLGVISVRGITSSVTDGVTLRAAKYITGNFVPVIGKMFADATDTVISASLLVKNAIGLSGVIIILFLCAFPAIKI.LVLAIIYNVAGAVMQP..L.G.DTPIV...SCLQTIGKSMIYVFAA..LAA..VS..L..MFFLAVTIMLTAG............
Q9K957_BACHD/70-390                  ..................................................sqkgs-----LMEF-LR-GDKQFRIDE.WGMGLVKYLLHELLVNGKLLGSIILLSVFSVMLQSLQNAFE.Q.KTI.S...KVAYAITYMVLMLIALNSFHVAMDYTKEAISSMVHFMVALLPLLLALMAAIG........NITSAALFHPLIVFMVNTSGMVIHH........FVLPLLFIST...VLSIVSTMT.D..HYKVTKLANFLRTIAVGVLGVFLTVFLGIISVQGATTAVTDGITVRTAKYIAGNFVPVVGRMFTDAADTVMSASLLLKNTVGVAGLAILLMLCAFPAIKV.LSLAVIFHISAAILQP..L.G.AGPIT...DCLSIIGKAIIFIFAS..LAV..VC..L..MFFLAITIMIVAG............
A0A1T5L9X1_9CLOT/70-391              .......................................................IDIKTFITKALK-GELNLSIDG.ILIGFFKKLFKEILINTKLLSQLVIISILCGFLKNLTSSIG.N.NAT.G...QIAFYSCYLIIAGIVIKAFIAAMNVGYQAIDNMVSFMQALMPVILTLLMAAG........SITASTIFKPIIVGSIGITSTIMKD........IILPLIFFSA...ILAIVNNLP.S..KIQISKLASLIKQICLTLIGLVLTIFFGIITIEGVLASSTDGVTLRTARFAMDRFIPIVGGFMSEAIDTVLGCSLLIKNAVGVVGLIIILTIVTFPMLKI.VSLIIIYKITAVLIEP..V.S.DEKIV...NCLNDMSNSLVIIFAT..VIS..VA..I..MFFIAITAIVGAG............
A0A147K7U1_9BACI/70-390              ................................................sqkgsfi--------DFIN-GEKKFSFEE.WVKGIARFAFQELMMNGQLLGTLIMLTLFSMFLQSIQNAFE.S.GTV.S...KVAYALVYMVLIILALNSFRVAMDYAMDAIDTMIHFILALIPILLALIASSG........GLLSAAFFHPVLIFIMNTSGLMIKF........IVLPLLFLSA...LLSIVSTLN.A..EYKVTQLANMLRNWSIGLLGAFMTIFLGVISVQGATAAVSDGITIRTAKFITGNFVPVIGRMFTDAADTVISASVLLKNTVGVVGVAILLMIVAFPAVQI.LMMAFIYKFSAALLQP..L.G.GGPVI...ACLDIISKNIIYVFAS..LAI..VS..L..MFFLCLTIIITAG............
R5VLE4_9CLOT/48-367                  .......................................................FSLREEVEKILS-GETEFSPSD.LLHSFLDQVSKQWNEQKSDFIKLLILGILTGFCANLSQTLG.D.EGL.G...AVSFYVIYGVLCSIVLAGFRQVYDLAQEGVEGVFSFAGALVPSFALALGISG........SSTAALGYYETMLIVISVMQWGLKS........IFLPLIEIYF...MLKILEPVT.-..KGRFLRLAGLCKSLVTLGLKGILTVVLGYQGLQGLILPVMDQVKNNGILTAAKS-VPGVGNLVGGAAQTLVGSTMLIKSAIGVGGVIGFVCVVFYPLLKM.GIFTCFYKVAQALVQP..V.S.SGGFC...VAVAAAGECGKLLFQC..LFY..ST..I..LFSLAILILLLA-t...........
R7K1I0_9CLOT/37-357                  .......................................................FSFSEMVRSLMHSGKAD-TLDN.ISTMMRELAASAFSQDRKLFVSILAIALVGAVFSNFSKILQ.G.REV.A...KTAFYIVYMLFFVTLSSSFLQIAQLAGNTLENLLTFVKVMIPAFFISLSFTQ........GGVAAGAYYEFALTMIMVVNWLLAG........LALPAIHLYF...FLQVVNQLS.E..QDMFSKMAELIRDGVRFGVKAVFGLMMGMNVIQGLIIPVSAEVKNMAVVRMGGA-LPGVGGSVSSVLQTVLCAGKLVKNAVGVAGVIAVFFVCAVPLLQM.VVSRILLQLAAAVLQP..V.S.DRRLI...RGLGGAVKAVDLYIYT..VGV..GA..L..LFISSIAVISAF-t...........
B0K9D4_THEP3/57-378                  ......................................................v-DIKTYIQDVIS-GKQPFNIKE.LFENLLKLFFKELYSSVRLLTQLLILAVIGGILMNLHSSFE.N.ENI.S...EIAFLAVYIVFIVIAVKSFTEALGIGKDAIDSMVNFMQSMLPVLITLLVSVG........AFTSAAFFHPVVIVTVEFIAHLMRD........FILPIILLMT...AVKIVGNIS.E..KFSLNKMGDFLKTLSTASISILLSIFLGVVTIQGLSSSMADGVISRTAKYTVGAFLPLVGGLLSDSVDAVIGASLLIKGAVGTYGLIAIVIISAVPLIKL.FSLIIIYRFAAAVIEP..I.S.DKRIV...NCLSDVATSLTYVFGV..LAS..VT..V..MMFFTITAIIGT-a...........
R6PQT9_9FIRM/42-361                  .......................................................IDFSNLFNNIIT-GNFDEVKSD.IIDNVKELFLENLQKNISNIKLLCVICLLIGLFKNAVNGIE.E.KGI.Y...EIVSFIGQILILSIAIIAFKEMIGILKEVAVSIIDIIDSAIPLMIGVISLNG........NTVHAAGVYAILMFVTERLLYIIDG........IIIPLISTGT...LIRIVNLLS.K..KEMLSKMSDLFSFITNGLIKIGAFAFVALLTFEKIGGGTVGSFFGNSTKSVIKM-IPVVGDIYGNGIDIASSALKTLNSGISLSIIIILITASIIPIIKI.LTITFLYKIVAALIEP..V.S.DKETV...EIIDSIGEGGKQILST..LFS..VL..F..MFIMTNVICM---nf..........
A6TR31_ALKMQ/49-370                  ......................................................i-EIKPLIFKIIK-GEEVLSLKE.ISQAVLGYLFKEVLINWRLLGQIVILAAIYAVLSNLQSAFE.N.DAV.A...KLAYTVCYLVIISITIQTFMIAINIGRDAITSMVTFMQVLLPILLALLMAMG........GIATSAFFHPVLLASIGLIGTIIQN........VVLPLIFFSA...ILAVINNFT.H..KIQITKLASLLKQAAIVILGFVLTTFVGIITIQGITASTVDGITIRTAKFAVDKFIPVVGGFLSDAVDTVIGCSLLLKNAVGAIGLLTIFLICLIPMIKI.LALVIIYKLSAAIIEP..I.A.DKQLV...DCLNSMSNSLVILFAT..VSS..VA..I..MFFITITIIVATG............
A0A2A2IBJ2_9BACI/65-384              ..................................................ektsi-------YEFIK-SKGDFSLKK.TLVGFLEYLFHELILNGKLLGLLLMLTLFSIVLQTMHNAFE.K.SAV.S...KIAYFVVYIVLIFIALNSFYLAVSYAKEAIDTMSSFMIALLPLILGLMATFG........NVISVSFFHPIILFLIPFSGVLISQ........FILPLLFLSA...LLLIVSSLS.D..NYKVTHLANLFKTVALGTLGVFLTIFLGVMSVQGAASAIQDGVAMKTAKFITGNFIPIVGRTFTDAADTILSASLLLKNAVGIVGLIVIVFFALFPAIKI.FAIAIIYKIAAAVLQP..I.G.DGPVI...TTLNTISKYIVYILAC..LLA..VS..F..MFLLAIVIIVVA-s...........
R6VK40_9FIRM/64-383                  .......................................................FSIEEILNQILK-GESLFQKET.MSKWFKNIVKAQLQREQKAMFQVVLLVLLAAVFSNFTAVFG.D.GKT.G...ETSFYITYMLLLALLIKSFGSMGVELKELLENFILFLKALMPSYFLAVTASS........GSATAMIFYEAVLFLIYVIQVVFLK........GIVPTIYVLA...LVELVNYLH.S..EDFLSKMAELLQTLIEWSLKSCMAVVLGMQLIQNMIGPAMDSLKRDIIGKTAAS-IPGIGNAINGVTEVALGTAVIIRNGIGVVGIIILVCIGIRPVIRL.ALLAFLYKLLAAVVQP..V.S.DKRMT...GALSTIGNGYVLFLKV..LLC..ME..L..LIFITIAILS---is..........
A0A1R0XGM6_9BACL/84-403              ....................................................tpt-----LMDMLLP-GDKGLSLKG.VLSGLLGFMWHEVLYNGKLLVTIVMISVLSMILETLQTAFE.R.KTV.S...KVAYTLCYMVVLVIAVNSFNIAIGYAKDAIDRMIDFMMAMIPLLFALLASMG........NIVTVSVTHPLIVFMIHTVGTMIHT........LVFPLLFFSA...VLHLVSALS.E..KYKLTQLANLLRNIGAGLLGVLLTVFLGVISVRGITSSVTDGVTIRAAKYITGNFVPVIGKMFADATDTVISASLLVKNAIGLSGVIIILFLCAFPAIKI.LVLALIYNIAAAVMQP..L.G.ETPIV...VCLQTIGKSMVYVFAA..LAA..VS..L..MFFMAVTIMLTAG............
R5PPL1_9CLOT/1-106                   .......................................................----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........------MLQPIILFLITFIGNFINA........ILIPVILISV...SLSIISNIS.D..RVQVDKLAKFINSSVVWILGIALTVFVGVTSLEGSITNGVDALTVKTTKAAVSNFIPIVGKILR------------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------rcc.........
K0IY03_AMPXN/68-386                  ....................................................rlt------VRDLIT-NQGQLTFID.WVIAIIQLLGQEIFLNGQLLGQLILIAIISALLKNIQSSFQ.S.NTV.T...VVANFVLMMILTTIAVSSFTVISELIIDTISKMHNFIIAILPLILGLMAMLG........GVFSASFFHPLIISFLYFIVVLVDK........VVLVLIFLSL...VLHLVSQMN.Q..TFQLTKLADLLRKISLGLLFMSLTIFLTILSAKGTITAVQDGLGIKTAKFVTNNFIPVVGRMLSEATDTIFATTQVIKNGLGLFGLITILLVVCLPIIKV.AVIGGFYKFAAAILQP..I.G.DDQVV...KSISIISDHVFYLLAI..LVV..VS..F..MFLMIIVVLLIA-s...........
A8MFJ8_ALKOO/65-386                  ......................................................i-EIKPFITKLLK-GEEIVSLEA.ALNGLMKYFFKEVVGNWRILSQIIVLSVIYAILNNLHSAFE.N.EAT.G...KLAYMVCYLVIISITIKSFMIAINLGKETVDTMVLFMQALLPILLGILIAVG........GLTTSAFFHPVLLGSIGFIGTIIKS........VVLPLILFSA...VLSIINNLS.S..RVQVTKLANLFKQVSVVILGFALTAFIGIISIQGIAASTVDGITMRTAKYAIGSFIPIVGGFLSDAMDTVMGYSLLLKNGIGVIGLVSIFIICLIPMVKI.VALIAMYKICAAIVEP..I.A.QNELA...DCLNQMSSSLTLIFAT..VSS..VA..I..MFFITIAIIVGAG............
A0A061PD49_9BACL/84-404              ..................................................sqkgs------FTDFLD-GDQQFSPTE.WGRALLNFLFHELTANVNLLGTLILLAVFSMVLKALQNAFE.H.AAV.S...KVAYSVTFTVLIVISMNSFYIAMSYAQEAVANMVHFMIALLPMVLALLAITG........ATTTAALFHPLIIVLVNTSGLLIER........FVLPLLFISA...IVSVASSMS.E..KFQLTRLATLIRNVAMGTLGAFLTIFLAVISVQGATSAISDGVTLRTAKYIAGNFVPVVGRMFTDATDTVIGASLLLKNTVGIAGLFILFVITVFPALKI.LVLALTFQIVSAIMQP..L.G.GGALG...EVMSLFARTVMFMFAA..VSV..VC..L..MFFLAITIIISAG............
A0A094JPF7_9BACL/66-387              .....................................................qs--SKDIFDWILS-GENNLSLKN.VLSGLIRYFFDEVLYNGKLLGSIIILTVFSMILQTLQTAFE.Q.NQV.S...KVAYAIVFMVVIILAVNSFYVAVDSAKLAIGRMTDFMLSLVPLMMTLMVTMG........NVVSVSLFHPLIVFMIHIIGTLIYT........VVFPLLFFSA...VLSIVSSIT.D..KYKVNHLAGLLRKIGITLLGGLLAVFLGVISIQGATSAVTDGITLRTAKYITGNFVPVVGRTISEAADTVMSASLLVKNTVGLSGVLILLFICAFPALKI.LSLAFIYNFSAAVMQP..L.G.SSPII...ESLNTIGKTLIYIFAS..LAT..VG..L..MFFLSVTILVAAG............
A6CTX0_9BACI/82-402                  ..................................................sqkgs-----LID-FIK-GDKQFSFKA.WFTGIIHFAFQELVMNGKLLGTLILLTIFSMFLQSLQNSFE.G.GNV.S...KVAYAIVFMVLIIIALNSFHVAIDYTKEAIGTMMNFIIALIPLLLALIASSG........GLISAAFFHPVIIFLMNTSGLLIQN........IVLPLLFLSA...LLSIVSTLS.P..QYKVTQLANLLRNWSIGLLGIFMTVFLGVISVQGATAAVTDGITVRTAKFVTGNFVPVIGRMFTDAADTVISASVLLKNTVGIAGVAILLMIAAFPAMKI.LMIALIYKLAAALLQP..L.G.GGPVI...ACLDTISKSVIYVFAA..LAI..VS..F..MFFLSITIMIAAG............
S5Z7E6_BACPJ/62-380                  ...................................................kgpl-------TDFLS-GDKQWSPVE.WLKALARYLFYELQINGKLLGTLILLAVFSTVLQSLQNAFA.Q.QEV.S...KIAHAVVYMVLLLIALNSFRLAAGYALEAVQTMSHFIIALIPLLLALLASSG........GVVSAAFFHPIILFLMNTTGTVVEY........VTLPLLLLAA...LLSVVSTLS.D..RYKATQLADLLNKVALGLLGIILTVFLGVMSVRGTTAAVADGVTLRAAKFVTGNFIPVVGKLFTDAADTVVAASMLLKNAVGLVGVAVLLMIALFPAVKI.FAIVIIYKLSAALLQP..L.G.GGPVL...SCLNIISKSIAYVLAA..LLI..VS..L..MFFLSLTVMVMAG............
I3VWP3_THESW/69-390                  ......................................................t-DVKTYLYNLLN-GKETFSVKN.IVNGILNIFFNEVKASVEILIQLILLAIIGAVLTNLENSFE.N.GGI.S...QVAHMAVYIVLVIVAIKSFMSVLNIGKDAIDSMVNFMQAILPVLITMLASVG........AFVSASFFQPALVMIVEFTAKEIRD........FILPAILFMT...AIRIISRIS.D..KFTLNKLADLFKTICTASISILLSIFIGVLTIQGITSSLADGVISRTTKYAVGAFLPVVGSILSDSIDTIMSASLLIKGAISTFGLIAIVLMAIVPIIKI.FSVMIIYKLSAAVVEP..I.A.DKKIV...DFLSDISTSVAYVFAA..LVS..VT..V..MMFLAITAVINA-s...........
A0A261QGG4_9BACI/71-387              ...................................................plps---------LLENGQ-SVSLSE.WVKGLASFFFHELTANGKLLGTLILLTVFSVFLQILQNAFE.Q.GVV.S...KTAYGIVLMVLMIIALNSFRLTMDYAIEAVDGMIQFLLALVPILLALLATTG........GVVSATLFHPFLLFLMNISAILIQK........VVLPLLFFAT...LISLVSLFS.E..YYQATKLADLLRRFSIGLLSVFMAIYLAVVSIQGTAAAVSDGLAIRAAKFLAGNFIPVVGRMFTEAADTVMSASLLLKNTLGLAGAGMLLLIIVFPALKI.FVLIMIYKISAAMLQP..L.G.DKMVV...DCLDIISKNMTYVLAA..LVI..VS..F..MFFLSIVILVSA-s...........
E0ICJ6_9BACL/90-410                  ...................................................dlps-----FAEMIMP-GGEGLKLST.VVTGLLRFMMHEVLYNGKLLVTIVLLSVFSSILETLQNAFE.R.NAV.S...KVAYAISYMVLIVIAVNSFNVAIGFAKDAIGGMIQFMMAMVPLLLTLLASVG........SIATVSVLHPVIVFMIHAVGTLIYT........VVFPLLFFSA...VLHIASAIT.D..KFKVTQLANLLRNIGIGTLGVLVSLFLGVISVQGATGAMADGVTLRTAKFVAGNFVPVVGKMFSDASDTVISASLLVKNAVGIAGVVILLFLCAFPALKI.LTLALIYNVTAAVMQP..L.G.ESPIV...TCLQTIGKTMIYVFAA..LAA..VA..L..MFFLAVTVILTAG............
A0A0M2VRB2_9BACL/72-391              ....................................................tps-----LMDMLLP-GGDGLTLKG.VLSGIGSYLWHEVLYNGKLLATIVMLSILSLILENFQTAFE.N.STV.S...KVAYTICYMVVLVIAVNSFNVAIGYAREAIDRMIEFMMAMLPLLFALLASMG........NVVTVSVAHPLVIFMVHTVGTLIST........IVFPLLFFSA...LLHLVSSLS.D..KYKLTQLGNLLRGIGMGVLGVLLTVFLGVISVQGITSSITDGVAIRTAKYVTGNFVPVVGKMFADATDTVISASLLVKNSIGLAGVIIILFLCAFPAIKI.LILALIYNVAGAVMQP..L.G.DSPIV...TCLQTIGKTMLFVFAA..LAA..VS..L..MFFLAITIILSA-a...........
A0A1M5SFK8_9CLOT/62-384              .......................................................MTFEDYVTTYTKTGQGALTFDK.FIEIFLKYGLREITATFKTMSTIIVIAIICALIKNLETAFS.N.ENL.S...NIAYFACYSLIIIILAKSFYNGVTLARETIQGMSDFMTALIPVLLMLLAGVG........SVTEAAVLDPIIIGTVNISAKLIVD........ILLPIISFAF...VLIFVNNIS.E..DSKIENLTKLLNQIVLWLQGIIMTVFIGIITIRGISANTIDAVAEKTVKFAVDKFIPIVGGALSDAISTVAGYSLLIKNALSSVGLIVLIAIVLIPIIKL.LAIGFIYKITAALIEP..I.S.DKRLV...KSVSAAGDSLILITSC..LIS..VS..V..MFFIMIAIVASAG............
A0A1M5Z0D1_9FIRM/64-383              ......................................................f-SLVRTFED-LKSGKLSLKPEN.LGKTLLTVLGHQILGTAPLIGKLLILAVLGAVLGQLQAAFG.-.GSV.G...KTARVMTYLVLLSLAITSFREALEIATGTIDQMVGLMQTMFPVILTLLITMG........NLTSAALFKPLIMGSLTVLATIIKT........VILPLFFLAA...VLKLFNQIS.E..QFKLGKLAGLFEFAGKLSLGVIMTVFIGVMTVQGVTGGVADSVVFRTAKYSADL-VPVVGKFFKDAVELVITSGLLLKNAVGIVALLAIIVICLGPLIKI.LAMILVFRISAALIEP..L.G.EKPLA...DSLQEMSKSLILVLVS..VAS..VG..I..MFFMAVAVVVGTG............
R5D7P0_9FIRM/32-352                  ..................................................tlpde------VKELAGDPDDAGDVQA.FFDRLSDTVKQKLKDNAGGILKKAVSVVIVAVLCSILVLFG.G.EKT.P...ELVALCGCAAITILCVSDTNSYINQGTKAIDDISAFSKILLPAMCTASAACG........EISSAAVRYAASAMFMDVFIALAQN........IIVPFIYAYI...AVSIASAAF.D..NPSLGSISKLLKWVSTSLMTLLSLGFTAYIGVSSAIASGGDKLASKIAKTTISTAFPVVGGIISDAASSVVAGAEIVKNTLGAFGMIAVLSLCISPMVVI.GLNYLAFKAAGAFTST..L.K.LPQIA...ALTQGIGTAFGMLLGL..VGC..CG..V..MMFISLI------scmra.......
B2A541_NATTJ/75-396                  ......................................................l-SFRDLFYMIVG-EEEGFSLAQ.VFSGLLQFFLHEVIVNFRLLGKVIVLTVIAALLTALQGAFA.N.EKV.A...RLAHTVIYFAVVIIALQSFYLAVDIGREAVSSMVDIILAMVPLLLTLLASMG........AVTTVAIFHPISIFLINTFSTLINN........VIFPLLLFSA...VLSVISHLN.P..KFKVSSLAGLFQNISITAIGFFLTIFIGIMGLQGVGGAVADGISIRAAKFLTGSFIPVIGKALSDAVETVMGASLVLTNSVTMAGAIILFFVTIFPALKI.LALVFVYKLAASLLEP..L.G.ETSIP...ESLGTMSKCLTWVFAG..VAT..VS..I..MFFIAMAAIVGA-a...........
A0A1M6C2P9_9CLOT/64-385              ......................................................i-DLREGIRSLIR-GESSLTLRD.TLNGLFKYLFKEIVANSMLLIRLIVLAIICAFLSNLSNAFE.S.NAV.G...KLAYMVCYLVIIAIAIQSFSIATAVGIAVINDMVLFMQALLPLLLTLLMAMG........GITSSALFQPVIIAAVSTISTLMKD........IVMPIIFFSA...ILSIVNNLS.S..RIHVSKLASLLKQACVVLLGFTLTVFIGIITIQGVAASTTDGVTIRTAKFAVDRFIPVVGGFISEAVDAIVGCSLLLKNAIGALGLFALAFIVLMPLLKI.FSLIVIYKIAAAIIEP..I.T.DSQLV...SCLNDMSGSLVLIFAT..VLS..VA..V..MFFMAVTVIVGAG............
A0A098EZI7_9BACI/68-388              .................................................sqkgsl-------YDFLK-GDKQFSLKE.WGKGLLAFAFHEFITNGKLLGSLILLTVFSMFLQSLQNAFE.K.STI.S...KVAYSIVFMVLVILALNSFHIVIQFTNETIQTMMAFILALVPLLLGLIAASG........GVVSAAFFHPVVLFLMNTSGLLIEH........VVLPLLFLST...LLSIVSTMS.E..HYKVSQLAGMLRNWSIGLLGIFLTVFLGVLSVQGASSAVSDGVAIRTAKFITGNFVPVIGRAFTDAADTVISASVLLKNTVGIAGVAILLVIAAFPAIKI.LMIAFIYKFAAAILQP..L.G.GGPII...ACLDTIGKSIIYVFAS..LGI..VS..L..MFFLCITVIVAAG............
A5D347_PELTS/58-379                  .......................................................INFKEMVGRLAR-GELDWDPAG.IVKNILAQMFKEVVASFDLLGKLVILAVICAVLQNLVSSFE.K.STV.G...QLAYSITCLVLITIAIGSFSLAVNAGREAVDTMVTVMQALTPVLLTLLVAVG........GVASAALFSPVILANLSVFGTLIKN........VVLPLLFFVA...VLGLTGSLS.E..RFKLSGLAGLLKTAAMGLMGIYSTVFLGILAIQGVAGAVGDSVTFRTAKFGVDAFVPVVGGMLADALEAVVSTSLLVKNAIGIAGIAVLGTVALLPLLKI.MTLAFIYKLAGALIQP..I.G.EDQMA...GCLNDLGNSLLLIFAA..VAT..AG..L..LFFFAIAIMVGVG............
W6RYB0_9CLOT/55-377                  .......................................................IDFSKYIEDTFKNGTSELNIKE.ISSTLIKYTVKEIYASIKIMALLAVMVLLTSFLMSLQEAFS.G.NNL.I...NISFYAIYGLIMILLMKNMLIGVEECKEIIKSLSDFMVVLIPLLLTMLIGIG........GFTEAVAMDPIVIAVVNICVTIVVN........FLLPAILMVT...VLKLINNLS.D..DDKLTKLTALFNSVIKYTQGIMLTVFITVLTIRGVTTRTFDKVAVETAKFAVDNFVPVVGGALSDAVTSVANYSLLIKNSLSSVGLIVIVFLILTPIIKL.FILSLINKFTAAILEP..I.G.NKKII...DSINEVGNSLMQIISC..VVV..VS..L..MFFIMIAIIAS--ak..........
D4N0G6_ANAHA/48-368                  ......................................................l-SYTQLVKQLIH-GNVKGVLHT.IKAKMKEVFLNRMLIQKDLIREILLIAFTAAIFKNLSDSFF.Q.QST.A...NSAFYITYVILCGVMVHSFFYLNKTVTQLVTLMADYMKGMIMAYSLAVVSTS........GITTSTTVYEFYLLLIYAMTTLTNV........VLLPMIKILF...VLKIINHIS.K..EEHFSRLCKTLEGMIKFLLKGFLSVLLGVQLIQSMILPAVDSMKNTVLQKGMSA-IPGIGNGLNSAMTMVIGSAVVIKNSIGAVGILVLIVIIVPPVIEI.TAVVLTYLLAGIMIQP..I.S.DKRIT...GAMDAVIQSGKLMLSM..IFT..MA..L..LFILSVALIAFST............
A0A0A3IU91_9BACI/1-295               ......................................................m----------------------.--NEILNIFLDPLKIAGQSILLIITYTVIFLSIEAYVPKFK.-.---.-...KWSDTLFIIVLVLTLGQTVMDAFSLMAQLAGIFSNFFLALYPIIMSLLVILN........SVFSFIAWSPIIFFIFELLILLCER........ILIPAVTIAL...IFDFCTRFI.G..EMSFGKASDLIRGSVMTIITATVIAIMTILSFTGVAFFTIDKAIADPVKKVIEQTIPIVGSLIVQGFSIFNKYQSTATTVAGLSAMTAFWVAAFYPAGKL.LIHAMTFKLLAAIIEP..F.S.SSTVS...GLVDDVGKSLLVLCAV..AFL..LG..I..AFVFIWLILMVM-t...........
A0A0N0E9X1_9BACI/63-383              ..................................................sqkgs-----FM-EFVK-GDKSFSLEE.WSKGFLKYLFHELLANGKLLGSLILLTIFSMFLQTLQNAFE.Q.KTV.S...KVAYSVVFMVLIIIALNSFHIVISYTLEAITAMTGFIIALVPLLIALIASSG........GLVSAAFFHPIILFLMNTSGLLIQY........VVLPLLFLSA...ILSIVSTLS.E..HYKVTQLAQLLRNVSIGILGIYLTVFLGVISVQGATAAVTDGIAIRTAKFVTGNFIPVIGRMFTDATDTVITASVLLKNTVGILGVATLILLAAFPAVKI.LSIAIIYKLAAALLQP..L.G.GGTVI...KCLDIISKSIIYIFAA..LAI..VS..F..MFFLSITVIIAAG............
A0A1R0WKG4_9BACL/84-141              ....................................................tpt-----LMDMLLP-GDKGLSLKG.VLSGLLGFMWHEVLYNGKLLVTIVMISVLSMILETLQT---.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..----------------------------------------------------------------------------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------a...........
R6K4N4_9FIRM/85-402                  ......................................................i-SYGKIMQSLISGGNG----LE.QIKDISAYITEVVKTGRNEVVQVVCLCIFSAVLNVLTPLFN.E.KQL.K...DTAAGIISVSLVTILLSVFMGVFMIAQDAVTSLINIYKVISMVFFPAVCATG........SPLSAAGYYQIVIWMMAAADIFIRN........ILMNLNRVYV...CVSLCDCVD.K..EAHFSKLCGFIQKGIKWCGYTMMTVFMGLNGIKSIINPVKDSINTSYVYKAVSI-IPGIGDAASMLSQTVIASSSLIKNTIGAAGVIALVLCMSFPVIKL.VVISCIYQGVAAVMEP..V.A.DKRII...RAVQALTSAVGCLTYL..VII..SS..V..LFILTIVIVCIAT............
W4QW22_BACA3/65-364                  ...................................................sqkg-----TFMEFVR-GEKQFSIKE.WGVGLLRFFLHELLVNGKLLGSLILLTVFCMILQSLQNAFE.Q.HTV.S...KVAYAITYMVLMIIALNSFHVAITYASDAINSMIHFMIALLPLLLAMMAAIG........NITSAALFHPLIIFLVNTSGLLIQH........VVLPLLFLSA...VLSIVSTLT.D..HYKVTKLANFLRNIAVGTLGVFLTVFLGVISVQGAATAVSDGITVRTAKFIAGNLVPVIGRMFTDAADTVLSASVLLKNTIGIAGLGILLMLCAFPALKV.LSLAIIFNLSAAVLQP..L.G.GGPII...ECLSIIGKA-------..---..--..-..-------------sssfs.......
V9HFW0_9CLOT/81-403                  ....................................................ldp---VEYIKGYIKNGEGNLSFKT.ISDAVISFLFKEVKTVLALSISIIAIAIICSLLKNLQTAFS.N.EGI.S...NIAFFACYALLIVILSKSFIVSINIATDIIKDLSDFMVAILPVLVMMIGTVG........GFTQAATMDPIVVGATLIIPRIYTT........VIIPLILITF...VLEFANNIS.T..EHKISNLCKLTKQITIWLQGIILTIFIGLLTVRGITSSTIDAVTLKTAKFAIDNFIPIVGKAFSDAIASVAGYSLIIKNAISSVGLIIIILMMLYPIIKL.VLISFVYKLTAAVIEP..I.S.DKRIT...SSIAAAGDSLILIMSC..VLS..VS..L..MFFILLGIMASAG............
R7DA98_9FIRM/101-420                 .......................................................FSMKDMLDGLIK-GEKVLSEDT.VQEMVHSFLFSGLEKEKSLLIKILLLILLSAVLANFADVFE.S.GQI.G...DICFYIVYLLLFILLMDSFSSVTRSVQQTITWMAEFMRGLAPAYFLTISIAA........GSSTAAVFYEGVLILTWLIQEVILN........LLFPGACLYV...LISLINNLS.K..EEMLGKMVELLDTAVSWGLKTLLGMVVGLQVVRGLIAPVMDILKRSALGKAAGA-LPGVGNAVNMVTELVLTSAVLVRNCLGVVILFAFVAAGAGPVIHY.GILSLLYRFLAAIAQP..V.S.EKRIV...DSLATMGEGCALLLRI..LFT..AE..I..LCILDFVILM---tg..........
D7GUK1_9FIRM/94-414                  ......................................................l-TFRDLMDM-IRKGDAENVFLY.GKDRIVSALFSEIRTNTSFLAEILILSLCGAACSGFFGIFG.S.SQL.S...ETGAYVICICVQTFLAASFFASIRIAEETTGDILGFMKVLLPAYFLAVTMAG........GAVTSASVCGFTLGAIGVIQAVVSG........FLLPIMKLYM...VLSLVGNLF.R..EEMFSVMTEFLGKVVGWTVKTMFGIVVGFHLIQGLVLPQADAMKNAAVVRTIEA-VPGIGAGAGAMSNLLMGSAVLIKNTAGAAAVAVLIFLASVPMVKL.AVLMALYYLAAAVMQP..V.C.DKRLA...ACMAQSAVGHGMLLEI..VGY..SL..A..LFAVTIAVISYS-t...........
W9B5E5_9BACI/67-386                  ...................................................ekts------VYEFIK-NNGELSIKN.AINGLLEFLFHELIVNGKLLGLLIMLILFSVLLQTMHNAFE.K.SSV.S...KIAYFVVYIVLIFIALNSFYLAVSYAKEAIDTMSSFMVALLPLMLGLMATFG........NIVSVSFFHPIIIFLVNFSGILVST........IILPLLFLSA...LLLIVSSLS.E..NYKVTHLANLFKTVGLGILGVFFTIFLGVMSVQGATSAIQDGVAMKTAKFITGNFIPVIGRTFTDAADTILSASLLLKNAVGLVGLLLIIFIALFPALKI.FAIALIYKIAAAILQP..L.G.DGPVI...SSINTISKYIVYILAC..MLA..VS..F..MFLLAIVIIVIA-s...........
A0A265Q8B0_9FIRM/59-379              ......................................................f-NTKDFLLGLIK-GDVKFTFKD.IVKNIGLLFFKELRTSLILLAKILIITLISSILTNLQSTFE.N.ASV.A...ELANYISYVLIAILVISSFTQVMELAKETTDRMVGFMQAILPILLTLLTAAS........GPNTKMLFHPMILMTVNLIGILIKT........IILPLIYFSF...IISIISNIS.N..RVEFSKLSELGRQVITFIISGALTLFIGIITIYGLG-TKIDGLTIRTAKFAVDKLIPIVGGFLSDAVEAVVGCSAILKNGLGFIGLLILLFICILPVIKI.LVLLFTYKLITVVIQP..V.G.SSNLV...EFFNQVGKSLLLILVS..LIS..TG..T..MFFITITIIVEA-g...........
A0A0W7YIG4_9BACI/1-297               ....................................................mqe---------------------Q.ILSFLIDPFFLLL----KMTLMLCSYVIIVLIVNMVLPEFE.-.KGT.R...ILFFLIVLATIGPVVVKSFTLIDEIA----QGLAHLFTAFYPILTSSFLLSS........SITAIASWQPFLLFFVQVLTIISSK........WLIPGVLLAI...VFDVCSVIV.K..EISFTRIAELIRFTIMSIVSASVICYILLMTAGGVAAFSVNAAVAEPVKKLIEENIPVVGSFIVDSFSMFQHMTQFTSSLTSISAFIAVITVSFIPTVQL.VVSAYSLKLLAAILEP..I.A.FDDIC...RLLEQISKSLFTLCAV..SFL..IAfsF..MFSCFFLIV----fvq.........
A0A0P9CUD6_9BACL/56-375              ....................................................qsg----NIIRSILENGG--WNLHG.LIHGILRYFFSEVFDNIRLLGAILLLSVLAVILQSLQSAFE.Q.QTV.S...QIAYAVIFFVLIGLAIGSFTEAVGYAKHAIQSMTDFMLATVPLVVTLMAASG........AVTSAAFFQPMLVFAVHLISNVIFL........FVFPMIFFAA...ILDLVSSLS.P..RYQVTRLAGFFRTAGVATLGLCLSAFLGVASVQGLGKGVADGVTLRLAKFSVNTFVPIVGKAMSDAAETVVSASMLVKNAVGVAGLLIVLCLALFPALKI.LALSMIYNGSAALMQP..L.G.DGPMV...KTLGSLSKTLVLVFAC..VAA..VA..L..MFFMAICILLLS-a...........
R7M9I9_9CLOT/2-119                   ......................................................i----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..-----------------------------------------GITAKTTKAAVSNFIPVVGKILGDAVDTVIGCSNILKNAVGIVGVIVVITICVGPIIKL.AILMGMYYLASAICQP..I.A.DEKIV...KLLEEIGNTFKMLLAI..MCS..VS..V..MLIVGTTLVLKI-t...........
K4LIH5_THEPS/76-397                  ......................................................f-SLIEMLEG-IRQGEIDFDLKG.LFKELIKFFFREFLTHAVLLGKLIVLGAVLALLAHLQCAFE.Q.NTV.A...RLAHSVGLLSLFTVALSSFTLALSAGREAIGSMVGFMQSLIPVVMTLLAAVG........NLTSVALMHPVIFLSLNVLGTLTQN........IVFPLIFCSA...VLGIVSQLS.E..RFQVSRLAGLFRDGSVLLLGLFLTIFTGILAVQGVAGAVADGVGLRTAKYLTGAFVPVVGGILSDAVEAVVGCSLFIKNAVGILGVLAIFFLCTIPVVKI.LAAAMVYRLAGAILQP..I.G.ARELS...DSLHLLGNHLFLVFAV..VAA..VG..V..MFFMALGIIVGL-g...........
C6J3T2_9BACL/71-391                  ....................................................klp----SFMDMLLQ-QDQSFSLKA.GLSGLMRYMWHEVLYNGHILVTIVLLSIFSMILETLQTAFE.R.KQV.S...KVAYSICYMVILVLAINSFHVAITYATNAISGMIDFMMAMVPLLFTLLASLG........NAVTVTVTHPLVVFMVHAVGTAVHT........VIFPLLFFSA...VLHIVSSLS.D..KYKLTQLANLLRTVSMALLGILLTVFLGVISVKGIAGSVADGVTLRAAKYLTGNFVPVVGKVFADATDTVISASLLVKNSIGLVGVIILLFLCAFPAIKI.ITLALIFNLAAAVMQP..L.G.DSPVI...ACLETIGKSMLYVFAA..LAA..VG..M..MFFLAITIMLTAG............
R9J588_9FIRM/67-386                  .......................................................FDFQGLVRRVIA-GE-EIEKER.LVQEIFYMIFAEISAFRGTLVQVVLLCAAFAILYNFADVFE.N.PAV.T...EISFYMVYMLLLILLMKSFFILRDVSVDVIGEMMTFLKVLIPTFTMSMSFSG........QITTAAGFYSMTFLLIYGMEWIMQY........LVIPAVQIYV...ALELMNYLT.E..EELLSKMTDLLKSGIAWVMKLLFTVVVGINVVQNLLTPVIDTFKTSLIAKTAGM-LPGLGASINAVTEIMVGSGIIIKNGIGIAAILVILLLCAGPLIQV.GVMTFLYKILAAIIQP..I.S.DKRMI...GCISSVGEGGRLLEKA..VVT..TT..V..MFLVTIAMVTAAT............
A0A1B8WQN0_9BACI/82-401              ....................................................tpt-----LMDMLLP-GDKGLSLKG.VLSGLGAYMWHEVMYNGKLLVTIVMISVMSMILETLQTAFE.R.KTV.S...KVAYTLCYMVVLVIAVNSFNIAIGYAKDAIDRMIDFMMAMIPLLFALLASMG........NIITVSVTHPLIVFMIHTVGTLIHT........MVFPLLFFSA...VLHLVSSLS.E..KYKLTQLANLLRNIGAGLLGVLLTVFLGVISVRGITSSVTDGVTIRAAKYITGNFVPVIGKMFADATDTVISASLLVKNAIGLSGVIIILFLCAFPAIKI.LVLALIYNVAAAVMQP..L.G.ETPIV...TCLQTIGKSMVYVFAA..LAA..VS..L..MFFLAVTIMLTAG............
W4V369_9FIRM/86-196                  ......................................................y-DPEKIIRDVAK-GQFGFDAPD.IINRILSYLFKEIYLNMDVLIKLIVLVALCAVLNNLQTSFL.N.KSV.G...ELAFYVCYIVLVSVLLVSFSSVVRAGTEIIDRMVNFMYSSIPA---------........-------------------------........----------...---------.-..----------------------------------------------------------------------------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------w...........
L0FB24_DESDL/90-409                  .......................................................FSLSHMFDD-LRQGKISLNPVD.IGNSLLVLLGKEIVVSAPLIAKLLILAVLTAVLQQLQSAF-.N.GGV.G...KMAQALAFLMLMGIALATFQMAMDVAYTAIQNMTGFMQTLLPVMMTMLAAMG........NLTTAALFKPIVLGSLAFLATLIKT........VALPLFFMAA...VLKLFNHIS.S..EFKLSKLAGLLEFAGKLSLGLFLTVFIGVMTVQGVTGGVADGVVLRTAKYSADL-IPVVGKFFKDAVELVVTSGLLLKNALGIVAIIALALICLGPVVKL.VAMILVFKISSALIEP..L.G.QTELA...DTLQEMSKSLIFIFAS..VAS..VA..I..MFFMAIVVVVGSG............
Q8XJD1_CLOPE/61-384                  ......................................................m-SAKEYIMNYLESGEDPITLKK.IGASILSYIFRELNIVLKFIASILVIALLSALLKNLQDAFNiE.EGV.T...QIAFFACYALLIMLLTKSFFISLNLGKEVLTSIIDFMNVIVPVIVMLIATSG........GVTSAVTIDPIVLGAVSITPRIYTY........FLFPLILAYF...TLQFVNNLS.S..EFKIDRMCKFIKQVVMISQGFILTIFVGILTLRGMTADTLDAVAVKTVKFAVDNFVPIVGKAFSDAITTVAGYSLAMKSVITSLGVIVLVVIVIYPIIKI.GLMAICFKLTSAVIEP..V.V.DSKIS...SSVETVGEALFMIMSC..IIS..VS..I..MFFIMASMMATAG............
A0A1I0WHA3_9CLOT/69-391              ......................................................i-NPKEFIKENMKDGRGDFSIKQ.FLPAIKKLFLKEISSTVKLMLVIIVIGTICALLKNLQSAFN.N.ESV.C...KVAYFACYALFIIVLSKSFILALDVAKNTISDITNFMAALIPVLFVLLCSIG........GIAQAATMDPIVLGLVNIVPRIYVD........FIIPLILMVF...VLQFINNIC.D..EYKISKLVKLIKQVAIVSQGIIMTIFIGILSIRGITAKTLDAVTIKTAKFAIDNFVPIVGKALSDAVATVAGYSLVLKSSISTLGLIILVLMILAPIIKI.FLMSIIYKLTGALLEP..I.S.DGKLV...ECITSAGDSLVLIMSC..VIS..IS..V..MCFIMIAIMASAG............
A0A1Y4RP79_9FIRM/93-413              .......................................................ISFSSLLERLMA-GQFSEAAEL.LVTAAKEAFLGGMADSAGFLGQILVLGVAGAVFAGFAGVFQ.T.GQI.S...ETGFFVTYLLVFTLLAAGFSQGAALAQGALEDVLEFMRALMPAYFLAAAFSG........GAVTAAGLYEGMLFLISGVQWLFLT........VLLPGVQIYF...LLVLAGHMI.K..EDMLSRFRDLVKTAVSWGIRTMAGLVVGINLLQGMILPYADAVKNSGITKALEA-IPGIGRGIGVAAKMVMGSGVLIKNTMGAGAVFVLAITVLAPLVKL.AVLAVLYQLASAAMEP..V.C.DKRIT...SCVAEAAEGYKLLVKL..VAS..AL..G..LFVIAIAMICMAT............
A0A1S2R1X4_9BACI/76-396              .................................................sqkgsl-------YDFIK-GEKKFSFSQ.WGQGILKFVFHEFVANGKLLGSLIMLTVFSMFLQSMQNAFE.K.SAI.S...KVAYAVVYMVLVILALNSFHVAIDYTNEAIGTMISFVLALIPLLLAIIAATG........GVVSAAFFHPVILFLMNTSGMFMQY........IILPLLFLAT...LLSIVSTMS.D..QYKVTQLAQLLRNWSIGLMGLFLTVFLGVISVQGASAAVTDGVAIRTAKFITGNFIPVIGRIFTDASDTIISASSLLKNSVGIAGVAILLIIVAFPAFKI.LMIAFIYKFAAAILQP..L.G.GGPVI...SCLDIISKSVIYVFAA..LGI..VS..L..MFFLSITVIVAAG............
A0A101V9I2_9FIRM/66-387              .......................................................ISIKNTIQG-IRDGSISLQIGE.IFNGVLRYIFREFIAHSALLGKLIVLAMICVVLQNLQSAFA.G.STV.G...KLSYGITYLVLITVAVSSFILVIDTGRTAVEQMVTFVQALIPILLTLLAAMG........GFTSAAFIHPFMMVSLAVITTIIST........IVFPMIHFYA...VLSIVSHIS.E..KFKVSQLAGLIKDVTLGILLLCMTIFVGALGFQGVTGVVADTLTLRTAKFLTGSFIPVVGHMMTDALEAVVGTSILLKNAIGMVGVLVLLAIWIFPMLKI.LVIGAIYRLAGALVQP..F.G.ESQIG...EALQTMSKCINLVFAA..VAA..VG..L..MFFIAVSIIIGL-g...........
A0A1Y4USF7_9FIRM/54-374              .......................................................MSFEDIVKKVLE-GDIDFSLSD.AFNFFLNSLFGEIKDVFSIFIGMTAVMIMSALLRTVTTSFC.G.KSV.G...ELGFYVCYMIMVLSICNVFYTGAEIAIETVENMGGFLNLTIPIFITLAVSSG........GVGEGVVIAPFVGGVSTFIIGFISK........FVVPSAVTVS...TFEIINYIS.E..RDLLKSFTQLLKKCISMTLKGTALLFTGILSIQKLAVPAVSGVAGKTAKAVVGA-VPVIGDVMSGTVESAVAMISAIKGSVSAVSIVIIIGMCLIPIIKL.SAVFIMYRLAGALSEP..F.C.DKRLI...GCMECAGDFTLLIVGA..VVT..SA..I..IFIFSIIVIVTSG............
A0A0K2SMS7_9FIRM/67-386              ..........................................dvrrmladpgaga----------------GLDVGR.MGRELGAYLLREVVFHARLLGQLLILVVVGSVLQQLSPAGG.G.GRV.D...EIAFLMVFLALSYLGLQSFREVVAIVGSSVEQMTGLMFALLPLLATLVAAAG........GVTSAGLFHPLLITTVTGVAAVMQR........WILPLLVIAA...VLSVAAHFS.R..GFPVSRLAGLARQAVTVGLGLVFTVFIGVMAVRGVVGPVADGVALRTAKFLTGNFVPVVGRMMSDAVEVVMGGSLVIKSGVGAFGLLALLLAVTVPVLKI.VAILAVYKVVTALMQP..L.C.DERLV...GALEGIGSSVALAMVS..LAT..VG..I..MFFISIMVLVGAG............
A0A150FPU4_CLOPD/58-379              ......................................................i-NIKTFLLDVAR-GKKNIFDII.NKDVLSTYLFREIRTNLKIFISILILSVISSLLKNLDNSFS.S.GTI.S...KLSNYVIFLVLVSLTFIGYKEVLYICSTTIENMSRFMEIVIPIEIAILVTLG........FPITSATLSPIFLGAIAFITMVFKR........FIVISMTLAF...SILIINSIS.E..NLKLKKLFSFIKQFNIFSVGAILTLYLGIISIQGIYITSFDKLSMKTVKFAVGNFIPIVGNLVSDSIDIVLSSSYLLKSVIGSLGLIILLSICLLPIIKI.ACILLVYKISAAIIEP..I.S.DDNIA...SYINEVGNLIAVSLAS..LVV..IS..M..IFFITMAILASI-g...........
E6SL62_THEM7/162-483                 .....................................................ld--WEHTLKA-LRQGELPWDAGD.LFGALLRALAGEVITNGGLLLRLLVLAVLLAVLQAIENAFD.N.EAV.A...RAAYAVTYLAPIALALVSFRDALAISQQAIQGLVDFLLASLPVLLTLMASTG........ALATAGILHPLVVATAHSTSVIIGQ........WVLPLIFLAA...VVDIAGHFP.V..GTSLSGLSRLLRQAALLILGLAGTVFLAVVAIQGAAGTVADGIALRTAKYLVGAFVPVVGGMLADSVELVVTSSLLLKNAVNLLGLLAVFALVAFPLLKL.VALVFVYRLVAAAIQP..V.G.PGHVT...GALQSMGDHLVLVGAA..TAV..VG..L..MFFIVLAVMLAAG............
A0A0M0GBG2_SPOGL/72-392              .................................................sqkgsl-------YEFIK-GEKEFSLKE.WATGAMKFVFHEFIVNGKLLGTLILLTVFSMFLQSLQNSFE.K.STV.S...KAAYAIVFMVLIIIALNSFHVAITYTQETISTMVSFIMALIPLLLALIASSG........GVVSAAFFHPVILFLMNVSGLFIQY........VILPLLFLSA...LLSIVSTLS.E..HYKVTQLANLLRNWSIGLLGMFLTVFLGVISVQGASAAVTDGITIRTAKFITGNFIPVIGRMFTDATDTVISASVLLKNTVGIAGVAILLIIAAFPAIKI.LMIAFIYKFAAAILQP..L.G.GGPII...SCLDVISKSIIYVFAA..LAI..VS..L..MFFLSITVIIAAG............
A0A0U4WFA3_9BACL/67-387              ....................................................mqs---KSLFEM-LT-GENALSIGG.VAKGLGAFLFHELLANGKLLGAILLITVFAMILETMQNAFE.K.HAV.S...TVAYAISYLVLIILAISSFRLAVEFAQGAIGDMVGFMTALMPLVLALLASTG........GLASAALFHPMVIFLVNTSGTLIAN........IVFPLLFLSA...LLSLVSTFS.T..KYQLTKLAGILRTVSLGVLGSFFTIFLGVLSLQGASAAVADGVALRTAKYIAGNFVPVVGRMFADATDTVVGASLLVKNSIGLAGVVILLFLAAFPAFKI.FILAFVYNLSSAVMQP..L.G.NSPII...ACLGIIGKNLLYVFAA..LAT..VC..L..MFFLAITIVISA-a...........
A0A0N0Z8Y6_9BACI/44-315              ...................................................kgpl-------TDFLS-GDKQWSPSE.WLKALARYLFYELQVNGKLLGTLILLAVFSTVLQSLQNAFA.Q.QEV.S...KIAQAVVYMVLLLIALNSFRLAADYALEAVRTMSHFIIALVPLLLALLATSG........GVASAAFFHPIILFVMNTTGTVVEY........VTLPLLLLAA...LLSVVSTLS.D..RYKATQLADLLNKAALGLLGLILTVFLGVMSVRGATAAVADGVALRAAKFVTGNFIPVVGKLFTDAADTVVAASMLLKNTVGLVGAAILLMIAIFPAVKF.----------------..-.-.-----...----------------..---..--..-..-------------spsssstnyrl.
A3DDP7_CLOTH/81-402                  ......................................................y-DPEKIIRDVAK-GKLNFNLPD.IINKILTYLFEEIYLNMGILVKLMVLVALCAILNNLQSSFL.N.KGV.G...ELAFYVCYIVLVSILLVSFSSVVKSGTEIIDRMVNFMYSSIPVLVTLIISSG........NISSGGVLQPLLIMVVQVSATIIKN........ILIPLIVLST...IISIVDNIS.D..KIQISRLSSFLKNITQWTLGLILTIFVAIVSLQGSLGAVVDGVTSKTAKFAIGAFIPVAGKYLADAADAVIGCTLLIKNAVGVAIMIGIVVICLLPLLKI.LAVVLLYRMACVLLEP..L.A.EGRII...KCISDVAGSMAHILGI..AAS..VA..F..MFLMTVTALILA-s...........
A0A0H4L0E0_9BACI/63-383              ...................................................sqkg----SLVEF-LK-GDKELSLEE.WLKGLMKFFLHEIIANGKLLGTLIMLTIFCVFLQNLQNAFE.K.TTV.S...KVAYALVYLVLIVIALNSFHIAISYATEAIQTMIHFIIALIPLLLALMASSG........GVMSAAFFHPVIIFLMNTSGLLIQY........VVMPLLFLSA...LLSIVSTIS.E..QYKVTQLAQLMRNVSIGVLGGFLTIFLGVISVQGTSSAVADGITVRTAKFITGNFVPVVGRMFTDATDTVLSASLLLKNTVGLVGVAILLFITAFPALKL.LSIAIIYKLAAALIQP..V.G.GGPII...SCLSIISRSVIYIFAA..LAV..VS..L..MFFLCITLVITA-s...........
C5VSZ2_CLOBO/59-381                  ......................................................v-DIKTYVKDYMKNGKGDVSKSK.FIKALAMYSFREVIACGKLMAMIVVICIICALINNLENAFS.N.GNL.S...NIAYFACYALLIIIITKTFYIGITTAKDILKQMTDFMAALMPVLLMLLASVG........GFTQAATMDPIIIGVTNISARLFMD........LIIPIISISF...VIQFCNNIS.D..DHKIDKLSKLLNKSVLWIQGIVMTIFIGIITIRGMTTSTLDAVTEKTAKFAIDNFIPVVGKSLSDAISTVAGYSLLLKNALSSIGLIILITIIIFPIIKL.FSMGFIYKLTGALIEP..I.S.NGKLV...KCIESAGDSIILITSC..VIS..VS..V..MFFIIICIVASAG............
W1SDA7_9BACI/72-392                  .................................................sqkgsl-------YEFIK-GDKKFSFKQ.WGQGVLKFAFHEFVANGKLLGSLIMLTIFSMFLQSMQNAFE.K.SAI.S...KVAYSIVYMVLVILALNSFHVAIDYTNEAIGMMISFVLALVPLLLALIAASG........GLVSAAFFHPVVLFLMNMSGLFMQY........IILPLLFLAT...LLSIVSTMS.E..QYKVSQLAALLRNWSIGLMGLFLTVFLGVISVQGASAAVSDGVTIRTAKFITGNFIPVIGRMFTDATDTVVSASVLLKNTVGIAGVAILLIIVAFPAIKI.LMIAFIYKFAAAILQP..L.G.GGPII...TCLDIISKSVIYVFAA..LGI..VS..L..MFFLCITVIVAAG............
R6S603_9FIRM/56-375                  .......................................................FSLEKALGELA-RGEKSLSKGQ.AAELLKEFLLSHLVWDREIYVQIILLVVVAALFSNFTEVFG.N.GQT.G...EISFYLVYMLLAAILIHSFGTASQEVSGKLQELMVFMKALMPSYFLAVTAAS........GSATAMVFYEMVMGAAYVVQVILLK........AVIPGIHAYV...LIQIVNFLH.R..EELLSRMAELLQTIVEWTLKTCTAAMIGMQLVQNMITPAVDSLKRDVIGKTAAA-IPGVGNAIDGVTEVALATAVLIRNSLGVLGILILLLIGLPPIIRL.GIMTLLYKFLAAFLQP..V.S.DKRMS...GCLSAVGEGCRLLLKV..LLM..VE..L..LLLITIAILAV--s...........
A0A0C2VAN9_9BACL/67-387              ..................................................irvps-----LMEL-LA-GGQRLQLDH.ILKGLLRYLFHEIIVSGKLLGSIMVLTVFSILLETLQSSFE.R.NTV.S...KIAYAISFMVLVIIAVNSFSVAIGYAKTAIADMIQFMLAIVPLLLTLLASTG........GVASVTILHPMIVFMVHTVGTAIYL........IVFPLLFFSA...VLHMVSSIT.D..KYKVTQLADLLRNVSIGALGAFVTVFLGVISVQSTSGAIADGVAVRTAKYVTSTFVPVVGRMFSDASETVIGASMLVKNAVGLVGVVIILLLCAFPALKI.ITLALIYNVSGAMLQP..L.G.NSPMI...KCLQTIGKSLIAVFAA..LAV..VG..L..MFFLAITMMITAG............
A0A1J0GI17_9CLOT/64-386              .....................................................mq--PQTFVEQFIKTGDNGLSFNK.TSTFIIRYTFKEVIACMELIGSLMIIAIICAMLNNLQSAFN.R.ESL.S...NIAYLACYGVMILMITKSFYVVAELAKNTIVSMSNFMSALIPVLMMLLASVG........GFAEATLLDPVIMGFATVSSRIYVD........IIIPIIFMSF...VMQFVSSIS.S..DYKIKNLTKLLKQTAIWIQGIVMTVFIAVITIRSIAAKTLDQVTIKTAKFAVDTFVPVVGKCLSDAISTVAGYSLLLKSAISGLGLIVLMVIVILPIIKL.LIMAFLYKAAAALIEP..I.S.DNRTV...ECINSVGDSILLLMSC..VIS..VS..V..MFFIMVAIVAATG............
R6U837_9FIRM/62-374                  ...............................................tledpssa---------------ANINASD.VINHIFESFTAALRSPLIMLGKITAATMLCVLVRSMS---A.E.GTV.D...KVFTLICVLTTVLVISDTVTDSLYSVKTSMEQMNRFMMSYIPIFSSVATAGG........SAAAGAGYYGVMLIICESAGILADT........ILVPFLSAVL...AVTLVSAIN.P..SLDLGSLAESVKKLVIWVLGIVMTLFTGLLSIQSFAGAAADNLSARAVKFAASSFIPVIGGSVSEAYSAVKGSIGVIRTSVGVIGVIIMSVIVAKPLLTL.LAVKLAVWIGATINDI..F.G.ISNSG...GLLKSINSVLSIGVSI..LAA..YS..I..MFVISTSVVIMT-a...........
R6Z824_9CLOT/1-179                   ......................................................m----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........VVLPITLIAT...ALGIISNLS.D..KVQIGKLSNFFKSGITWFLGLIITIFVGILSMEGTLTSNVDGLTAKGVKAAASTFIPVVGKALGDSADVVLGSTSIIKNSIGIVGMFVIIGICAMPIIKL.TLLTTAYYFTSAICEP..I.A.DKKIV...SLLEQMGGTFKVLLGI..MFF..VA..T..LLIIGLAMCIKI-t...........
A0A0M0GPR9_9BACI/69-389              ..................................................sqkgs-----LID-FIK-GEKEFSFKA.WFTGLLHFAFQELMMNGKLLGTLILLTIFSMFLQSLQNAFE.G.GNV.S...KVAYGIVFMVLIIIALNSFHVAIDYTYEAITTMVNFIIALIPLLLALIAASG........GLISAAFFHPVIIFLMNTSGLLIKN........VVLPLLFLST...LLSIVSTLS.T..HYKVTQLAQLLRTWSIGLLGAFMTIFLGVISVQGTTAAVSDGVSIRTAKFVTGNFVPVIGRMFTDATDTVISASVLLKNTVGIAGVAIILLIAAFPAIKI.LMIAFIYKLAAALLQP..L.G.GGPVI...ECLDTISKSIIYVFAA..LAI..VS..F..MFFLSITIIVAAG............
A0A167T3T3_9BACI/60-380              ..................................................sqkgs-----LMEF-LQ-GEKEWSFKA.WLTALVKFLVYELQANGKLLGMLILLTVFSMFLQSLQNAFE.Q.QAV.S...KVAYAVVYMVLMILALNSFRLAMEYAQEAIQTMTHFMIALIPLLLALLASSG........GLVSAAFFHPMVLFLMNVTGAIVEY........IALPLLFLAA...LLNIVSTMS.E..HYKVTQLADLFTKVAMGALGAILTIFLGVMSVKGATAAIADGVALRTAKFVAGNFIPVIGKMFTDATDTVVTASMLLKNAVGVAGVALVLLIAVFPALKI.FIISFVYKLSAAVLQP..L.G.GGPVI...ACLNIISKSVLYILAA..LAI..VS..L..MFFLSLTVIITAG............
A0A0K9GVN7_9BACI/70-390              ..................................................sqkgs------FMDFVS-GDKKFSFAE.WMKGIGKFLFHELLVNGKLLGSLILLTVFSMFLQTLQNAFE.Q.STV.S...KVAYSIVYLVLIILALNSFHVAIQYTQETIDTMIAFLMALLPLLLALIASSG........GLLSAGFFHPILLFLMNSSGVLIQY........VVLPLLFLSA...ILSVVSTMT.E..QYKVTQLAQLLRNWAIGLLGAFMTIFLGVISVQGVTTAVADGVSIRTAKFVTGNFIPVIGRMFTDAADTVINASVLLKNTVGMAGVIILLFIITFPALKI.LMLSFIYKLAAALLQP..L.G.GGPVI...KCLDIISKSMIYIFAA..LAI..VS..I..MFFLSVTVIIAAG............
Q81M42_BACAN/63-383                  ..................................................sqkgs-----FM-EFVK-GEKEISIKE.WMLGLLKYLFHELVANGKLLGTLIMLTIFSALLQSLQSAFS.K.SSV.S...KIADAVVYMVLIIFALNSFYVVMTYARETIQTMVDFILALLPILLALIATGG........GVVSVAFFHPIIIFLMNTSGLLMNY........IVLPLLLLAT...ILSIVSTMS.D..QYKVTKLSKLLQNVSVGIIGIFLTIFLGVLSVQGTATAVADGIAVKTAKFVTGNFIPVVGRMFTEAADTVISASGLLKNTVGIIGLVILCLIVAFPAIQI.FCIAFIYKFAAAVLQP..V.G.GGAII...QCLDIIGRSIIYVFAC..LAI..VS..F..MFFLSITIIIAAG............
N0B3R8_9BACI/64-384                  .................................................sqkgsl-------YDFIK-GSKDFSLKE.WSSGIVKFTFHEFIINGKLLGSLIMLTIFSMFLQSLQNAFE.K.GAV.S...KVAYAIVFMVLMIIALNSFHVAINYTNEAIGTMIDFILALIPLLLALIASSG........GLVSAAFFHPVILFLMNTSGIFIQN........IILPLLFLST...LLSIVSILT.E..HYKVTQLAHLLRNWSIGLLGLFLTIFLGVISVQGASTAVADGITIRTAKFVTGNFIPVIGRMFTDATDTVIGASVLLKNTVGIAGVAILLLIVAFPAIKI.LMIAFIYKFAAAILQP..L.G.GGPII...SCLDIISKSVIYVFAA..LAI..VS..L..MFFLSITVIIAAG............
A0A1Q6TB89_9FIRM/52-363              ..................................................pqsil----------------SLKPSK.IWEIIKDIIESKISQPLKLFVSLLLVIILTALIEGTGNTIR.N.KEI.S...KIYELICVLVCVAALSVPVCTCLEIASESLSQGADFMLGFVPVFAGVAAAGG........HITSASGYNMLVLGFSDIAIQIAGN........FFMPVLSMCI...CLAIVDAAC.D..TIDLSGMLNGIKKIVTWGLGLIMAIFTGLLSIQSIVGSSADTMTTKAAKYVISNSVPVVGGAASDAYTTVRGSLVLLKNGIGGVGIIALAVMLLPSLILI.FLNKLSFSALGAAAEI..F.G.AKKIV...QLFKNINSVLSAALGI..MVC..FT..L..MFIISTAIIMMV-c...........
A0A177KYN2_9BACI/33-346              ...............................................dnlditsf-----------------FSLEN.WMDMFQSYILFEITENVKLLSIIFLLSILASVLKTMGHAFG.H.QTV.S...KTAEAAILIPIFILAMNTFRLAIESASNAVENMTVFMTVFMPVLLALLALSG........AVVSAALFPPLLLFMMNISGVLIDQ........IVLPCLVFSV...LFSLVGLLS.D..HYKADRIASLLRIISVSLLSAFMAAFLTVMTMRGMSAATADGLTVKTAKFLSGTFVPVVGRMMADAADTASGAALMINNTAGAAGIAILLLTAIFPVLKI.MVLAFLYKVAAAVLQP..L.G.DSAAA...SCLDIIGKTMSFVLAA..LAL..VS..F..MYFLMMAAVVAAG............
A0A1Q9K5Q7_9FIRM/43-363              .......................................................FSIEEVIEG-FQNGEIKETLGA.VIKQQWKKAFQEEEELRQLFIQMIFIGFMTAVFSNFSKAFV.E.QYV.G...TTGFYIAYMMMCGLMIRQFLIMFELAKGAMENILTFMKVLIPTYSLALVAVS........GLTTSMATYELFFFLIAAVQWGMIT........IVLPCVKVGM...VLKLLNFLS.S..EDLFSGFVELLESLIKLLLKGAIMIVLLFNIFQSMLLPAIDSVKSNVIQKGLGF-LPGVGQVLGMVANTAIGSGIILKNAIGAAGMVVICVIAFLPVLKI.MIYIGSFLLAGALLQP..V.T.DQRLY...RALKGVAESGKLLLQA..VLT..SV..V..LFLLTIAIVSVT-t...........
A0A1Y3YBD5_9FIRM/62-381              .......................................................FSVRQALEKILA-GEEVFTPDF.VLETVRGFLYEHLLADREVLFQVVLLVILAALFANFTNVFS.G.SQA.G...EASFYIVYMLLLALLIHSFGELSAELSGSLEDLTAFMQALMPSYFLAVTAAS........GTATAMVFYEMVFGVIYLTQVLLLK........AVIPGIQAYV...IIELINYLH.K..EDFLSKLADLLKTILEWTMRTITAVVIGMELIQNMVSPALDSLKRDALGKTAAS-IPGIGNVINGATEVALGTAVLIRNCLGVMGIVVLVLLGLPPVIKL.AMNSLVYKLLAALLQP..V.S.DRRMT...GCLSAMGEGCRLLLKV..LLT..LE..L..LLLITIAILSV--s...........
R6BEX2_9CLOT/1-188                   .......................................................----------------------.-----------------------MVIIIISSVLRSITDGLE.N.KSV.S...QITYYITYILIVTIVMKNFSDIINMVKTSIDNLVAFTNCLIPLLITLMITTG........NIASAGMLQPIILWIISFIGNFINV........VLVPASLISV...ALSVISNVS.D..RVPIDKLSKYINTTVVWILGIVLTIFVGVSSLEGSITNGVDALTVKTTKAAVSNFIPIVGKILR------------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------rcsg........
R7NNL2_9FIRM/57-371                  ................................................ekdynsi---------------INMSFSN.VFHKIFDIVNDEGVTPFSSSALILSLLLIYSVFDNFRDGLK.N.KEL.K...CITDTVFVLVVTLSISSPVISVINRAIESINNAGSFMLLYIPIMAVILITNG........QSITGASYYSLVVMVGEGVTYIAKN........IVSPLLSVFL...GLSVTSAIS.S..DLNMQGIINGISKIIKWIIGFAMTVFSGLLTFKTLITTSADSISTRAVRFTLSSFIPIVGSALSEAYKTIQGSMCLLKTGLGVFVIISVMIVFLPIIIHC.LLWIISLNITCGIGNM..L.G.IKGPI...SIIKSCSTVLTTLLVI..ILC..VM..A..IYVISTAIILTMG............
A0A0K9YR58_9BACL/67-387              ...................................................ikse----GFVQLLMHQGE--FSLSS.VLQGMGKFVFHEILMNGKLLSSIIIITVFAMILETMQNAFE.R.NAV.S...TVAYSIAYLVLMVLAINSFHVAITYAKDAIANMSDFMLAMIPLVIALLASVG........NLATATMFHPLIIFMINISGMMISY........VVFPLLFLSA...MLSIVSLFS.E..RYKVTQLATLLRNIAMGVLGSFLTIFLAVISIQGATSAVTDGVTLRTAKYITGNFIPIVGRMFSDAADTVLNASLLVKNAVGLAGVLILITLCAFPALKI.LVLALIYNISSAVLQP..L.G.NSPII...SALGTIGKSLLFVFAA..LAT..VG..L..MFFLAITIIIAAG............
R7MML7_9FIRM/50-367                  .............................................diiytlddie----------------DMPFER.ISDSIKEVIVTRISAPFNLLKLMLLLTLFAAFVQSFGESVL.S.KNG.G..eSIFRMVCVVSAVTVLSTPLLTAFENAADSMERGGNFMLLFVPVFAGISFFSG........DITTISCYNAVVIGAAELLVQIAQH........FFMPLISITA...ALAIANSIS.S..KSSIESVIRLIQKIITWSMTVLITLFIGFLTVKGTLSAAADGFASKTAKFMISGFVPIVGSAVSDAYSTVKGSMTLMKCTTGTAGIVALAFILLPPVIEL.FCYKAVMWVCNAAADM..L.S.VKSLS...RLFRTLDKGLSIAISI..MIS..FS..L..LFVISTAVLMKT-a...........
A0A1G5JYW5_9BACL/69-389              ...................................................ktps-----FMDM-LIPGNEGFSLKS.VFSAIGTFMLHEILYNGKLLVTIVMLTVLSMILETLQTAFE.K.NNI.S...KIAYAICYLVIIIIAINSFSVAIGYAKEAISSMINFMMAMVPLLFTLLASMG........NVVTVSVTHPLIIFMIHLVSTLIHL........LVFPLLFFSA...VLHLVSSLS.D..KYKLTQMADLLRNISVALLGILLTMFLGVISVQGASGSVADGVSLKAAKYIAGNFVPVVGRTFADATDTVITASLLVKNAIGLTGVIIILFLCAFPAIKI.LALALIYNVTGAIMQP..L.G.ETPIV...DCLQAIGKSMIYVFAA..LAA..VG..L..MFFLAITILLTAG............
A0A1I0RV79_9FIRM/30-350              .......................................................IDFKGLVTDIIS-GGKTSLKQN.FIQQLQSTLTKELVSNKKAIIQVIALAIISAFFTNFSNAFN.N.QQI.S...QTGFFVTCIALVTILIAIFSVAASTATTAIQSVLAFMKALIPIYATSIALTS........GSMSSMAYYEFILLIITVVNWVFLN........VVIKGSYIFV...MISAADCIA.K..EESLSKLSALIKLIIGWIMKTCLAAVIGINAIQSLVLPVADSIQSSVLSKALGM-IPGIGSGIGAISTTVIGAGTLVKNGIGVAALIVVVVICSIPIIKL.VIFVITYKFISAIVQP..V.A.DKRIV...ECINATAEGMNILLTT..VIY..SA..I..MFLITIAIICAST............
A0A1R1EV11_9BACL/69-389              ...................................................ktps-----FMDMLLP-GGSGFSLKS.VLTAAGTFMWHEVLYNGKLLVTIVILSIMSMILETLQAAFE.R.KTV.S...KVAYALCYMVIIVLAINSFNVAIGYAKEAIDRMIDFMMAMVPLLFALLASMG........NIVTVSVTHPLIIFMINTIGTLIHV........MVFPLLFFSA...VLHLVSSLS.D..KYKLTQMANLLRNISVGLLGVLLTIFLGVISVQGITGSITDGVTIRAAKYVSGSFIPVVGKMFADATDTVISASLLVKNSIGLAGVIIILFLCAFPAIKI.LTLALIYKVSAAIMQP..L.G.DSPIT...ACLDTIGKSMIYVFAA..LAA..VG..L..MFFLAITIMLTAG............
A0A1G9Q996_9FIRM/69-390              ......................................................v-NLKTFVKDLIS-GDKTLLDLF.NKEGIKVILFEELKSSLKIAAIILVLALLSSVLKSLDNSFS.S.GAV.S...QITTYIIFITMVTLVLVGFKDVLDICNSTIDSTVGLMQVIMPVLITLLVLIG........FPITSTVLNPLFIGGVTFINVIFKK........FLFVSIAVAF...AILVINNLS.K..NVRLKKLSSFIKQINLVSLGAMFTIYLGLVSMQGLYVKNIDNFTVKTAKFAIGNFIPVVGGFVSDSVDILLSSSQLIKGVFGGIGLVLLVAICLVPVIKI.LSIIFVYKISAIVVEP..I.G.EEGIS...SFLNEVANLMVIMLAC..IIA..IT..I..MFFVTVAIITSI-s...........
W4BIR4_9BACL/75-395                  ....................................................ktp----SLMDMLLP-GGDGLSFKG.VMSGIGKYLWHEVLYNGKLLATIVMLSIMSLILENLQTAFE.K.STV.S...RVAYTICYMVVLVIAVNSFSIAIGYARDAITQMIDFMMAMLPLLFALMASMG........NVVTVSVAHPLVIFMVHTVGTLIST........IVFPLLFFSA...LLHLVSSLS.E..KYKLTQLADLLRGISMGVLGVLLTVFLGVISVQGLTSSVTDGVTIRAAKYVTGNFVPVVGKMFADATDTVISASLLVKNSIGLAGVIIILFLCAFPAIKI.LTLALIYNLAAAVMQP..L.G.DTPIG...TCLQTIGKTMLYVFAA..LAA..VS..M..MFFLAITILLTAG............
A0A1I2L4T7_9BACL/69-389              ....................................................ekg----DLFDAVLS-PEGGFSPEE.TLKALARYFFHEILYSGKLLGTVIVLAVLSMILQLLSTAFQ.H.DQV.S...RVAFAVAFMVIIILAMDSFSVAVESAKTAIERMIHFMLALIPLVLTLLASMG........NFGSVAMLHPLIVFMIHVVGTLIYT........VIFPLLFFSA...VLGIVSCLS.E..KYKLNQLADLFRRVSMALLGGLLTIFLGIISIQGATAAVTDGVTIRTAKYLTGNFVPVVGRMFSDAADTVVGASLLVKNAVGMAGVLILLFISAFPALKI.ISLAVIYNFSAAVMQP..L.G.SGPII...DCLNIIGKTLMYIFAA..LAT..VG..L..MFFLAVTIIIAAG............
A0A1W2AE92_9FIRM/59-379              .....................................................lt---TETIKDIAT-KGLAFNWQT.IANKLISYLFKEIAINIHLMGKLLFLAVLCALLQNLQNSFE.Q.STI.S...LLAYSVCFIFLSVIALSAFYQGLTLARETVGNMVGFMEALLPLLLSLLAGVG........ALTSVALFTPLMLLVVSVTSVLVKD........IILPLLFLTA...ILECVNYLS.G..NYKLSNLTGVLKQAGMMTLGLVLVIFIGIVSIQGVAGSVADGLTLRTAKYATATFIPVVGKMFADTVELVMGASLLLKNAVGIFGVLAIALLCALPLVKL.ISLVVVIKIAGALIQP..M.G.DEKMA...KCLDAMGNNLLLVFGA..LLT..VA..L..MFFLVVTMIIGAG............
A0A1H8C3H5_9BACI/79-399              .................................................sqkgsl-------YEFIS-GEKEFSLKG.WFNGILKFMFHEFLANGKLLGSLVLLTIFSIFLQTLQNSFE.K.STI.S...KVAYSIVFMVLIIIALNSFHIVLDYTNETVGKMIHFILALIPLLLALIVSSG........GLVSAAFFHPVILFLMSTSGMFVQY........IILPLLMMSA...LLSIVSILS.E..NYKVTQLAGLLRNWSIGLLGAFLTVFLGVISVQGAATAITDGVTLRTAKFMTSNFIPVIGRFFTDATDTVISASLLLKNTVGIAGVAIVLLIAAFPAVKI.LLIAFTYKFAAAILQP..L.G.GGPVI...SCLEVISKSIIYVFAA..LAI..VS..L..MFFLSITVIVVAG............
L1QG99_9CLOT/67-389                  ...................................................ldpv----SYIESYIENGEGNISVSK.VLSAVISLFFREIKSVLALSFSIIVIGIICSLFKNIQSAFS.S.EGI.S...QVAFYACYALLIIILSKTFIISLDLAKDVIVEITNFMSKLLPVLVVMLAAAG........GLTQAATIDPIVLGATIIVPKIYTD........IIIPLILMTF...VVKFTNNIS.S..EPKLSNLSAMMEKSVTWIQGLVLTIFIGLLTIRGITSSTIDAVTLKTSKLAIESFVPIVGKSLSDSIASVAGYSLIIKNAIGSIGLIAVILIIIYPIIKI.VLSSMIFKLSASLLEP..I.T.DKRIT...SSIAAAGKSLVLIMSC..VIS..VS..L..MFFILIAMMISAG............
C5EH39_9FIRM/101-421                 .......................................................FSFWDLMKELVK-GNLGGVLGQ.VGAGIRNTLFSEVGKGGHMLFQVAAIGIIGAVFSNVSSVFK.G.GQI.S...DAGFFVTYLLLFTCLAASFTASLQVAAQVLDQILEFMRLLMPAYFMSVAFSG........GSMSALALYEGMLGAVTLIQWLCST........VLLSMVRIYV...LMVLGSHVV.K..EALLSKLTELLEQAVGWSLKTLTGLVVGFHLIQAMILPYADAAGQAGMKRLIEI-IPGLGQGAGAMAQMVLGSGVLIKNTIGAAAVVVLAVITVIPIIKL.MVLMVLYQCVAAVMQP..V.C.DKRIV...SCVSGVSKGHKMLIQI..VLY..SM..F..LFMISIAITCAST............
A0A1M5Y8H9_9FIRM/73-383              ...............................................mkvtdsld---------------LSGGLQK.ILKSVSENVGGIFSGALKSAVVILLIAVLCGVVSSAFD---.-.-AA.S...KYVILAGILAISVVSVSNVSAFIGLGGKTLDEMNTFSKMLLPTLTTAAAASG........AITSAAAKYAATALFMDILMTVAKN........VVMPLIYAYT...ATSIAEAAL.G..GEGLAGASNLLKWLAKTLMTVAMLLFIAYLSLTGVITGSVDAASTKALKSTISTVLPVVGSIIADASETVLAGASILRNAIGVFGLLAVVGTCILPFLRL.GANYLLYKAAAGLSAA..I.A.DSRIT...KLVNAVSTAFGMMLGL..VGS..SA..L..MLFISIISVI---kvv.........
A0A1M6KHQ6_9CLOT/61-383              ......................................................l-NIKDYLDFYLKNGQGNLSVKK.IIATVSSIMIRELISFVKLSILIIILALIAALLKNVQNAFS.N.DSL.S...NIAYFACYALLIIILSKSFIISVEIAKSTIEKISNFMMALIPVLITLLATVG........GIAQAAAMDPVIIIAVNLCPKIYMD........IIIPLILMGF...MLQFANNIS.E..GFKLDGLSKLIKQSVIWIQGIMITIFIAVVTIRGVTSSTIDAVTLKTAKFAVDNFIPIVGKAMSDAISSVAGYSLILKSATGTLGLIVIIFIVLVPILKL.FLCALVYKLTAAFIEP..I.S.DSRIV...RCIASAGDSLILIMSC..VIS..VS..V..MFFIMISIMSSA-g...........
M7NHF4_9BACL/4-294                   ...........................................liaavagppakl----------------------.-----------------------FALIIVLSA-AALAADFA.V.PQF.R...EWTRLFLLVSAGAAAMGPAIDAVRMMDGLVGKMTGLFLGIYPVLAAGMAAAG........GALSLINWNPAVFLFVQGAVVIGGK........WMVPLLIVSF...ILDYLSRLV.P..EIPFTRISEMIRVTLLGAISVIIACYSLFITATGAMAWSSGSALAEPIKALLRQHVPLIGSFITDTMGVVGKYSSGMAPIAGSYLIVALLVTSLSPVAYV.LLTAFLYKWIAALCEP..F.A.HEDLA...GFFDDIGKTLFVLCGI..MLI..VA..F..AIFYTAVLS----iilikv......
A0A099SB96_9CLOT/56-378              .......................................................MDIKEYIQTYMKSGEGTFSVSK.VFKGIASYAVRETSAAIKLMSVLVIISIICALITNLERAFS.N.ETL.S...HIAYFACYSLIIIIMAKSFYVGVELARETIQRMSDFMLALIPVLIMLLTGVG........GITEATLMDPIIIGTINISAELFAN........IIIPLITITF...VLQFVNNMS.D..EFKVDKLTKLLNQCALWMQGILMTIFIGIITIRGISSKTIDQVVAKTAKYAVDNFIPIVGKCLSDAISTVAGYSILLKNSISSVGLIILIGMVLLPILKI.IITALVYKLTAALIEP..I.G.DKRLV...SCISSAGDSLILISAC..LIC..VS..V..MFFIMIAILASAG............
A0A174TK33_9CLOT/75-397              ....................................................ldp---VEYVKSYITNGKGNLSFSQ.LGKAVVSLLFKEVGSVLKLAISMIVIAILCTLLKNLQDAFS.T.KSI.S...QIAFYACYAVMVMLLSKSFLISISVAKDVINGVADFMAAILPVLVTMIALAG........GVTQAATIDPIVMAAVVIIPRIYVT........VIIPLIMVGF...VLQFANNLS.E..EHKIDNLCKLLKQWTVWIQGIIITSFIALLTIRGITSTTIDAVALKTTKFAVDNFIPIVGKAFSDAITSVAGYSLIIKNAISGIGLMVIILIILYPIIKM.VLMTFIYKMSAALVEP..I.S.DKRIT...STIAATGDSLVLLLSC..VLS..VS..L..MFFVLLAIMASAG............
D9SLF5_CLOC7/84-408                  .......................................................MDIKQYVEEIMKNGQGNLDTKE.IIRVIFIYMARESTFVIKMMLTLFVISILGSLISNMQSTFE.K.EIV.N...TAVDFAFKGIAFVVLLNCMQVSISITKEAIGAMTGFMYSIVPLMLMLVASVG........GITQASVMNPIMIGIINLSSIVVKE........FFVPIILMVF...LLKFIERLT.K..GHSLSRLAKLLDKTVDITQKYILTLGIFLITIKGIVGGAFDDFTIQSAKLAVDTFVPIVGKSLSDAVTTVASYSLQLKAAIGSVGLFIVIAIVLMPLIKV.LLIALGLKITAALVEPfsI.N.DYELC...NIIEDTGNSITKLVAC..LVI..VT..F..MFFILITILLASG............
R6P0W5_9CLOT/72-383                  ..................................................wqsiq----------------NLSPGA.VFSEIGSQAQTQAKGPLAAMFQVLFVILLCALMEGLKVSFG.D.RPL.S...GVVNTVGTLCVCAAIIMPIVSCIAETAEVIYGSSMFLMCYVPVLAGIMIAGG........QTVSAASYHMMMIGAGEVVSQLSTY........FLVPMLNIFL...ALSIVSSIS.P..RLKFNGICEMFYKAVKWVLSIVMTIFVSLLTIQNLIGVAADNAGTKAVKFAVSNFIPVVGGALSDAYTTVQSCVKVLKSGVGAFGILAAGVIFLPVLLEL.ILWLAAVNLSAVVGDL..F.E.LKEIS...VLLRSVGKVISAMIAI..VVC..CM..V..ILIISTVLLLL--ig..........
R6I8J6_9FIRM/64-374                  ..............................................snwqsmlsp------------------SPKK.IISMFADIARGSFKKPIKDMVIIAGVVVLVGLIKGTAA---.A.ENF.S...EPLNIVIGCAVAITVFASSAGVISQGMSAVETTSDFMLALIPVLAGIITAAG........NPTLALTYGSFAMAAAQAAAQTAGN........IIMPLCGAFS...AFGVSASLS.P..ELKLIKLADMIKKLTIGVLSFIAAAFSAVLGLKSLLAGSADTLASKGIKLALSSAVPIVGGALSDAYSSIIGSVSLLKSTVGVFGVIAVVMIDLPVVLQL.TARIILLKLLGVLSSS..M.G.DDTTG...EVLDTLSSALTVINAA..VIF..TA..A..LFIISTGIVIS--vk..........
K6U8J8_9CLOT/99-421                  ....................................................ldp---VEYMKTYIKEGKGNLSLDN.ILNAVISLAFKEVKSVLKLVVSIVTIAIICSLLKNLQDAFS.N.ESI.S...QVAFYACYALIIMVLSKSFIISISVARDVINNISDFMSALLPVLVTMITISG........GIAQATTLDPIVLGAVVFIPKLYSN........FIIPMILMSF...VLEFANNIS.S..EHKITNLCKLFKQIIIWIQGIVVTIFIGLLTIRGITSSTIDAVTLKTAKFAVDNFIPIVGKAFSDAITSVAGYSLIIKNAISSIGLVVIILILLHPLIKL.VLMTFIYKLSAALIEP..I.S.DSRIT...KSLEAAGSSMVLIMSC..VLT..VT..L..MFFILIGIIASSG............
A0A1E3BWE0_9CLOT/81-402              ......................................................y-DPEKIIRDVAK-GQFEFDVPN.TANRILGYLFEEIYLNMDILIKLIVLVALCAVLNNLQTSFL.N.KGV.G...ELAFYVCYIVLVSILLVSFSSVVKAGTEIIDRMVNFMYSSIPVLITLIISSG........NISSGGVLQPVLIMIVQVSATIIKN........LLIPLIILST...VISIVDNIS.D..KVQISRLAGFLKHVTQWTLGLILTLFVAIVSIQGSLGAVVDGVTSKTAKFAISAFIPVAGKYLADAADAVIGCTLLIKNAVGVAIMIGIIVICLLPLVKM.LAIILLYRMTCVLLEP..L.A.EGRII...KCISDVTNSMTYILGI..AAS..VA..F..MFLITVTALILA-s...........
B1CBV3_9FIRM/67-388                  ......................................................g-NIKNFISDVVS-GNYSFDYND.FINALKDLFFMTLRESISILLTFIALSIFLSLINLLNTSFM.N.KEI.S...DVAFFGIYLVLVALIVKTFFNIVTIAYSLIKAITGFMNVLLPIIIILMNLSG........NVFSGNIISISLVFIINFFASAMTY........FVIPTLSFGF...ILSIMDNLL.T..DINISYLVSFIKQGVLFIMGLFSVLFVGILSIQGSLFSSLDSLSVKTAKFAVSKLVPVLGSLISDSADTVIGFVKVIKNSVGLIGVLILISLLLIPFMHM.LCSIVTLKISAFLSEP..L.T.DPRVS...KALNDASTFLSLIFAC..FLV..VA..V..LFIMLIGIIAML-g...........
A0A0U2MXF0_9BACL/101-419             ..................................................apsfm--------DLLL-GAKEISPGS.IFSGLLRYFFHELIYGGKLLASIVILSVFSMLLETLQSSFE.K.NNV.S...KIAYAISFLVLMIMAVNSFNLAIGYAKSAISEMTHFMIAVVPLLLTLLASMG........NVVSVSVLHPLIVFMVYAIGTVIYF........FVFPLLFFSA...VLHIVSALS.D..KYKVTQLANLLRNISLGCLGIFVTVFLGVVSVQGGAGAIVDGVTIRTAKYIAGNFVPVVGRLFSDASETVIGASLLVKNAVGLSGVVIILVLCAFPALKI.IALAFIYNLSAAVMQP..L.G.DHPMT...ACLATIGKSLIYVFAA..LAA..VG..L..MFFLAITILIAAG............
C7H7Q9_9FIRM/11-204                  ....................................................avf----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-----------FLTLLCLLAQALTA........FVPPILECFL...ALSMACCIT.E..QSCLGNLCKAAGTLLQKGLSLTGKLLAALLGFQRISAAQLDRTALRTGQFLTGT-IPIVGQSLSDASEAVLAGIQLLKSGLGMAAILILLAEFLPLYLGM.LAHLGCIILCGTLCSL..T.G.NNRGQ...ALLTCFASAVRCMMAC..IAL..FF..G..LAVTGTALL----fmlg........
A8FF23_BACP2/70-390                  .....................................................sq---KGTVKEMID-GDKELSPQT.WLKAFVHYLFHEVIANGKLLGTLILLTIFCSLLQLLQNAFE.Q.SNV.S...KVAYALVYMVLIIIALNSFHVAISYATEAIQTMTSFILALIPLLLALIASSG........GLVSAGFFHPVILFLMNTSGVFIQY........VVLPLIFLSA...ILSIVSTLT.E..QYKVTQLAQLLRNVAIGGLAVFLTVFLGVISVQGASAAVTDGIALRTAKFITGNFIPVLGRMFTDATDTVISASVLLKNTVGLVGVAILITIAAFPAIKV.LSLALIYKLAAAILQP..L.G.GGPII...SCLDVISKSVLYIFAA..LAV..VS..L..MFFLSITVIITAG............
A4J3E2_DESRM/61-382                  .......................................................INFKEMVIQLMK-GDLDWQVSD.IFTGLFKFFFKEVVANASLLGKLVVLAVICAVLQNLMSAFE.K.GTT.G...KLAYAVSYMALITLAVGSFALAVNIGREAIDQMVHFMQALMPLLLTLLAAMG........GVASTAIFHPIIFGSIATIGTVIKV........IVFPLIFFSA...VLNILSNLS.E..KFQVSRLADLFKTVAMTVLGLCSTIFLGIFSIKGVAGSVTDGVAIRTAKFATDAFIPVVGGMFSDALDAVIGSSLLIKNAVGIAGVVIIFVLTILPILKI.FAVAFVYKLAGALIQP..V.G.DKQMA...DCLTGLGKSLLGIFAA..VAT..VG..L..LFFFAITIVVGMG............
R7IEH9_9FIRM/1-293                   ......................................................m----------------------.----LSRQFFSAVRQSLWRLTRLIAPALLWALLKQFSG---.-.-RS.S...ECGRIVVQLFVCVFLTQDLSDHITLAVATVQQISAGMQGLLPMLLTMMAAVG........GSAGSALMQPAVVASASAMTSLISG........ITVPLAVASG...VLCMLCHLG.D..GIRVQRLAEFTQQCAVWSLGIGFTVFIGVLTTRSVTAAAIDGVTLRTAKYALNNLVPFVGGLFADTVDTLVGSGMLVQSALGVTGLIVIASRAVLPLCQT.LAAAMLYKLASALMQP..V.S.DGSLA...GCIHDFAKVLMLLFVL..QLS..AA..A..MYLMLIAQLIAV-s...........
A9KMC7_LACP7/56-376                  .......................................................MNFGEYVKNLLS-GKESFSFKG.VFQKMLQTIGLEFKSNLSSLMKLLTIAVISAVFTNFSHTFQ.N.SQI.A...ETGFYVTYLLMFVILASTFIGATKLATDTLHNVLNFMKALVPTYCMSVAFCT........GATTSAAYYQGILILVTVVDYLLLK........IVFPLTSIYM...MAVLANNLS.Q..EDMLSKLSELLATLIRWMLKTLLAVVIGIGTIQSLITPAVDQVKRSSIIKATQM-IPGIGGLFSGVAETVLGAGSLLKNCIGVAGLVAIIVICAIPIVKL.IIYVLIYKLVAAAIQP..I.S.DKRIV...NCVSASAEASSLLLQT..VFV..AA..I..LFEIVITIVAVST............
A0A0F6BKM5_GEOS0/61-381              ..................................................sqkgs------LTEFVS-GEKQLSLKE.WLIALMKFLFYELQANGKLLGTLILLTVFSMVLQSLQNAFA.Q.QAV.S...KVAYAVVYMVLMIIALNSFRVAMDYALDAVQVMSHFMIAMIPLLLALLASSG........GVISAAFFHPIILFLMNTTGAIVEY........VTLPLLFLAA...LLNIVSTLT.D..HYKVTQLAELLTKISMGILGAILTVFLGVMSVKGATSAIADGIALRTAKFVTGNFVPVVGKMFTDAADTVVTASMLLKNTVGIVGVTILLIIAAFPALKI.FAIALVYKVSAAVMQP..L.G.EGPVI...SCLSIMSKSIAYVFAS..LAI..VS..L..MFFLSLVVIITAG............
A0A0Q3X0N7_9BACI/64-384              ..................................................sqkgs-----LVDF-IK-GDKSFSLNQ.WFHGILKFMFQEIVMNGKLLGSLIILTIFSLFLQSLHNAFE.Q.GTI.S...KVAYSIVFMVLIIIALNSFHVAINYTKDAVSMMINFILALIPLLLALISTSG........GIASAAFFHPVIIFLMNTSGILVQY........VVLPLLLLST...LLSIVSTLS.E..QYKATQLAQLLRNCSIGLLGIFMTIFLGVISVQGTATAVTDGISIRTAKFVTGNFIPVIGRMFTDAADTVISASVLLKNTLGLAGVAIVLIIAAFPAIKI.LTLAFMFKFTAAILQP..V.G.NGPVI...ACLDTISKNMIYVFAA..LAI..VA..I..MFFLSLTIIITAG............
R6LS66_9CLOT/37-357                  .......................................................FDFEGYIGKIINSGH-GLFTDD.FFKGITDGIVSNFNNEKAMYINIIFIAVSGALITNFSKLLQ.G.KKV.A...QMGFYTIYILFFAILSNAFIQTSSIAIDTLSKIFDFMKVLSPAYFICISFTK........GAGLGTGYYQLALVMITVADGILLN........FVIPGIKVYF...WLQIANHLS.E..EDLFSKMADFVKDIISFVMKTMSIILMGINVVQGMVAPLAAEAKNSFLVKIGSS-IPGIGNAISNVTSSVLLAGRLVKNAVGVTGIVVLVILCAAPLLKL.WVSEFAYKGLAAVLQP..V.S.DKRIV...NCLSITADAIKLLAYA..VGL..AG..M..FFAVSIAIISAMT............
F0T0S0_SYNGF/59-378                  ......................................................l-SLSNIFEG-LKSGSIELSVQD.ILQQIFSAAIKEFLKNIPLVSKLLVLAILCAVINQLQTTFT.-.GEV.S...KLSKLLTYFVLAGMALVSFQSAISIGISAIDRMVSFMQAVLPVMYTILLAMG........NITSGALFKPLVMGSLVFLATIVKS........IVLPLFLVSA...VLRVFNHIS.G..QFKLSKLAGLLEFGGKTAIGFIMTVFLGVMTIQGATGGVADSVTLRTAKYSADL-VPVVGKYFKDAVELVASSGLILKSAVGIIALLAIILYTLSPIIQI.IAMIITFKLSAALVEP..L.G.EQELA...ESLQDIAKGLLQICIT..VAA..VS..V..MFFITLSIIIGVG............
W4QIB6_9BACI/65-385                  ..................................................sqkgs------FMDFIK-GDKQFSFKD.WGIGFVKYLLHELVVNGKLLGSLILLTVFCMILQSLQNAFE.K.QAV.S...KVAYAITYMVLMIIALNSFRVAITYATDAVNSMIHFMIALLPLMLAMMAAIG........NITTAALFHPLIIFLVNMSGLFIQK........IVLPLLFLSA...VLSIVSTLT.D..HYKVSKLATFLRNIAVGSLGIFLTIFLGVISVQGAATAVSDGVTVRTAKFLAGNLVPVVGRMFTDAADTVMSASLLLKNTIGLAGLGILLMLCAFPAMKV.LSLAIIFNLSAAVLQP..L.G.GGPII...ECLSIIGKAVMFVFAA..LAV..VC..L..MFFLAITIMIAAG............
A0A061NR47_9BACL/84-404              ..................................................sqkap------FTEFLQ-GEHTFNPMD.WLKALLSYLFHELTANIALLGTLILLAVFSMVLRALQNAFE.H.DAV.S...KVAYGVTFTVLIVISMNSFYIAMSYAQEAVANMVHFMISLLPMVLALLAMTG........AATSAALFHPLIIVLVNTSGLLIER........FVLPLLFVSA...IVSVVSSMS.E..KFQLTRLATLIRNVAMGTLGAFLTIFLATISVQGATSAVHDGVTLRTAKYIAGNFVPVVGGMFTDATDTVIGASLLLKNTIGLAGLAILFVITVFPALKI.LALRLRFKLRARIMQP..L.G.GGALG...SVMSLFAKTVMFMFAA..VSV..VC..L..MFFLAVTIIISSG............
R5RUA0_9CLOT/48-368                  .......................................................FDFGDFVGKTINSGK-GIDFNN.ILKQIADGIVSNLNDEKSLYTNIILIALSGAVITNFSKLLQ.G.KRV.A...QMGFYTIYVLFFSVLSVSFMRTSTIAEETLTKIFDFMKVLAPTYFTCLSFTK........GAGLGTGYYQITLLMLTVADFILLK........FVLPGVKIYF...WLRIADQLS.E..EEMFSKMAEFVKDILSFSMKTMSVVLMGVNVVQGMIAPLAAEAKNSALVKVGSM-VPGIGNTISSAASSVLLAGSLVKNAVGVAGIVVLIIICAMPLIRL.WVSEFAYKGLSAVLQP..V.S.DKRII...KCLSMTSDAIKLLAYA..VGL..AA..M..FFAISIAVISTMT............
A0A0K8J7G5_9FIRM/63-383              ......................................................l-DFGDYVKKLMS-GEESFSLTS.IAGKILKSISEEIKAHIGTFVKLISIALIAAIFTNLSMAFK.N.NQV.S...ETGYYVTYLLLFGLIISTFISASKVASMVIGQILDFMKALVPSYFMSVAFCS........GSMSSFVFYKAALVLISLVDLIIIK........LVIPLINFFL...IIVLANNLS.K..EDMLSKLAELIETIIRWLLRSLLAAVIGFQAIQGLVVPVADQVKRSAIYKASSA-LPGVGNAIESVAETVIGSGVLLKNAIGAAGLVVIIVICSVPIIQL.GTVAFIYKFSCAALQP..I.S.DKRIV...ECVSASAKSVQMLLQA..VVV..GA..I..LFLISVTIVAIST............
A0A1S9I244_9CLOT/59-381              ......................................................i-NAKDYVKNFMEKGESNISIKK.AAKAITTYVFKEIAASLKLIALLIMVAIICALLNNLQKAFS.N.ETL.S...DIAYFACYALIIIILARSFYLGVNIARDTINKMTEFMMALIPILVMLIASIG........GIVEATMLDPILIGTINISANIFSK........FIIPLICMTF...VLQFVDNLS.E..DYKINKLTKLLNQVALWTQGIVMTIFVGVVTIRGITSKAMDQVTVKTAKYAVDNFVPVVGKCLSDAISTVAGYSLLLKNSISTLGLIIIIAMLLIPTIKL.LIMAFMYKMAAALIEP..I.S.DSRLV...NSIGTAGDSLILILSC..LIC..VS..V..MFFIMIAILASAG............
A0A1S2QX50_9BACI/70-390              ..................................................sqkgs------FMDFVS-GDKHFSLSE.WAKGFAAFIFHELLVNGKLLGSLILLTVFSMFLQSLQNAFE.K.SSI.S...KVAYSIVFMVLIILALNSFHVAIQYVQDTISAMTSFLMALIPLLLALIATSG........GLVSAAFFHPVLLFLMNTSGILIQY........IVLPLLFLAA...ILSIVSTLT.E..HYKVTQLAQLLRNWAIAILGAFMTVFLGVISVQGASSAVADGITIRTAKFVTGNFIPVIGRMFTDATDTVINASVLLKNTVGVSGVIILLLITAFPALKI.LTISFIYKLAASLLQP..L.G.GGPVI...SCLDIISKSMIYIFAA..LAL..VS..L..MFFLSITVIIAAG............
F6DUB2_DESRL/59-380                  .....................................................fg--FQEMVSQLIK-GDFSWQLSD.ILTGLLKYLFKEVVANASLLGKLVVLAVICAVLQNLMSAFD.R.GTT.G...KLAYAVSYMVLVSLAVGSFALALNIGREAVDNMVHFMQALLPLLLTLLAAMG........GVASTAIFHPIIFGAIAAIGTVVKV........IIFPLIFFSA...VLTILSNLS.E..RFQVSRLADLMKTVGMAVMGLCSTVFLGLLALKGVAGSVTDGIAIRTAKFATDAFIPVVGGMFSDALDAVIGSSLLIKNAVGIAGVVVIFTLTILPMLKI.FAVAFVYKLAGALIQP..V.G.DKQMA...DCLTALGNSLLGIFAA..VAM..VG..L..LFFFAITIVVGMG............
T0CRN5_PAESO/62-240                  ......................................................v-DLKTFVKDLIS-GKKTMLDLF.NKEGFKVFLFEELKASLKVASIIFVLALLSSILKSLDNSFS.S.GAV.S...QVTTYIVFIVMVTLTLVGFKDVLNICNNTIDSMISLMQIVMPILITFLVVMG........FPITSTVMTPIFMGGVTFINIVFKN........FLFISITIGF...AVLVINNIS.S..SIKLKNY---------------------------------------------------------------------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------hhfkankl....
A0A0A2TAU8_9BACI/65-385              ..................................................irkgs-----FMEF-MQ-HRESISIKD.WTFGLLKYLFYEFIMNGKLLGTLLFLTLFCMILQSLQNAFE.N.QAV.S...KVAYAIVYLVLIALALNSFHLAVSYAKDAIQMMSSFMIALLPLMLGLMATFG........NLIAVSFFHPVIIFLIHASGLLISN........IVLPLFFLSA...LLTIVSTIN.D..QYKVTQLAQLLRNAGLGIMGVFLTIFLGVISVQGAASAIQDGVAMKTAKFVTGNFVPVVGRMFTDATDTVLSASLLLKNTVGIVGVIIILGLALFPAIKV.LAVALIYKLAAAVLQP..I.G.GGPVI...TSMEIISKHILYVFAA..LLV..VT..F..MFFLAIVILVAA-s...........
A0A1I1NPJ6_9CLOT/90-412              ...................................................ldpi----QYIKEYIKTGKGNISIGS.VSKGVLSIVFKEVRSVLKLVISIVTIVIICSLIKSLQNAFS.N.DSI.S...EIAFYACYALIIMVLSKSFIISISVAREVITNISDFMAALLPVLITMIGVAG........GMTQAATLDPIVFAGVIFIPRIYSN........IIIPLILMGF...VLEFANNLS.T..EHKITNLCKLLKQCILWMQGIIITVFIGLLTIRGITSKTIDAVTLKTAKFAIDNFVPIVGKTFSDAIASVAGYSLIIKNAISSIGLVVIILILLYPIIKL.VLMALIYKLAAALIEP..I.S.DSRIT...NSVAAAGDSMILIISC..VLS..VS..L..MFFILIAIIASSG............
A0A1I6TVV1_9BACL/72-391              ......................................................d----DLFDVILSQAKGGWDWKE.FFLSFIKYLFHEVLYNGKLLGTIIVLTVFSMFLSTLQTAFE.R.NQV.S...KIAYAISFLVITILALNSFSVAVDAAKGAISRMIDFMMALVPLVLTLLASMG........NLGSVGMFHPLIVFMVHVIGTLIYT........IVFPLLFFSA...VLAIVSCLS.D..KYKVNQLANLLRNVSVGLLGSMLTIFLGIISVQGATSAVTDGVTIRTAKYVTGNFVPVVGRMFSDAADTVVGASLLVKNAVGIAGVVILLFISAFPAIKI.LSLAFIYSFSAAVMQP..L.G.HSPII...ECLNIISKTLIYVFAA..LAT..VG..L..MFFLAITIIVAAG............
R5FUG5_9FIRM/79-399                  ......................................................t--IKALVSYVSKNGLSAKTFRS.FFSLTAKSMAKGLTLLLPAFVSVMIISVLSGLLRGLTSDLL.K.KET.S...EVICIVLYVAAVLTVLGTLVPMLNTVKLTVGRVKKLSEAVFPVLTVLTTALG........GTVSAGIYSPLTVCFSSVLIALIDA........VILPCFIAVV...VFSVVGNVS.E..NVKLEKMTGFFKSFSSWLLGISFSLFVSFATFQGVSGAAVDGAKMSAAKKLVSGSVPIVGDYLADGFDIALVSTGLIKNSVGLTGVLVLAATTLAPLIKI.VAFLLLSKLTSAVSEA..V.G.DKKIS...AMLSGMAKSASLLVST..LAG..IT..F..VFTVLLMLMIF--t...........
A0A140LC92_9THEO/55-375              ......................................................g-DLKDLINS-LR-KNQKIDFKS.LFEGIMRYVFHEITANYSLLVKLIALSVICAVLKNLHHGFE.K.DNI.G...KMAYSAVLFVLVIIAIQSFTIAIETGQEAINKMVSFVQAIMPTVFTLLAAVG........GMTSVSVFNPLIFMGITAASTWIKD........IILPVIFFIS...VLSLVNNIT.D..SFHVSQLAHLLRQVCVFLMGLFLSVFLGIMVVQGATAATVDGITIRMAKFASKNFMPIVGGIFSDALDAVVGYSLILKNAIGLIGLLTLFLITIFPVIKI.LSIIFIYRLSAAIIQP..V.G.EDSIV...KCLNDIGNSLTLIFIS..VAS..VA..M..MFFIAITIVLASG............
A0A1B8VUQ7_9BACI/88-408              ....................................................hip----SFMEMIVP-GGKGLKFTD.MAQGLVKYLWHEVLYNGKLLVTIVMLTVFSMVLETLQNAFE.R.NAV.S...KVAYSITYMVLIIIAVNSFHVAMGYAKGAIESMIQFMLAMVPLLLTLLASMG........NVVTVSVLHPLIIFMIHAVGTLIYT........LVFPLLFFSA...VLHITSALS.E..KFKVTQLANLLRNIGVGVLGILLTVFLGVISVQGATGAVTDGVTLRTAKFVTGNFVPVVGRMFSDAADTVISASMLAKNAIGLAGVIILLFISAFPAIKI.LTLALIYNIAAAVMQP..L.G.DSPIV...TCLETIGKTMIYVFAA..LAA..VS..L..MFFLAVTIILTAG............
A0A1M4UZM5_9FIRM/61-382              ......................................................l-KFKELVVQLVK-GNFDWQVTD.IFTGLFKFFFKEVVANASLLGKLVVLAVICAVLQNLMSSFE.K.GTT.G...KLAYAVSYMVLISLAVGTFTLAVNTGREAVDNMVHFMQALLPLLLTLLAAMG........GVASTAIFHPIIFGSITAIGTIIKI........IVFPLIFFSA...VLTILSNLS.E..RFQVSRLADLMKTVAMGVLGLCSTVFLGILAIKGVAGSVTDGVAIRTAKFATDAFIPVVGGMFSDALDAVIGSSLLIKNAVGMAGVIIIFVLTILPMLKI.FAVAFVYKLAGALIQP..V.G.DKQMA...DCLTGLGKSLISIFAA..VAT..VG..L..LFFFAITIVVGMG............
A0A1G4FHT4_9FIRM/67-387              .......................................................ISLKEFILSMIK-GENRIDGKS.ILIGILKIFLKEVLANITILINILSIVIISGILTNLQSSFE.T.NNV.S...KLAYFVSYMVISIILIRSFSISLSIGKEAVDNMVNFMEIMLPPMLGLLIAVG........GTTTSVMFNPLIIGTVNIVGTVIRG........IIFPLIFFSF...IIGLLSKIS.D..KIQFGRLAELIRGAAVTIIGIALTVFIGVISMYGVASK-VDGVTIRTAKFAVDKFIPIIGKFLSDAVETVVGCSAILKNAVGVIGLFALFLICIIPVMKI.ISIIFLYKLTIAIIEP..I.S.GQKEI...ECLNEVSKSLTLILAS..ILS..VA..T..MFFITITIIIEA-g...........
A0A1S1FST0_9BACI/62-382              .................................................sqkgsl------LQF-LN-GEKELSFQE.WSKAFLKYIFHEIIANGKLLGTLILLTIFSMLLQLLQDAFS.Q.STV.S...KVAYALVYMVLMIIALNSFHIAIEYTVEAIQTMTSFILALIPLLLALMAASG........GLISAAFFHPVILFLMNTSGVLIEK........IVLPLLFLSA...LLSIVSTLT.D..QYKVTQLAQLLRNISIGLLGTFLTVFLGVISVQGASAAVSDGMAIRTAKFVTGNFIPVLGRMFTDATDTVISASVLLKNTVGIIGVAILLFIAAFPAIKV.LTLAFIYKFTAALLQP..L.G.GGPII...KCLDIISKSVIYIFAA..LAI..VS..L..MFFLSITVIIAAG............
G9RYJ9_9FIRM/57-373                  ............................................eapmtagdfsg-----------------MTLSD.WLEKGAEILRESLHEPLRLLARLCGLLLLAAVGKSMCTERT.S.PEL.A...GLVDTVVTLAVFTLCSSCMLALTGVLQDAIETSRVYIISFVPVFASVLTACG........QVGGAALYSGFFFGAAMVMADILCR........VGLPLTRVLL...ALNATAAVG.S..TLDLSQLTASVCRWTKWLLTFCATVFGALIGLQGIFAQSADTLALKTGKFLLSSGVPVVGRAISDAMGSVLAGLKMLKGTVGFAVIAVIAASFLPLLIQC.CAYHLVFSAGNIVASA..T.G.GTKSA...KLLSGLSDCVSLYISM..VVF..FS..L..IVISSTLVMIL--lg..........
A0A0C2VAG3_9BACL/61-378              ............................................khdllalifkp----------------QSSIAE.WFSGILRFIFHEVAEQAHIIFWLLLLLVIGSILQTLQQSFS.S.SGV.A...SVSSVAMTGLLLMIVIESVQTCVTYVNETVDLMADFMYALLPLYMAMLTLSG........SVTTAAASHPILLFIVQFSHYLMQY........FLVPLFVLSI...LLDIVDTIS.I..SFRTSKMAGLCRQVGMWLLGVVVMIYMSIFSVQGVTTSVTDGVGAKTVKTIAGQFIPFIGKVVADTTDLLLASTVLAKNAVGLAGALVLGIMVLFPALKI.LVIAFMYRICAVVMEP..L.G.HPGMV...QAVDAVSKGLFHLCGA..LVL..VS..I..MFLLGIVVLLIV-s...........
A0A1M6JR07_9CLOT/66-387              .......................................................INIKTYIMKAIK-GELNLSFKG.ILIGFIKKLFKEIIVNSKLLSQLIIISVLCSLLNNLTNSFG.N.NST.N...EIAFYACYLVIAGLLVKAFTVAMNVGQQAIDNMVSFMQSLMPILLSLLMAAG........SITSSAIFKPIMVGTIGITSTIMRD........IILPLIFLSA...ILAIVNNLP.T..KIHVSKLASLIKQGSITLIGLMLTIFFGVVTIEGVLTSSTDGVTLRTAKFAVDSFIPIVGGFMSDAVDTVLGCSLLIKNAVGVVGLIIILTIVTFPILKI.LSLIIIYKITAVLIEP..I.S.DTKIV...NCINDMSNALVVVFAT..VIS..VA..I..MFFIAITAVVGAG............
A0A176JBI7_9BACI/56-376              ................................................sqkgsly--------DFVT-GEKHFSIMD.WMKALLKYLFHEILANGKLLGTLILLTIFSVLLQLLQNAFQ.Q.STV.S...KVAYALVYMVLMIIALNSFHIAIQYTSDAIQSMTNFIMALIPLLLALMASSG........GLVSAAFFHPVILFLMNTSGVLIQN........VVLPLLFLSA...LLSIVSTLT.D..QYKVTQLAQLLRQAGIGLLGTFLTIFLGVISVQGASAAVTDGITIRTAKFLTGNFIPVLGRMFTDATDTVISASVLLKNTVGIAGVAILLAIAAFPALKV.LSLAFIYKFAAAILQP..V.G.GGPVI...KCLDIISKSVIYIFAA..LAI..VS..F..MFFLSLTVIIAAG............
C0C3R5_9FIRM/85-405                  ......................................................l-DFKETLMAVIT-GDMSLSADL.LNRLVSDQLTYVVRSNKSNLIHILLIAVIAAVFTNFSNVFQ.N.RQI.S...QVSFYMLYLLLIALCLNSFEIVIDWVEGGIQNLTSFMGVFCPLYFLAVAIAK........GSVTSIAFFNLVLFLIYLVEMLIVN........FLLPAVHIYI...MVKIINYLS.S..EDYLSKLAELMQVVIVWTLKTLLACIIGLNVIQGLISPAIDTVKRSVVTRGAEA-IPGIGDAIGGVTEVVLGTAVLVKNGIGMTGAVICVALCVVPLVQT.GIVVIMYKLVAALIQP..V.S.DKRIV...GCVESVGDGCQILMRV..IFT..VG..L..LFLLTIAIVSAVT............
Q818Q7_BACCR/63-383                  ..................................................sqkgs-----FM-EFVK-GEKEFSLKE.WMIGLLKYLFHELAANGKLLGTLIMLTIFSALLQSLQSAFS.K.SSV.S...KIADAVVYMVLIIFALNSFYVVMTYARETIQTMVDFILALLPILLALIATGG........GVVSVSFFHPIIIFLMNTSGLLMNY........IVLPLLLLAT...ILSIVSTMS.D..QYKVTKLSKLLQNVSVGIIGIFLTIFLGVLSVQGTATAVADGIAVKTAKFVTGNFIPVVGRMFTEAADTVISASGLLKNTVGIIGLVILCLIVAFPAIQI.FCIAFIYKFAAAVLQP..V.G.GGAII...QCLDIIGRSIIYVFAC..LAI..VS..F..MFFLSITIIIAAG............
R5AHW6_9CLOT/49-363                  ..................................tqellsqagaedglwegngge---------------------A.LLDTFSELLREKLAAPVKGLAALLGVVILC----RLAGCFE.E.G--.G...DFSLMAGTLACAGILTAPLMELIQASEQVVESACVFLGASVPVYSALLVASG........NTVVGGSYSFLTLLAGSVIPVISSA........LLMPLLHVFL...MLSLATSLC.-..GAKFDRLLSSLYGFTKWLLVLAVTLFTGILSVQTVLNAQADAATGKTVKLIASSAIPIVGGAFGDAVAAIQSSVQIVKSGVGAFGILAAICIFAPSMIQA.SLWMGVCLLGQVAADL..F.D.TPRLG...SLFGACASVTRMILAI..LVS..VC..A..VAVVCAALVL---fv..........
R5K1X9_9CLOT/55-373                  ......................................................l-SFREVVSY-IRNGDLQGLLDY.SLKTIQQTLTGEIKSNNRLLLQLLAVVILGSVFTNLSGKFG.-.KMV.G...GNGFFVTYLMVVSILLGMFAIVSNIAVSAVSDLTDLMITFIPAYTLAVSYTN........GAGTAEFTYQITMLIIFLCEKVIIQ........IVFPLAKCSG...VVGLVNKLN.A..EDHFSRTVTLLRNIAGWILKTMFAVVTGMNVIKGVIVPSVDKLERNAVLKAFGM-LPG-GNTVKNVSDILLGSGMVLKNAIGIAGAVVVLLAVLLPVTKI.AVIYLTLRIVSAFVQP..L.G.DKRFS...DGINIMAQTIGLMLRG..IWC..AS..F..LFIISLTLMTL--la..........
A0A1U7MM24_9FIRM/59-379              .....................................................lt---TDVIKDIAS-KGFSIDWQA.VGNKFIAYLFKELATNIHLMGKLLFLAVLCALLQNLQNSFE.Q.SSI.S...LLSYSVCFIFLCVIALSAFYQGLSLARETVGNIVGFMEALLPLLLSLLAGVG........ALTSAALFTPLMLFVVSATSVVVKD........IILPLLFLTA...VLECVNYLS.G..KYKLSNLTSVLKQAGMMVLGLVLVVFIGIVSIQGVAGSVADGLTLRTAKYATATFIPVVGKMFADTVELVMGASLVLKNAVGIFGVLTIALLCALPVIKL.ISLVVVIKIAGALIQP..M.G.DENMA...KCLDAMGNNLLLVFGA..LLT..VV..L..MLFLVITMIIGAG............
A0A1K1MSD9_9FIRM/55-371              ...............................................rsaspdga-----------SAGTGSLDPQS.LISGFKNAFVDSLKSPLKIFGSIAAVLIVSSAVQSMAA---.G.GET.A...SAVGTVSVLGCVTLIYSAVCEAFTGVCVFLRRLSEFMLSYIPIYASVTAASG........GVKTGGSYYAAMLGVTELIGFVAER........AVMPFLSVFM...ALSFTAAVN.P..TLKLSNAAASVGSGVRITLTALMTVFGGSAAIQSISSAAADTAAARAVRFGAASFVPIIGGSVSEAYSTVCAGVGMLRSGVGTVGIAAVAFMLIRPLVTL.ICLRIMLGLSKVTADL..L.G.AGAAS...ELLSGTGYAVSAAIST..VLC..FG..M..MFILSTAVVTAA-a...........
A0A1U9K988_9BACL/78-398              ...................................................epps-----IFDLILD-NREGFDVKG.ALLGFFEYFLFEIVHNMGLLGTIAVLAVFCMLLQQMQTAFE.Q.NTV.S...KVAYAVAYLVLIILAINSFAVAIETAQSTIGGMVNFMLALIPLMLTLLGAMG........NVVSVTVFHPLIAFLVHVIGTVVYT........VVFPLLFFSA...VLGMISSYA.V..QYPLTNLARLLRNVSMSALGIFMTVFLGVVSVQGAATAVTDGVTIRTAKYVTGNFVPVVGGLFAEAADTVVGASLLVKNAVGMSGVIILMFICAFPALKI.LALALIYSFTGAVMQP..L.G.DSPIT...QCLDTIGKGLITIFAA..MAT..VG..L..MFFIAVTIIVAAG............
R4K7I4_CLOPA/57-379                  ......................................................l-DIKSYIQDFMKTGDGKFSFQK.LCKALLGYFFSEVIASFKLMIMLLIICVICALLTNLQRAFS.N.ESL.S...NIAYFACYSLIIIIVAKSFYIGVDEVKTATNNLTDFMTALVPVLLTLLAASG........GIVQSTIMDPIIILAINVAARIFMD........VLLPLILISF...VLQFVNNIS.E..EYKVDRLAKLLSQIVLWIQGLVMTIFIGIVTIRGINAKSIDEVTAKTAKFAVDNFVPIVGKALSDAISTVVGYSVVLKNAVSSIGLIVLVAIVIFPIIKV.LALALIHKLTAALVQP..I.S.DKRIV...NCINAAGDTLILLMSC..LIS..IS..V..MFFIMIAIIASSG............
A0A011VT13_RUMAL/64-372              ..................................................aevek-----------------LDMRG.FFGWLWVRFREMLCTPAVMLGRILAVSLLYSAVTFLT--IE.N.REL.S...SVYGNICVIAVVTVMAETLSSSFCALQDSISCINKFMLSYIPVFSAVSAASG........SPATAGAYSSSTVLLCEVTEFIASG........LLIPFMSAFM...AIALVSVLN.T..HVKLSGAADAIRRLTTWLLAALMLVFVGLLTIQGITCSAADSVAAKTVRFTASSFIPVIGSSVSDAYLAVKSGVGVIRAAVGGFGMAAIFLIALRPFLLI.LSMRLTLWAGRIANEF..L.G.LRTTA...ELLKTIDHVMSVGGSI..LIA..IT..S..AFIIATAAVL---sfm.........
C5D480_GEOSW/61-381                  ..................................................sqkgs------IAEFLS-GEKQLSLKE.WLIAFGKFLFYELQANGKLLGTLILLTVFSMVLQSLQNAFE.Q.QTV.S...KVAYAVVYMVLLIIALNSFRVAMDYALDAVQTMSHFMIAMIPLLLALLASSG........GVISAAFFHPIILFLMNTTGTIVEY........VTLPLLFLAA...LLSIVSTLT.D..HYKVTQLAELLTKVGIGILGVILTTFLGVMSVKGATSAIADGIALRTAKFVTGNFIPVVGKMFTDAADTVVTASMLLKNTVGIVGVAILFIIAAFPALKI.FAIAFIYKVSAAVMQP..L.G.GGPVI...SCLSIMSKSIAYVFAS..LAI..VS..L..MFFLSLTIIITAG............
A0A0S2W423_9FIRM/57-371              ...............................................dtvtgvdl----------------DAGLQD.LLDTGSDQLAGVLRKAVRSGVLLLTVVLLCSLAQGTCEAIG.E.PGG.L...QVVPLVGALAITAISVADVHSLIGMGREALNNMTAFSKILLPTMAVATAASG........APGGAAARQMATMLFSTVLMSLITK........LLLPLVYGYI...AACVAHAAV.G..NEGLKRIAVVLKWTVTSILTVLLLVFVGYLTVSGVIAGTADAVAVKAAKFTVSSMVPVVGGILSDAAETVLAGAGILKNAVGVFGMLVILSMCVVPFLQL.GIHYLAYKLTAALAAT..V.A.DGRTS...GLIDGLGGAFGLILGM..TGA..SA..M..LLLVSMV------savsmv......
A0A150F6Z1_9BACI/75-395              .................................................sqkgsi------I-DFIN-GEKKFSPQE.WLKALFSYLFHEVLANGKLLGTLILLTIFCVILQLLQNAFQ.Q.STV.S...KVAYAIVYMVLIILALNSFHVAVNYASEAIQTMTSFILALIPMLLALMASSG........GAVSAAFFHPVILFLMNTSGLLIQN........IVMPLIFLSA...ILSIVSTMT.D..QYKVTQLANLLKNIAIGALAVFLTVFLGVISVQGASAAVTDGITLRTAKFITGNFIPVLGRMFTDATDTVISASLLLKNTVGLLGVGILICISAFPAIKV.LSLAFIYKLAAAILQP..L.G.GGPVI...TCLGVISRSVLYIFAA..LAI..VS..L..MFFLSITVIITAG............
A0A109RLV0_9FIRM/29-345              ............................................dyldksnllnv---------------ENFNIVG.FFQSLGDYAMHELSTGFSQFKSILIFLLIIALFQNIQSSFS.T.K-Y.E...KITNTVLKLVLMVQLFQLFIFYHDYVLDILTRYMNIVVAIFPILLSLITITG........ALWNQALFKPAVVFLINASYFFINA........ISMPLTVVGT...IFGFINQIN.I..EDLYGRLIEFINKIAIWTLGGYFAFFLTLMSIQNITLSFADGLFFRTTQNLMNH-IPVIGTRFTDTVVSVVSTLSILRNSVGLLSVITLVVVVAFPVIKV.GVSLILFRLLGAVIQP..I.I.SKDYI...KILDVFNTGMTNLLVI..MII..IG..V..MFIFTFFIILYS-s...........
A0A248TLL0_9BACI/81-401              ..................................................sqkgs------IYDFIK-GEKEFSFDQ.WALGILKFVFHEFVVNGKLLGTLILLAVFSMFLQSLQNAFE.S.GTV.S...KVAYAIVLMVLVILALNSFHIAMEYASDTVHKMTSFILALIPLLLALIASSG........GLISAAFFHPVILFLMNTSGVLIQY........VVFPLLFLST...LLHIVSTLS.D..QYKVTQLGNLLRNWSVGLLGIFLTVFLAVISIQGVSTAITDGVTLKTAKYVTSNFIPVIGRMFTDATDTVVTASVLLKNTVGIAGVAILMIIVAFPAIKI.LMIAFIYKFAAAVLQP..L.G.GGPII...KCLDIISKSVMYVFAA..LAI..VS..L..MFFLSITVVIVAG............
E3E4Y4_PAEPS/69-389                  ...................................................ktps-----FMDMLLP-GGEGFTIKG.VLMAIADFFIHEIRVNAKLLVTIVMLSIMSMVLETLQSAFE.S.KQV.S...KVAYAIVYMVIIILAINSFSVAIGYAKEAIDSMIHFMMAMLPLLFTMLASMG........NVVTVSVTHPLIVFMINTVGTVIHT........LVFPLLFFSA...VLYLVNSLT.G..KYKLTQLADLLRNAGVAVLGVLLTIFLGVISVQGLTSSVTDGLTIRTAKYITGSFVPVVGKALADATDTVISASLLVKNAIGLVGVIIILFLCAFPALKI.LTLALIYKVTAAIMQP..L.G.DTPIV...ECLDAIGKSMIYVFAA..LAA..VG..L..MSFLAITVMLAAG............
A0A268E8N3_9BACI/75-395              ..................................................sqkgs-----LLQF-LS-GEKELSIQE.WLKAFLKYLFHELIANGKLLGTLILLTVFSMLLQLLQNAFN.Q.STV.S...KVAYALVYMVLIIIALNSFHVAIQYTNEAIQAMTNFILALIPLLLALMASSG........GIASAAFFHPVIIFLMNTSGLLISN........IVLPLLFLAA...LLNIVSTLT.D..QYKVTQLAGLLRNISIGLLASFLTIFLGVISVQGASAAVTDGITIRTAKFITGNFIPVLGRMFTDATDTVISASILLKNTVGVIGVAILLIIVAFPAIKV.LSLAFIYKFAASILQP..L.G.GGPVI...ACLDIISKSVIYIFAA..LAI..VS..L..MFFLCLTVIIAAG............
A0A1M6PGB0_9FIRM/61-382              ......................................................l-NFKELVLQVIK-GDVDVQVSD.IFTGLFKYLFKEVVANSSLLGKLVVLAVICAVLQNVMSSFE.K.GTT.G...KLAYAVSYMVLMTLAVGSFTLALNIGREAIDTMVLFMQALLPLLLTLLAAMG........GVASTAIFHPIIFGSITVIGTVIKV........IVFPLLFFSA...VLNILSYFS.E..KFQVSRLADLMKTVAMTVLGLCSTIFLGVFAIKGVAGSVTDGVAIRTAKFATDAFIPVVGGMFSDALDAVIGSSLLIKNAVGIVGVIIIFILTILPMLKI.FAVAFVYKLAGALIQP..V.G.DKQMA...DCLTGLGKSLLSVFAA..VAT..VG..L..LFFFAITIIVGMG............
A0A1I6ILC8_9FIRM/67-387              .......................................................FNFEEYVNEFVS-GEEPFDLSN.ICSKLANGVLNQIVIERKTIIQLLAIAVIASVFTNFTNVFQ.N.SHI.A...ETGFYVTYLLLFTLLTTSFYQVTRIAEGALTTLLDFMKALLPTYFICITFSA........GAKTSMVFYESTLVLITIINVVLIK........ILLPLINVYF...ILLMANNIM.K..EDMLSKFAELLEMVISWSLKTILGAVVGFNVIQGLVVPVTDYVKQSMMMKTANA-IPGVGNAFSSVTETVFAAGVLIKNSVGAAGLIAIVVICANPVIKL.GIYSLIYKLGAAIVQP..I.S.DKRVL...NCINGTAKSARLLVSM..VII..AA..V..LFIFTIVIITTST............
A0A1T4K467_9FIRM/66-386              .......................................................FNVRDMISSIAK-GELNFNMKD.FFTGIGKYLFNEVNTNINLLLRIILLSIICAILQNFQNTFD.N.-TV.S...ELAFNIVYMIILVMAIQSFTISIQIGIDVIDKMVTFMQALLPILLSLLTSMG........SITSSALFKPLVILTVSTLSTFIKN........IIIPMIFCGG...ILNLINHIS.E..KIQISKLSGLLKQTSIVLLGFVMTVFVGVISIQGIASSSFDGITARTAKYAIDNFVPVIGGFLSEAADTVMGCSLLIKNAIGIIGLIFLFIIMLFPIIKI.LSIIIIYKISAAIIEP..I.A.DGRIV...NSLNDISKSLTLILAS..IIS..VG..I..MFFLVITIIIGTG............
R6Q3U0_9FIRM/1-53                    .......................................................----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..----------------------------------------------------------------------------------------------------.----MIFKLTAAAVES..V.C.EARLV...ECIGIAGDYTALLLGV..VFL..VE..V..MFLFSSVLLLG--v...........
F7KB96_9FIRM/28-348                  .......................................................IDFTSFFGQVLA-GNMGEAFRG.LSSSLRNGILAEIGGMKNLMLTLLIIGVLSALFTVVMQSFD.N.HQI.A...DIAHFISYLLMLFVVLRTFTQAADIAGVLLERILLFVRLFVPTFMLALGLSS........GAATAAGYYQLILLLIYGVEQLLVS........IGLPAVNIYM...MLVVMNGVW.E..EEKLGMLVDLLQKGIGGFLKFMLTCITGIGLLQSMVTPVLEQLKLNVAGKALSA-IPGLGGLAEGTAQLLIGSAVLVKNGLGVAAFLLLLALCIVPFAKL.LLYAGILKLCAALLGM..T.A.DKRIT...GCVNKAGDGLLLLLRI..SFT..AC..A..CFLIMFAIITC--la..........
L0K665_HALHC/63-384                  ......................................................l-QVTDIINL-FSKQGLENKFQE.IVRGLLHYFFDEIVINSKLLGQLIVLAMVVAVLKNFQANFA.V.SQV.S...QLANGITYLVLAIVALNSFKVAITVGQGTIQDMVGVMYAIIPLLLSLLISMG........NLASASLFHPITFLIVNTLSTIVKN........FVFPIIFLST...VLEIVDNIS.N..DFKVSGLVSLLRQLAMGALGVVTTIFLAAIITQGTVATVSDGVTIRTAKYLTSNFIPVVGGFLSSALDVMIGGSLLIKNALGLFSVLIILVFCSFSVIKI.LALVFIYRFAAAIIQP..V.S.DDQTV...NCLNILAGNLLRIFGS..VVV..VG..V..MFFVVIIIVVGT-a...........
A0A0K9FAS9_9BACI/1-297               .....................................................ml--------------------EQ.IFSFLTDPFFLLLKMTLILCGYVIIILIVNMILPEFE----.-.KGT.R...ILFFLIVLATIGPVVVNSFKLIDEIA----QGLAHIFTAFYPILTSSFLLSS........SITAIASWQPFLLFFVQVLTFVSSK........WLIPGVLFAI...VFDVCSVIV.K..EISFTRIADLIRFTIMSIVSASVICYIILMSASGVAAFSVNAAVAEPVKKLIEENIPVVGSFIVDSFSMFQHMTQFSSSITSISAFIAVITVSFIPTVQL.VVSAYSLKMLAAILEP..I.A.FDDIC...KLLDHVSKSLFTLCAV..SFL..IA..FsfMFSCLFLIV----fvq.........
A0A1S9C128_9FIRM/60-381              ......................................................f-NLEEEVLLVVS-GKKEFSIET.IVDATIEMFVGELDTYINMMARFVLIIVLCHVLSNLSSAFE.S.KNT.T...KIAFFVCYIVILYSVAQGLVLMVELAQNTIGNLLNIMYVVLPTLLTFMATSG........YIATSAALSPVIIGGLTFISFVIQK........FMLSSVVGVI...LLQIISSMS.E..EFKIDNLIALFYKICRWILRSTFFLSIGIMGIYRMSLPYTDATMKRVGITLSTKFIPILGDAVSGAIDLIIQCAGMIKSAFGIGVIIWIIVLITMPFIKM.LVYIILYNFAAALVEP..L.G.DKKMA...KIALNIANGCEFIMSC..VGV..VA..I..LCISALVICMSI-g...........
A0A0A8JKT5_BACSX/2-291               .............................................iafietilgt----------------------.-------------------VLSSFAIIIISAFMALMAD-FL.F.PSF.S...KWTRILLIILIVSVALQPAMGHLDLIRDIARSISLIFISIYPVLSAGMVMAG........GAFGLLNFQPAMLLFANGAVVLAER........LLIPLLTATF...LFDLISRLL.P..DVPFSRMADMVRTTLLAVVSATVATYSIFITAGGTMSWAISGLTSEPVRELIRQNIPLIGSFMTDTIGTMGRYSSGASVFAGGWMMVTVWTVALVPSLKT.LIVAFFYRWTAALIEP..F.A.DEDIA...GILDDIGKTLFVLCAV..SFL..IS..F..AFIYTSLVS----ivf.........
R5DEA0_9FIRM/27-342                  ..............................................aaeelegkd---------------FSGGIAA.LLEQGTTLLGEALRGNLRGAVLILGVVLLCGAADAVLRTPE.-.SPM.R...RFLPMAGAAAIAVLSLGSMKSLLGLGTQTIEELDVFSKALLPTLAAAVAAGG........GAVTAGTGQVIAVCFADALITLIRG........LLLPMTYFLA...AAATADAML.P..RHGLGTVAKAASRVVTWLLTGSLVLFTGYLTLSGAVSTSADALTVQVARSAVGA-MPVVGRILSDAAGSVLAGAGVVKNAIGVFGLLGVLAACLGPFVRL.GVQYLLYKLTAFLAGM..T.A.APELA...KLIDALGGVFGLMMGM..TGS..CA..L..LLLISIS------sailvvt.....
A0A1I4KVN1_9BACI/61-380              .................................................nkeniw--------SIVK-GDGSLSIKD.WLEGFLRFFFYEIVENGKLLATLMLLTLFCLMLQTIQNAFE.N.QVV.S...KVAYAIVYTMLIIIALKSFQLASSYVLDTVEMAQNFLIALLPLLLGILASLG........NLVTISFFHPIIIFLIHTSVLVISK........IVIPLILISA...ILHIVSTIS.P..EYKATKLANLIKNIAISLMGILLTVFLGVISVQGAASAIQDGIAMKTAKFVTGNFIPVIGRIFTDATDTVLSATILIKNGIGMIGVVILIGIVLFPAIKI.FTISLMYRVATAILQP..I.G.DGPVI...ECLDIIGKHILYLFAA..LLL..VT..F..MFFFTIVILIIS-s...........
A0A084JIV2_9CLOT/56-378              ......................................................m-SPKEFVQSYMKDGQGSLERKE.ILKMALGYLFKEIVVSFKIIGQLIIIAIVCALLNNLQNAFS.N.EKL.C...NVAYFACFSVMIILIARGFYIGVELTQQVINSISDFMVALMPVLIMLLASVG........SVSQAVVMDPIIMGVCTLGTKLYSS........IIIPIICMSF...VLDFVNNIS.N..EYNVKNLTSLLKKFALWVQGIFLTIFVGIITIRGIVGNSFDVVTTKTAKFAMDSFIPVVGKTLSDAFATVASYTLLLKNSVSLLGVVILISIILLPIIKI.FVMGFMYKLTSALLQP..V.S.DNKVT...NIIDAAGGSLMLLGSC..IIC..VS..V..MFFIMIAIIAATG............
A0A0A7FXA2_9CLOT/80-402              ....................................................ldp---VEYFKSYVKNGQGNITFET.ITKIVLSILFKEVKSVLKLVISVIVIAILCSLLKNLQDAFK.N.DNI.S...QIAFFACYSILIMILSKSFLIALSVATNAINEMANFMNALLPILVTMISLAG........GFVQAATLDPIILVSVTLIPKIYVT........IIIPLILISF...VMQFANNLS.T..EYKIDNLCKLMKQTILLLQGIIITVFIAILTIRGITADTMDAVALKTTKFAVDNFIPIVGKTFSDAITSVAGYSLIIKNAITGVGLIVIVLVILYPIVKL.GIMTFIYKLSSALVEP..I.S.DKRIT...NAISSVSEALTLLVSC..VIS..VS..F..MFFILLGIMASAG............
A0A0B7MPF6_9FIRM/62-383              ......................................................f-SLIKIFED-ARQGKLEMDISG.IFKALISYFCREFLTHTSLLGKLIVLGALLAILEHLQSAFE.Q.NTV.A...KLAHSIGIIALLTVALSSFTIAIQTGRDAIGNMVGFMQSLIPILLTLMAALG........SLTTVALMHPVIYVSLNIIATLIQN........IVFPLIFCAA...ILGIVSSLS.E..RFQVSRLADLFRDGSMLLTGLLLTVFTGILGVQGVAGAVTDGVGLRTVKYLTGAVVPVVGGVLTDAVDAVAGCSLFIKNAVGIVGVLAILFLCTLPVVKI.LSAAVMYRLAAALLQP..L.G.AQELS...ESLHLLGNYLLLVFAA..VAA..VG..L..MFFIALTIIVGL-s...........
A0A1Y3TV44_9FIRM/64-362              .......................................ldavrrllpgdmmrtv----------------------.-------------RDSVGSYAQVFLFLLLVMLISFF----L.G.EDK.A...DLLDLAAAGGSALLCWTALAALAETVCEKLDSWRVFLLGFVPVYEGVLLAGG........EATAAAAAGGLFLSGLCLLTQLLCS........WVPPLLHCYL...ALSTACCIS.T..EAALSAACRGVGRLFRKGLSWAGRAFGALLGLQRIFTCQLDRTSQQLGQLLTGT-VPIIGQSLSDAASTVLSGIQLLKSGLGFAAIAFLAAEFLPLYMIL.MVHAVLLFGCEMLCSA..A.G.IGRCAalfNCLREAVQGLAAATAL..VFG..IA..V..L---G--------tallfmvg....
R5DUI8_9FIRM/81-399                  ......................................................t-DFESLVKS-IA--ESDYSQTG.IINVVIKNFLAVFRENTDTVIKIIMLSLLSAGINFIIPSFN.K.KQV.S...DISEIMLYTGLVVIVSGFFYSSCVECVNAIDAGLKIYKAVIPAFLSAVTFMT........GSVTSGVYYEMMLLMITVVNIIFKN........VLLGIIKVDF...MLIVADAFT.K..SERFSNICKFIPPVIKWTCRIVITLFSGAGWIKGMITPVKESAKKKAVYKVLKV-LPGIGDSAETVSFTIFSAGSVIKNAIGIGGVILIISAVSLPVIKL.LSFTVILKFTAAAVQP..V.A.DKKFA...NILDASGTVTGLMTLL..VVM..SA..C..LFILFTAIVCTVT............
A0A1G6QAM8_9BACL/66-385              ....................................................npg----DLFDLVLS-GE-GLSWRN.FFSAFTKYLFHEVLYNAKLLSTIIVLTVFSMILRTLQTAFE.Q.NQV.S...RIAYAISFMVIIILAVDSFSVAVDSAQEAISRMIHFMLALVPLVLTLLASMG........NLGSVGMFHPMIVLMIHVIGTMIHT........VVFPLLFFSA...ILGIVSCLS.D..KYKVNRLARLLQKISVGMLGTLLTIFLGIISVQGATAAVTDGVTIRTAKYVTGNFVPVVGRLFSDAADTVVGASLLVKNAVGMAGVVILLVIIAFPALKI.LSLALIYSFSAAVMQP..L.G.NSPII...ECLSIISKTLLYIFAA..LAT..VG..L..MFFLAITIIVASG............
A0A0B0HR86_9BACI/1-153               .......................................................----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........---------------MNITGTIIEH........FSLPLLFLAT...ILSIVSLLS.E..HYKVTKLADLLRNISIGSLGVMLTIFFGVLSVKGATTAIADGIAIRAAKFVAGNFIPIIGRMFTDAADTVVTASVLLKNTVGLFGVTLLLLIAAFPAIKI.LVIALIYQLAAAILQP..M.G.EA---...----------------..---..--..-..-------------ssf.........
E6UIW3_RUMA7/64-372                  ....................................................vgi---------------EKIDMRQ.FFRWLLDRFLSSLKAPVMMLGRIIAVTILYSAVSFLGS--E.N.SDI.E...NTYGTVCVIVVIAVMADAFSPSLDMLKDSLSCINRFMITYIPVFSAVSTVGG........NPASAGVYTSSTLLLCEVAEYIASV........VLMPFLSSLT...AMAVVSAID.T..RIKISGAAETVRRFTVWLLAAVMIVFVGLLTIQGVTCAAADSVAARTIRFTASSFIPVIGSSVSDAYLAVKSGVGVIRSAVGGFGMAVVFVIALRPFLMI.LSMRVTLWAGRIANEL..L.G.LKRTA...ELYRTLDSVLSVGVSI..LIA..IT..S..SFLVATAAVM---sfm.........
A0A0D8IDG5_9CLOT/62-383              ......................................................v-DIRQFIMNLIR-GEATLSLGD.IVRGSTRVLFKEVVANWKLLAQIIVLAAICAVLRNLQSAFE.N.EVV.G...KLAYNVCYLVIISITIKSFMIAIGIGKETIDLMVSFMQVLMPVLLAMLMAIG........GITTSAILHPILLGAIGFVGTIIKV........TILPLILFSA...VLAIVNNLS.S..KIQVTKLAGLLKQAAVVTLGFILTTFVGIISIQGITASTVDGVTIRTAKFAVDKFIPIVGGFLSEAMDTVIGCSLVLKNAVGAIGLLSIFVLCLMPMIKI.LALIIVYKLCAALIEP..I.S.EDGLV...DCLNSMSSALTLLFAT..VSS..VA..I..MFFLTITIIVSTG............
A0A0F0C2T5_9CLOT/96-416              .......................................................FSFWELMKELVK-GNLKGILGQ.AGAGIQNTLFSEVRRGGHMLFQVAAIGIIGAVFSNVSSVFK.G.GQT.S...DTGFFVTYILLFTCLAASFAASLQVAAQVLDQILEFMKLMMPAYFMSVAFSG........GSMSALALYEGMLGAVTLVQWICST........VLLSMVKIYV...LMVLGSHVV.K..EALLTKLTELLEQAVGWGLKTLTGLVVGFHLIQSMILPYADAAGQAGMKRLLEI-IPGLGQGAGAMAQMVLGSGVLIKNTMGAAAVVVLAVITVIPIIKL.MVLMVLYQCVAAVMQP..V.C.DKRVV...SCVSGVSKGHKLLIQI..VLY..SM..F..LFMISIAITCAST............
J9HED9_9BACL/64-383                  ...................................................sgpg-----LVKSILHNGP--PNFVS.VTHGLLRYFFQELVDDAGLLGSILILCVAGAVLKTLQTSFE.Q.ESI.S...ELADMVVCFVLIALVAHSLIETIGAARHAIETMNHFMLATVPLTVTLLAASG........SLASAAFFQPMLLFTVHFVSNLVFY........VVFPLIFFAA...VLDLTSALS.V..RYTLSRLAGLIRTVSVAVLSFGLAVFIGISTVQGAGKGIVDGVVLRTMKLGVSTFVPVVGKAISDAAETVLSASLLVKNAVGVAGLVIITLIAVFPALKI.LAVATMYGGSAALMQP..L.G.ETPIV...TCLGALGKTMVLVFAC..VAG..VA..L..MFFFAICILLAS-a...........
A0A0D3V783_9BACL/71-391              ....................................................kvp----SFMDMLLP-GGEGLSFKN.ILSGLISFFWHEVLLNGKLLVSIVILSIMSMILETLQTAFE.R.NTV.S...KVAYSLCYMVIMVIAINSFSVAIGYAKGAISHMIDFMMAMLPLLFSLLASMG........NVVTVSVTHPLIIFMIHTVGTLVYT........VIFPLLFFSA...VLHIVSSLS.D..KYKLTQMANLLQRISVGLLGVLLTIFLGVISVQGMTSSVTDGVTIRTAKYISGSFIPVVGKMFADATDTVISASVLVKNSIGLAGVIIIIFICAFPAIKI.LTLALIYQVAAAIMQP..L.G.DTPIV...TCLQTIGKSMIYVFST..MAV..VG..L..MFFLAITILLMAG............
A0A0D0SHX2_9FIRM/20-131              .......................................................FSFEELLNLLIS-GDYKVIGER.VLAQLKRGFLGGISQNAYLIRQMIFILVAFAIYLAIVKAFK.D.TTL.P...TIGIYLGYLMLVTLLVTSFQVGYQFVQTVIEKMFSFLTVSLPVF--------........-------------------------........----------...---------.-..----------------------------------------------------------------------------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------s...........
A0A268J9Y8_9BACL/65-385              .................................................iektsi-------YEFVK-NQDSFSLKN.TIVAFLEYLFHELIANGKLLGTLLMLTLFSVILQTMHSAFE.R.NAV.S...KIAYFVIYLVLIFIALNSFYVAVSYTQEAIEMMKGFMIALLPLMLGMMASFG........NVIAVSFFHPIIIFLINFSGILVST........FILPLLFLSA...MLLIVSSLS.E..NYKVTHLANLFKTVGLGALGIFLTIFLGVISVQGTASAIQDGLAMKTAKFVTGNFIPVVGRTFTDAADTILSASLVLKNAVGMAGLLVILLIVLFPALKI.AAVALIYKIAAAALQP..I.G.GGPVI...TVLNTISNYILYILAC..LLA..VS..L..MFLLAIVIIVSA-s...........
W4VDH9_9BACI/1-114                   .......................................................----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..--------------------------------------------MKTAKFVTGNFIPVIGRIFTDATDTVLSATILIKNGIGMVGVVILIGIVLFPAIKI.FAISLMYKVATAILQP..V.G.DGPVI...ECLDIIGRHILYLFAA..LLL..VT..F..MFFFTIVILIIS-s...........
A0A1M6KKV5_9CLOT/61-383              ......................................................l-NAKEFVTEYMKKGQSSLSVDM.VIKSCKVYLLKEVKLTLKLMIGVLVIGVISALLKNLQTAFS.N.EAI.S...SIAYYACFAVLILLLSKSFMISITLARDTITKLTDFMAVLLPVLVLLLTTAG........GVTSAVTLDPVVVAAVGLTPRIYID........FLIPLISLTF...VLQFVSNLT.G..ENKITNLCKLLKQIALWSQGIVITIFIGILTVRSITTNTIDAVTLKTTKFAVDNFIPLVGKAFSDAITTVASYSLLMKNAISSVGLIFVCIIVLYPIIKI.IIIIFTYKLTAALIEP..I.S.EKGIV...SSIVGAADSLVILLSC..VFS..IS..I..MFFVMVAMLASS-g...........
A0A0H3E3W9_BACA1/78-398              ..................................................sqkgs-----LLEF-MN-GEKSFSPQE.WLKALFSYLFHEVLANGKLLGTLILLTIFCVILQMLQNAFQ.Q.STV.S...KVAYSIVYMVLIILALNSFHVAITYASEAIQTMTSFILALIPMLLALMASSG........GAVSAAFFHPVILFLMNTSGLLIQN........IVMPLIFLSA...ILSIVSTMT.D..QYKVTQLAGLLRKIAIGALAVFLTIFLGVISVQGTSAAVTDGITLRTAKFITGNFIPVLGRMFTDATDTVISASLLLKNTVGIIGVAILICIAAFPAIKV.LSLAFIYKLAAAILQP..L.G.GGPVI...TCLDVISRSVLYIFAA..LAI..VS..L..MFFLSITVIITAG............
A0A1M4N591_9CLOT/56-378              ......................................................l-DVREFVDSFIQTGDGGISNED.IYKVLLTYLFKELAASSKLMIIVVVIAVVAALLHNLQTAFS.K.EGL.S...NIAYFACYSVLIIVVSNSFIVGLNLAKETIQQMTDFMTALVPVLIMLVASVG........GVTEAAVMNPIIVSGVIIAARIYAT........VIIPLILIGF...IMQFVNNIS.D..DYKISKLTKLINQWALWIQGIIMTIFIAILTIRGITATTIDQVTVKTAKFAVDNFVPIVGKCLSDAISSVAGYSILLKNSLSALGLIIIILIMALPILKV.FILAMMYKFTAAMIEP..I.S.DKKFV...NCVTNAGDSLILIASC..LVS..VS..V..IFFIMISILASAG............
A0A1H3CSE1_9FIRM/66-386              ......................................................i-DMKENIISMIK-GEKKFDLNE.IINGIVKTIFNEINNNLNLIVQILIITIACSLLTNLQSAFE.K.DTV.S...QLAQYTCYILLVMQIMNSFNLALELGKNTVINMVNFMQILLPILLTLLTAIG........SLSTRTIFHPVLVAIVNVIGILIKN........LVFPLIFFTF...IISVISNIS.Q..KVQFSKLSQLMRQIIIVLISASFTVFIGIITMYGL-GANIDGVTIRTAKFAVDNFIPIIGKFLSDAMEVVVGSSLILKNGIGIIGLASLFLICIIPALKI.IIIIFIYKIAAAFVEP..I.S.SINIS...NFYTEVANSLLLILIG..MLS..VA..V..MFFITITVIVEA-g...........
A0A1M6S3S8_9BACL/77-395              ...........................................qgtsllravfdg----------------GFHPSH.LLAGLSKYFLDAVLDHARLVGGILILAVLASVLETMQTAFE.Q.KAV.S...QIAYAVIFLVLLVLAIGSFTEAVGTAKHAIETMDHFMLATIPLAVALLAASG........SVATAAFFQPMMLFVVHLITNVVFF........LIFPLIFFSA...ILDVTSSLS.T..RYSLTRLAALLRMTGLAMLSLCMTTFLGVVTVRGIGKGIVDGVTLRAVKYSVGTFVPVIGKAVADASETVLSASLLVKNAVGMTGLLLIALIAIFPALKL.LAMAFIYSGSAALMQP..L.G.ESAIL...DCLATLAKSLLLVFGC..VLA..VA..L..MFFLAICILLAS-a...........
A0A0C1U246_9CLOT/55-377              ......................................................m-NPKEFVKNYIKNGDSGLSMKE.LFKYFSTYAFKEVLVAFKLVGSLIIVAIVCALLNNLQNAFS.N.ESL.T...SIAYFACYSVMIILIVKGFYIGVTLARDAIMEMSNFIAALFPILMMLLASVG........GFVEATLMDPIIMGISSVGARFYAT........VLIPVICMSF...VLEFVNNIS.D..DYKVNNLSNLLRKSALWIQGIFMTVFIAIITIRSIAAKSLDLVTMKTAKFAVDSFIPVVGKTLSDAISTVAGYTVLLKNAISSIGLIVIIVIMLLPIIKI.LIMAFIYKLTAALIEP..I.S.DKKVV...SVIDSAGNSLIMINSC..IIS..VS..I..MFFIMITIVAST-g...........
A0A1Y4WEY5_9FIRM/1-256               .....................................................vd----------------------.-----------------------------------------.-.---.-...-VVSIVGALAVAAVAAADANTLIGLGREALDNMSTFSKLLLPTVTAAAAAAG........SPGGAVARQLATMLFSDVLITLITQ........LLLPLVYAYI...AACVAHAAV.G..NEGLKRIAGTLKWLVTAVLTTVLVVFVGYLTVSGVIAGTTDAVTVKAAKFTMSSLVPVVGGILSDAAETVLAGAGILKNAVGVFGMLAVLAMCVGPFLQL.GIHYLAYKAAAALSAT..V.S.GGRVA...GLIDQLGGAFGLVLGM..TGS..CA..L..LLLISLVS-----aitav.......
A0A1Y3SME9_9FIRM/50-361              ................................................dltagld---------------VDESISQ.ILDTGSAELGGVIRKALRSGALLVAVVLLCSLAEGMG---A.G.KGP.V...DAAALVGALAVTAVAAADANSLIGMGRQAIEHMESFSKLLLPAVTAAASAAG........NPGGAVARQLATMLFSDLLITLINR........VLLPLVYTYI...AACVAWAAV.G..NEGLKRMAATLKWAVTTVLTGVLILFVTYLTISGVIAGTTDALTVKAAKFTMSSMVPVVGGILSDAAETVLAGAGVLKNTVGVFGMLVVIGICLIPFFQL.GFHYLTYKVASALSAA..L.S.GSRVA...ALIDQIGGAFGLVLGM..TGS..CA..L..LLLISMITAVS--vt..........
A0A1T4LID6_9FIRM/61-375              ...............................................ldfsydsi---------------TKLSLND.IVELIKSLLSKKAELPIKSSVTVLVFILLSALLQSLKNDSD.-.NSL.N...TIYSTATAIFISTVILVKLTTTVSMASMAISVASDFVYAFIPVFCSIVVASG........GITTGFSTNTTLLVLSQALSFISSN........VFMPIVNCYL...ALGVTSSLR.Y..ELNLDKLLTSLKRIITTCISFLSGVFVSILSVKTAVAGRADMLGLRSVRFAINSVVPVIGSSISEGLLSIQAYSSLIKSSVGVVGVIAVALVFLPSIVEV.VLWRISLTVCAIVSDV..F.G.DKSVS...AVLNAFLNTLLLMNVI..LIL..SM..V..TTVISFGILIAAG............
R7FF66_9FIRM/69-383                  ...............................................sspeqvge----------------HFTLAG.VWDVLRDFCADRIQLPFQMLGGLLTVILFAALLEGMQCSTS.H.AAT.V...RVFDYVCALAAVSLLADPLFQSIAAVQTALEQGASFMTAFVPVFAGILAAGG........TAGTAVCYQTGVIALSDGVLQLICH........TLLPLCTMGF...SLAIVDAVS.P..SVSVGGLLTLSRKVTTWTLGLLMSVFLGVLSMQNLISGSTDTAAAKTTRYVLSNFVPVVGSAVSDAYATVRGSLQILRSTTGVLGIMALCLLFLPPLLQL.LLYRMVVAVGAAAAEL..F.G.TQRLL...RLLRGTQQALAIAFAL..LVC..FA..V..MFIVATAVAMTI-g...........
W7UHP5_RUMFL/48-362                  ..............................................iayssdels----------------RISFKG.FAGMISDSLGDTPFSSLKLLGKILLIIVITSVLKNAGGGMI.T.KDC.-...DIYGYICAISAVTLISEPLVAAFESVFEAVRRCGELVSVFIPVFCGITVACG........CVTSAGLYDIYVLAASEMIVWLSKS........FIMPSVSIST...MLSVTGCVS.G..EINFSGIVQLIKKVITWGMTVAMTLFTGFLTLKCTISGKADGAVTKTARFLISGSVPIVGGAVSDAYATVRSSFEIIRSTVGTAGCFVVAVIILPPLLNI.IILRAVMWTVSAAAEL..F.S.EDSMS...KLAKALDNGLAVAQSV..LIC..YG..L..MFILSTGILLNI-s...........
E4Q5X4_CALOW/45-361                  ......................................................k-DIKSYLESIVEQKRAK---LD.MVNVLKEKILGQIFSTFRQISLIIIIALLYILIASVQTGLK.N.QSV.A...NVTFLAFFFTEVLIVLQNLKDVLLDAQQTVQNACNFAEVFFPLFVSLIASMG........YPTYAAAMSPKIMFAIVFSSEFLKN........IISPFAYTYI...LLSILSNIDsG..RLGLRRVLGFCKTILMWSIVIGIVVFVAIVSVEGITNVTVDSLITKSIKYSVGNFVPFVGKILSDAADTLATSLAIVKNSLGVVGLIVLLIGIGISLLKI.LAVFVVFRVAAIFVGL..V.G.DAKLA...QFLDDYADVLILIFAI..AFA..AL..C..MFVVAF-------sss.........
F6B9Z1_DESCC/61-382                  ......................................................l-KFKELVTQLVK-GDLDWQVSD.IFTGLLKYLFKEVVANTSLLGKLVVLAVICALLQNLMGAFE.K.GTT.G...KLAYVVSYMALISLAVGTFTLAVNIGREAVDNMVQFMQALLPLLLTLLAAMG........GVASTTIFHPLIFGSISAIGTVIKN........IVFPLIFFSA...ILGILSYIT.E..KFQVSRLADLMKTVGMTVMGLCSTIFLGLLAIKGVAGSVTDGVAIRTAKFATDAFIPVVGGMFSDALDAVIGSSLLIKNAVGIAGVVIIFILTVLPMLKI.FAVAFVYKLAGALIQP..V.G.DKQMA...DCLTGLGNSLLAVFAA..VAT..VG..L..LFFFAITIVVGMG............
A0A1W5ZV05_9BACI/64-384              ..................................................ftmdn------FREYIQ-SEGSVKSSD.WFSGLLKFFFHELLVNGKLLASLLFLTLFSTLLHSVQSSFE.N.SVV.S...RIAYLVIYLVLLTLALESFRQVIGYTLDAIDRMSSFMIGLLPLLLGIMASFS........HLMSISFFHPIIVALVQSSGLLVKY........LLIPLFASSA...LLLIIGGLN.E..TYKVDQLAELLRKTGLAVMGIFLTIFLGVISVQGTVTAVQDGVTMKTARFVTGNFVPVVGRLFTDATDTILGASLVLKNTLGIAGVVILLGIAIFPALKV.FAIAIIYKLAAALLQP..L.G.DGPII...EAMSVVSRHIMYVFAA..LLM..VS..M..MFFLVIVIMVAAS............
R5JZC5_9CLOT/115-433                 ......................................................y-DFKTIVQGLLT-GDIS-EETG.WQEAFYELFLQEIDANKAIMLKLLLLAMITAFFTNLGGAFG.K.SMI.G...ENGFYVTYLLMTALLLYSFSIVFQLAQDTVEELRKIMETLIPVYIMAVSITS........GITSSVVLQEGMVLGLTAVSYGIQR........IIFPFAELFV...VLGLVNNLM.E..EDYFSRFGDLIKTWIRWMLKGILAAVVGVNTVKGMLAPAADSVTATALQRGLAI-IPG-GQAVNTVSGVMIGSGILIKNAIGVGGMLVLIMAVSMPILKM.SVFVLGYKLTGALLQP..I.A.DKRML...RGIESVSEGGRILIST..VLT..VI..A..LFLLSIAIIAVST............
A0A089L173_9BACL/78-398              ....................................................qtp----SLMDMLLP-GEDGLSFAG.VLSGLGRFMWHEVLYNGKLLVTIVMISVLSMILETLQTAFE.R.KTV.S...KIAYMLCYMVVLVIAVNSFNIAIGYAKDAIDRMIDFMMAMIPLLFALLASMG........NIVTVSVTHPLIVFMIHTVGTLIHT........IVFPLLFFSA...VLHLVSAMS.D..KYKLTQLANLLRNIGAGLLGVLLTVFLGVISVKGITSSVTDGVTIRAAKYITGNFVPVIGKMFADATDTVISASLLVKNAIGLSGVIIILFLCAFPAIKI.LILALIYNVAAAVMQP..L.G.ETPIV...SCLQTIGKSMIYVFAA..LAA..VS..L..MFFLAVTIMLTAG............
A0A162MGU4_9FIRM/63-383              ..................................................fdinf------ILDFIR-GKNRFDVKN.FFISLFEYFFKEIKANYALLAKLIAMAVVFAVLKNMELNFE.N.NNI.S...NLAHSVVYMVLIIIAVQSFYVAISAGKNAIDRMVAFVQSLVPVMMSLLLAVG........GKVSNAVLHPYIFAAITASSTWIKD........IILPIVLLIA...ILNIVNNIS.D..SFHVSQLATLMKQIMILLIGIFLCVFLGTIVVTGAAASAVDGIFIRTMKFASKNLIPIVGGVFADTVDAVIGCSLIIKNALSLVGLIVVIVITAFPVIKI.FSIIFIYRIAAAVIQP..L.G.EKSLV...KSLEDIANSLVLVIIC..VAS..VS..I..MFFIAITVILSAG............
C8W104_DESAS/69-390                  .......................................................FNFKETVIKLFN-GKLDWKASE.LFNKLLKYMFREVVGNLSLLGKLIVLAIICAVLRNLIDAFD.K.GTT.G...LLAYGVSYMVLITLAVASFGLVVNTGRQAIENMVIFMQALLPILLTLLTAMG........GITTAAVTQPVILASISVIGTLIKN........IVFPLIFFAA...VLSIVSNLS.E..KFQISKLAGLMKTSGMLLMGMFSTIFLGILAIQGVAGAVSDGVALRTAKFATDAFIPVVGGMFSEALEAVVSSSMLLKNAVGIAGLIMVFILTIFPLLKI.LSVAFIYKLAAALMQP..V.D.DGQMV...ECLNGLGNSLITVFAA..VAT..VG..L..LFFFTIVIVVGVG............
A0A1H9A9Z1_9BACI/61-381              ..............................................ssqdhwlds----------VQDGS-VFTLKY.WLSGILSFFVNEWIVNGKLLGMLIFLTLLSVFLKLLIGSFE.N.ETV.S...KVSYLVIFGVLLTIAVTSFYHAVEYATNAVDAMGNFMIALLPLMLSLMAAFG........NVASVAFFQPIILVFVQVSGILISK........VVLPLFFLSA...ILNIASTIN.N..EYNVTKLANLIRQIAFIVLGAFLMLFVSIMSLQGVNAAVTDGIAIRAAKFVTSNFIPVIGRMFTDATDTVLSASVLLKNSIGIAGVVLILIITLFPVLKV.LVLGLIFKLSAALLQP..V.A.DGPII...EAIETMGKHILYILAA..LLA..VS..L..MFFFALVMLIIV-g...........
A0A0Q3TNW9_9BACI/62-382              ...................................................sqkg----DFIQF-IK-GEKKFSLQE.WFIAFAKYIFFELLSNGKILGILIMLVIFSSLLQSLQNAFE.K.STV.S...KIADNVVFLVLVVFALNSFYIATQATQDAITVMIDFLRALIPILLALIATSG........GVISVGVFHPILIFLMHTSGLLVTY........FVLPLILVST...ILSIVSIIN.D..ELKVTKLASLIRNVAVGVLGIFLTIFLGVLSVQGLTTAVSDGVAVKTAKFVTSNFIPVVGKVFADVTDTVISASLLLKNTVGIVGLVTLLAIVVFPAIKI.LVLALIYKFSAAILQP..V.G.SKNII...STIDTIGKSVTYLFVC..LSI..VS..L..MFFLSMTLIIAAG............
R5C619_9FIRM/79-398                  .......................................................FSFTEMMGKLMN-GEISLDGDT.IVVFLREIFIEQFAREKTILLQIFLLVLIAAVFSNFTSMFE.N.GQI.G...EISFYVIYLLLFVLLMESFQNMSSQLEDSLRAVVTFMQGLAPAYFLAVAASN........GATTAAVFYEMVLLLVWLIQWLMIT........FVLPAADLCV...LLNMVNHLS.K..EDLLSKLADLLRTLVDWSLKTMLGVVAGMQIVQSLVAPVIDSLKRSAIGKTASA-LPGVGNAFNAVTEIVVTAAVLVRNCLGVTFVIILLIWGLTPIIQY.GLMSLTYRLMSALTQP..V.S.DPRMV...GCLSIMGDGCALLLRI..LLT..TQ..V..LCMVTVVILAV--t...........
A0A161XHR5_9CLOT/59-381              .......................................................IDIKTYVKDFMKTGDGKISTKK.LINAVGIYAVKELAASIKLLALLVIIALICSLLTNLQKAFS.N.ESL.S...NIAYFACYSLLIIIMAKSFYIGVDIARSTIKEMTDFMTALVPILIMLIASVG........GFVEAAVMDPIVIGAITISAKIFMD........VIIPIICMAF...VLQFVNNMS.S..EYKINKLTKLLNQIALWMQGIIMTVFIGIITIRGITAKTIDQVTAKTAKFAVDNFVPIVGKSLSDAISAVAGYSILLKNALSSFGLIAIIVIMLFPIIKL.FIMSFLYKLTAALIEP..I.S.DGRLV...NCINSAGESIVLVASC..LIC..VS..V..MFFLMIAIIASAG............
A0A1Y4NVH9_9FIRM/69-389              ......................................................l-SFGEVVSALVS-GDLQEAGSM.FLGFLSDQVSYGFRYNRHNLVYILLVALAAAVFTNFAGAFQ.S.RQL.S...DISFYVLYMLLITFCLTAFQTAVQEVEEQMESLVGFMRVLCPSYFLAVAFAS........GSTTSLFFYNVILFLIFVVEVVIVR........FLMPAVNIYI...MIQVLGNLT.G..EDFLSEFASLVKKVVTWSLKSLLACVIGINVVQSLLAPAIDALKRSALTRTAEA-LPWVGNALGGVTEVVLGTAVLIKNGIGMAGAVIAVVICAVPILQM.AILALLYKLAAALVQP..V.S.DKRIT...GCISGVSEGYELLMRL..VFS..TG..L..LFLLTIAVVAAST............
A0A0Q3WRV2_BRECH/59-377              ...................................................spgf------IQLLMQ--QGDFSFSG.VLKGMGKFVFHEILMNGKLLSSIIIITVFAMILETMQNAFE.R.NAV.S...TVAYSIAYLVLMVLAINSFHLAISYAKEAITDMSDFMLAMIPLVIALLASMG........NLATATMFHPLIIFMINISGMMISY........VVFPMLFLSA...MLSIVSLFS.E..RYKVTQLATLLRNIAMGVLGSFLTIFLAVISIQGATSAVTDGVTLRTAKYITGNFIPIVGRVFSDAADTVLSASLLVKNAVGLAGVVILIILCAFPALKI.LVLALIYNLSSAVLQP..L.G.NSPII...SALGTIGKSLLFVFAA..LAT..VG..L..MFFLAITIIIAAG............
A0A0K9H6Z0_9BACI/77-395              ...................................................rqpl-------TDLFKEGQ-AFSFST.WAKGLLSFVFHELYANGKLLGTLILLTVFSVFLQILQNAFE.Q.GTV.G...KTAYSVVLIVLLILALNSFRLAMEYATEAVDQMIQFLLALMPILLALLASTG........GAISATVFHPFLLFLMNISGLVIQK........VVLPLLFFST...LLSVVSLFS.T..HYKATKLADLLRHWSVGLLSAFMAIYLAIVSIQGSAAAVADGLAIRTAKFFAGNFIPVVGKMFTEAADTVMSASLLLKNTIGIAGAGILLLIVAFPALKI.FALVLVYKIAGAILQP..L.G.DETIT...ECLEIIGKNMTYVFAA..LVI..VS..F..MFLLSIVILVAA-s...........
R5HVZ3_9FIRM/94-414                  .......................................................FSMETALKNMIS-GETVFSKEA.VQSFLRSLFFDRLEQERANFMRILLLVLAAALFSNFAAVFE.N.GQI.G...DVSFYMIYLLLFTILMNSYQSLGISMGKQLDWLTQFMKGLAPAYFVAVSAAS........GALTATAFYQGVLLLVWLVEWLLLT........LILPGANLYV...LLCLVNHLS.K..EDMLSKMAELLETLISWSLKTMLGAVLGLQAVRGLVAPAMDAIKRTAIGKTAGA-IPAVGNAVNVVTELILTGALLVKNCLGAVAVVALLLAGAGPVIHY.GVLSLSYRFLAAAAQP..V.S.DKRIV...GCLGTMGEGCAMLLRI..MIT..AE..V..MCILTFVILMAS-v...........
U2RS47_9FIRM/2-248                   ....................................................als----------------------.-----------------------------------------.-.---.-...----------ITLASAGSLDSLMGLGSRTIGELADFSQALLPTLAAATAASG........AVTTATVQQVSTVFFVDLLLRLIRQ........LLLPLVYLYI...GLLTAAACL.P..ENRLGAIAEALKKLVTWILTTALLVFTIYLSIVRIISGSADSATVKVAKAAISGVVPVVGGIIADASETVLAGAGMLKNTIGVFGMLAILAACAYPFLQL.GVQYLLYKLTAYLASV..V.G.APGLC...KLIDGLGGAFGLILGM..TGG..CA..L..LLLISVLAS----vga.........
A0A1H9YPL4_9CLOT/62-383              ......................................................i-EIKSFITSLLK-GESTISFND.ILNGSLRFLFREVIANWKLLAQIIVLASICAILKTLQSAFE.N.EVV.G...RLAYNVCYLVIVSITIKSFLIAINIGKDTIDLMVGFMQVLLPVLLAMLMALG........GITTSVFLHPILLGAIGFIGTIIKT........IILPLILFSA...VLAIVNNLS.S..KIQVTRLSALLKQTAAVMLGFILTAFVGLISIQGITAATVDGVTIRTAKFAVDKFIPIVGSFLSDAMDTVIGCSLLLKNAVGAIGLISIFILCLIPMIKI.LALIIIYKLCAAVIEP..I.S.ENGLV...ECLNSMSTSLILLFAT..VSS..VA..I..MFFITITIIISTG............
R7K6M6_9FIRM/70-390                  ....................................................sfl----KKIKKILG-GEMDTTAAS.YLGFLGDVFLGEFNKVLPSLLSVAAICILSGLINRTKTTLL.S.DST.G...ELINFVCYGVIILLVLSGIWELLDSTKVTVLRIKQLTNVAMPILLAMMSATG........AAVGTKVYQPSVALLSSGITEIIAN........IILPMFIFTV...VFSVISNLS.K..NIRLDKLSDFFKKTSVWIVGISFTVFTGFLTVQGLTSSTIDGVSIRAAKFATKNYIPILGGYLADGFDLILASSVLIKNSLGVVVLILLVITIMAPVLKI.VVFNLALSFVTAIVEP..I.A.GDRIV...GFLSGVGKNLTILLVS..ILA..VA..F..MLFILIMLIIFS-a...........
A0A1H8EEX9_9BACL/94-414              ..................................................evpsf------AEMVMP-GGEGLKLTT.VLSGLLRYVLHEILYNGKLLVTIVILTVFSMMLETMQTAFE.R.NTV.S...KVAYSITYMVMIVLAVNSFNVAIGYAKDAITGMIQFMLAMVPLLLTLLATMG........SVVTVSVLHPLIIFMINAVGSIIYT........VVFPLLFFSA...VLHIASAVS.D..KFKVTQLANVLRSFSVGLMGIMLTVFLGVISVQGATGSITDGVTMRTAKFITGNFVPVIGRTFSDAADTVMSASLLVKNAVGIAGVVIILFLCAFPAVKI.MTLALIYNVSAAIMQP..L.G.DSPIV...TCLQTIGKTLVYVFAA..LAA..VG..L..MFFLAITIVLTAG............
R6WI50_9FIRM/74-394                  ......................................................l-DFKETVTELIS-GDTKATASL.LNRMVRDQVFYAFRSARKNLIQIILLALIAAVLNQFSSVFQ.N.RQI.A...EISFYAMYLLLLALCLNTFGAVMDWVRDGIENLTSFMGAFCPLYFLAVSIAR........GSVTASAFYQAVLFLIYLVEMIIGK........IVLPSIHIYI...MVKVLNFLS.E..EKYLNRLSELLEIAIAWILKTVLALVVGLNIVQGLISPAVDMVKRSTLTRSAEA-IPGIGDAIGGVTEVVLGTAVLVKNGIGMTGAIICVSLCLIPIVEI.GCIVLMYKLAAALLEP..V.S.NERVI...GCIESVSEGGRLLIKV..VFT..VG..L..LFLVTIVIVSAVT............
A0A269W695_9BACL/57-376              ....................................................tps-----LMDMLLP-GGDGLSFTS.VLSGLGKYMWHEVLFNGKLLVSIVMLSIMSMILEQLQSAFE.K.NTV.S...RVAYAICYMVVLILAVNSFSVAIGYAKGAISSMVDFMLAMLPLLFALMASMG........NVVTVSVAHPLVIFMVHTVGTLIST........IVFPLLFFSA...MLHLVSSLS.D..KYKLTQLGNLLRGVGMGVLGVLLTVFLGVISVQGISGSITDGVVIRAAKYVTGNFVPVVGKMFADATDTVISASLLVKNSIGLAGVIIILFLCAFPAIKI.LILALIYNVSAAIMQP..L.G.DTPIV...TCLQTIGKTMLYVFAA..LAA..VS..M..MFFLAITIMLTAG............
A0A143XPI9_9FIRM/78-397              ......................................................d--FSAIFDALLD-FRFVDALEE.AGVWLVETLTYEISTSWVLMGELIGVILFAAVFNNISSSFR.Q.FAI.G...DSGFLISYFITFTIIFANFTIMANLFEHTVETLSKLLKMVIPVYTLAVTLSG........NLSVGVVFYEYFVIVVLVVNWICLT........VILPMIQYYL...LLELLNNFS.A..RQNISRLCESLYLLLSKSMKFLFVLFFGFHLLETMVVPSFDATKNAVFNRIVGM-IPGAGSVVQSVAGTVVGSSIMIKNTMGATAIIFILLLLAIPIIKL.LLYCLFYLLLSILLEP..V.A.DERFI...RCISAAQKSGILLVYT..LGI..TA..A..LFILTIAVTSLA-t...........
G5IBT0_9CLOT/96-416                  ......................................................l-SFQEVMKDLMA-GHLVQVFEK.FLGAIKNTLFAEIHNGGVLMGQIIILGIFGAVFTNFSSVFN.G.SQI.S...ETGFFVTYLLLFTFLTTSFFQSITIASDVVGKILDFMKVLMPTFFMAVAFAG........GSVSSVAMYEFTLWIITAAQWLIGS........GLIPLVRVYM...ILVLASHIS.K..EEIISNLTELLEQIIGWGLKTLIGVVLGFHVIQGLVLPYVDSVKNSAVQKLIGL-IPGIGQGASAVTQMILGSGVLIKNTMGMAAVIILLVIVAVPVMKL.AVLMVLYRCVAAVLEP..V.C.DKRLV...SCVSAAAKGHKLLLNM..VMA..AA..L..LLIITVAVVCA--gt..........
A0A173XL95_CLOVE/69-392              ......................................................l-NPKEYIASYLTSKEDPISFKT.IGNSIISFLFREIKATMSLVVSILVISLLSALLKNIQDAFS.NdDGI.T...SIAFFACYAVLIMLLSKSFLISLDVAKEVFKNIVEFMNVLVPVLIFLISSAG........GITSALTIDPIVLAAISITPRIYTN........FIFPLILIYL...ALLFANNIS.K..EFSIASLCKFLKQTIMLCQGFILMIFVTILGIRGMTANTLDAVTKKSIKFAMDNFIPVVGKAFSDAISTLAACSLAMKSVISTLGVLILILIAVYPIIKI.FIVSISLKLTGAILEP..V.V.DSKIS...SSVSMVGEALTLVMSC..VIC..IS..I..MFFIMISMMASSG............
A0A0N0CWM4_9BACI/1-297               .....................................................mq----------------------.--EQILAFLVDPFFLLLKMTLMLCSYVIIILIVNMILPAFE.K.G-T.R...ILFFLIVLATIGPVVVNAFT----LIDEIAQGLAHLFTAFYPILTSSFLLSS........SITAIASWQPFLLFFVQVLTIISSK........WLIPGVLFAI...VFDVCSVIV.K..EISFTRIAELIRFTIMSIVSASVICYVLLMTASGVAAFSVNAAVAEPVKKLIEENIPVVGSFIVDSFSMFQHMTQFTSSLTSISAFIAVITVSFIPTVQL.IVSAYSLKMLAAILEP..I.A.FDDIC...RLLDQVSKSLFTLCAV..SFL..IAfsF..MFSCFFLIV----fvq.........
D4LX77_9FIRM/98-418                  .......................................................FSLTDTLVS-LTRGEKIFSEKD.LQGIFYRLFFGQIEKQKGLYIRILLLILLAAVFSNFAAVFD.N.GQI.G...DTCFYVVYLLLFMVCMDSFSGMSRALQNVLSWMAEFMRVLAPAYFLTVSVSA........GTTSAAVFYEGVLLLVWLVQSLLLG........ILLPGVGMYV...LLSLINHLS.K..EEMLDRMAELLKTVVNWGLKTMLGAVVGLQVVRNLVAPVIDTLKRSMVGRAAGA-LPGIGNAVNMVTELVLTSAVLVRNCLGVVILLAFVAVGVGPVIHY.GLQSLVYRFLAAVAQP..V.S.DKRIV...ESLATMGEGCAMLLKV..LFT..AE..V..LCMLDFVILMT--sv..........
R6QS98_9CLOT/68-388                  ......................................................t-DFQDLIKKMLS-GQTEPSLQV.IGEMISDQFFYEWKSSKAGMVHILLIVIVAAVFTNFSNVFQ.N.KQI.S...EISFYVLYLLLITIGLNSFRILIVSAGENLERLIGFMKVLGPVYFLAVAFAA........GSSTSILFYNLVLLLIYLVELVILN........FLIPFVQVYI...VVKVMNNLS.E..EDYLSKFAELCETVIAWTLKTLLAGVTGVNIIQGLLSPAIDSLKRSVVGRSAEA-IPVVGDAIGGVTEVMLGTAVLIKNGIGVAGALVCIGICLVPIIQM.AVVTLLYKLIAAMIQP..V.S.DKRIV...GCISSIADGSQMLLRI..IFT..TG..V..LFLLTIAVVTATT............
H6NL74_9BACL/89-407                  ..................................................apsfm--------DLLL-GAKDISFPG.LLQGLLKYLFHELLYNGKLLVSIVILTIFSMLLETLQSSFE.K.NAV.S...KIAFAISFLVLMIMAVNSFSVAIGYAKEAIGDMIHFMIAVVPILLTLLASMG........NVVSVSVLHPLIVFMVHAVGTVIYF........IVFPLLFFSA...VLHIVSALS.D..KYKVTQLANLLRTISLACLGIFVTVFLGVVSVQGATGSVADGVTIRTAKYIAGNFVPVVGRLFSDASETVIGASLLVKNAVGLAGVVIILVICAFPAIKI.IVLALIYNVAAAIMQP..L.G.DNPMI...SCLETIGKSLIYVFAA..LAV..VG..L..MFFLAISIMIAAG............
A0A0K0GEX3_9FIRM/52-371              .....................................................ek----TTVYEFIK-NQDSLSIKG.VLLGLIKYLFYEIILNGKLLGTLLLLTLFSILLQTMHTAFE.S.SAV.S...KIAYFVVYIVLIFLALNSFYVAVSYVEDAIGMMSSFMIGLLPLILGLMATFG........NIISVSFFHPIIIFLINVSSILVSS........FILPLLFLSA...ILTIVNNIS.D..NYKVSHLANLFKTVSMGVLGIFLTIFLGVISVQGTASAIQDGVAMKTAKFVTGNFIPVVGRTFTDATDTILSASLLLKNAVGIVGLIIVLFIVLFPALKV.AAIAIIYKIAAAVLQP..I.G.DGPVI...TTLNTISNYILFVLAC..LLS..IS..I..MFFLAIVIIVVA-s...........
K0B183_CLOA9/66-387                  ....................................................mnl---KEDILSMVK-GEDSMDIKL.LTKGLLKYLFKEIVLNWGILTKVLFLSIICSILTNMQGAFE.G.KTI.G...ELSFYVCYLILVAMSINSLMVIIKVANEAIGSMVFLMQALLPILITLLLAIG........GITSSSLFQPIILGSISVVSTLMKD........VILPLIILST...IIGVISNIS.S..KVQITKLSGFLRRSILYVIGISITLFMGVMSIRGAVGSKLDGLTIRTAKFAVDKFVPVVGRFLSDTMETVVGCSMLIKNAVGIFGLIALFIITIVPIIKI.ISLILIYKFTIVIIEP..I.A.NERIV...NCLTDISKSLTLVLAT..VAI..VG..V..LFFMAVTIVIGAG............
V2YG61_9FIRM/46-350                  ............................................ldaglsgllad----------------------.----AAGQIGGLFRTGLSTAMKLIIVVLLCSLAHSVKA--G.E.DGG.L...QAVTVAGALAITALTMTDMAVMIGLGRDTLGRMGDFSSVLLPAMAVLTAATG........GVTAAAVRQGATVLFSQLLITAMDR........LLVPLVYAYV...AVSCAYAAV.G..NPGLKRVAGLLKGAITFFLTALLLAFVGYLTASGAIAGSVDAAAVKAARMAISRAIPVVGGILADASESVLAGAGALRGAVGAAGMLAVLAICLTPFLRL.ALQYLVYKGASALCAT..V.A.QPQLS...GLIDAIGSAFGLVLGM..TGA..GA..L..VLLVGIV------savka.......
A0A1I5EYX1_9FIRM/83-403              .......................................................INFEEYVSNLVS-GKTKFSLNQ.ISVDIKNGIVNELKGNIGTLTSLLSVAIIAAVFTNFSHAFQ.N.SQV.A...ETGFYVAYLLLFSVLTASFISAANLAAATISKVLNFMTVLVPTYFITVAFTS........SASTSMVYYQATLFLITFVDALLIK........VVIPSINIYL...ITSMANNLS.K..EDLLSKLSELMAVVIKWVLRTLLAVVLGFNAVQGLILPVADNLKKSVFMKAAGA-IPGVGDILGGVTESILGAGILLKNSVGIVGVIIIIIVCAVPIFKL.AATTLIYKISCASVQP..I.S.DKRML...NCINSSAEASALLLET..VFV..GA..V..LFLLTIAMVAAST............
A0A1T4S9B0_9FIRM/55-376              .......................................................INFRNLLES-LKRGEWSLGVGQ.VLSGLLSFFSRQLLANLKLLGQLLVLGVLLGLTRTVADSLE.N.KGV.A...ETAAAIIYLVVFTIVLKTFAVTAGVAIDGVKEMTRFIQILAPVLLTLVVLTG........SFLGSSFFSTMLVGAATLTATLMEF........VVIPLIGLAA...LLGLVNEVT.G..KVQVSKLAGLLRTGAVFAIGLLMTVVLGIISVQGVGSGVADGVALRTAKFATDALVPVVGGMLSDAVETVVSGAVLMKSAVGLTGLVIIALLAVLPALKI.LAVTFTLKLAAALLQP..L.S.AGKLA...DALEQVDTSLTLMFGA..VAI..TG..L..MFFLMISGLIAA-s...........
A0A0M0EXZ4_9BACI/75-395              ..................................................sqkgs------FMDFVS-GDKKFSFDQ.WIKGMIKFVFHELLVNGKLLGSLILLTVFSMFLQTLQNAFE.Q.SSV.S...KVAYAIVYMVLIILALNSFHVAIEYTKDTIDLMISFLMALIPLLLALIAASG........GLVSAAFFHPVLMFLMNTSGILIQY........IVLPLLFFAA...ILSIVSTLT.E..HYKVTQLAQLLRNFAIGILGAFMTIFLGVISVQGASSAVADGVTIRTAKFVTGNFIPVIGRMFTDATDTVISASVLLKNTVGLSGVIILLLITTFPAIKI.LMISFVYKLAASLLQP..L.G.GGPVI...KCLDIISKSMIYIFAA..LAI..VS..L..MFFLSITVIIASG............
A0A1H8NLJ0_9BACI/64-382              ....................................................rls------VKEMIT-NSSGLSITS.LFRAFFELTAHELMASSKLLGQLIVISLISAFLKNMQASFQ.S.ESV.S...TVANLVLIILLTTLAIQSFTVVGALITDVVSQIHSFVLALLPLLLGLMAMMG........GILSASFFHPVIITFLNITVVITDK........VVLPLIYFSL...LLHLVSLLN.K..TFQLTKLADLLRQVALGLLVICLSVFLTVLSAQGAISSVQDGLTVKTTQFVTNNFIPVVGRMFSEATDTIFATTQILKNGLGVFGFIFILLMVAVPIIKV.AIIGLSYKLVAAILQP..I.G.EVQIV...KSATAISEHIFYLLAA..LLV..VS..F..MFVMTIVILLVA-s...........
A0A143ZV49_9FIRM/73-384              ...............................................pdsllglt-------------------TDS.VATTLTDTVKESAKGPLKSAAAVAGIILLCALLEGFKISFG.E.RPL.A...GVFGAVAALSVGVAIILPVLEVIQKAGEAVRASSTFMLSFIPVFAGITTAAG........QPVTASLYQGLLFGVAQVVSSAANT........IVVPLLSLFL...AFSLVSAVA.P..NLNLSATAGSIQKVASWVLGLVMTIFVGILSIQGVVGNASDGVAIKAAKFFSGSFIPVVGSALGDALGAVQGCVGLLKSTVGSFGILAVIVIFVPPLIQA.LIWQFILNIGAAFSDL..F.D.LKQIS...AMLRSTAKVLNLLIAV..MLC..CS..L..LLIISTTILLAL-g...........
R8W3H6_9CLOT/49-366                  ...........................almdgvtlddgvgqaaaqlldnlegsgr----------------------.----------TAWTAALTSLGKLLVVAVICGILQSARAAAG.G.SDL.-...PIVTMAGALGMTGVFLSDLSGMMTLCEDTLHEVSTFSKAMLPVMAGAISATG........APTTATVLQGVTMFSFDLLVRFLTG........LLLPGVGVYI...GVVTVNTAI.G..GGLLGQLAGFIKWVITGSMKLTLTVFIAYLTISGVIGGSADALAVKTAKFAVSGSVPVVGGIISDAAESMLAGAMLIRNTVGVIGMLCIAAICLIPFLKV.GCNYLLFKAGAAVLTP..V.C.GSALS...GLVAGLSDSMGLMLGM..LGT..CS..A..ILFFE--------lvfsitlv....
A0A1M4VIX5_9CLOT/91-410              .......................................................FDLGTAMERLMN-GEQIFTKEN.FREVIQQVLLTSFSVEKETMVHVLLLVLLAALFTNFSNVFE.N.GQI.G...EISFYMIYMLLLAVLIHSFGTLSSQVHDTLTGLTTFMKALAPAYFLAITVST........GAGTAMMFYEMVLILIYLVQVLLLT........VILPGINVFV...LLELVNYLH.S..EDFLSKMAELMKTLIEWTLRTCLAVVVGLQVVQNMVTPALDSLKRTFLGKTASA-IPGIGNAVDAVTEVVLGTSVLVRNCLGVVAIIVLVILGLSPLIKM.GFTTILYKFLAALTQP..I.S.DKRMV...GCLSTIGEGCALLLRV..LLT..VE..V..LFMITIAILAT--s...........
A0A1Y4B485_9FIRM/94-414              .......................................................ISFTEVVSTLMS-GDMTETIRI.FLRFLADQVSYEFEYNRRNLAYVLLAALTAAVFSNFAGAFK.S.RQI.S...DISFYIVYMLLITLCLTSFQTSAAGLEEKLGSLVDFMRVLCPSYFLAVAFAS........GSVTSLFFYNVILFLIYVVELVIVR........FLLPVINIYI...MVCVLGNLT.G..EDVLSEFADLIKKAVTWILKTLLICVVSVNIVQGLLAPAIDAVKRSALTRTAEA-LPWVGNAVGGAAEVVLGTAVLIKNGIGMAGAVIAVVICAVPIIQM.LIMALLYKLAAALVQP..V.S.DKRIT...TCISSVSEGYEIMARV..IFT..TG..L..LFMLTIAIVAAST............
A0A1I2VHM8_9BACL/72-392              ....................................................ete----SSFKNFVQ-SNKQGFFKQ.LIDGIVHYFFHELVVSSKLLGTLILLTVFSTLLQTIQSAFE.H.KAV.S...KVAYIVVTLVLIILLLNSFRLAIDYTNDTVGAMSNFLVALIPLIFALTAATG........GLASVAFFHPLVIFLVNASGWLISS........FVLPLLLMSA...LLAIVSTLS.D..HYKLTKLSDLMKNIALFTLAGFFAVFLGVISVQGAATSISDGLMVKSAKFFTGNFIPVVGRMFTEAADTVMGASVLLKNTIGIAGLLLLLCITIFPLLKI.LSLAFIYNLAAAVLQP..L.G.SGPVI...DCLVIMAKSIFYLFAS..LAV..VS..L..MFFLAITIIIASG............
A0A151B718_9CLOT/63-385              .......................................................FDAKTYIENFIQTGESGVTFSK.VIKYLSKYLFIEIGSTIKFIGILIIISIICVLLNNLQNILS.D.GEI.T...NIAYFACYSMIIIILAKSFYIGIDLAKSTIITLTNFMAALMPVLMMLLASVG........GFTQAASMDPIIIGVTSIGARIFVD........FVIPLAIMSF...VTVFVNNIS.S..DYKISRLSKLLNQVVLWTQGIIMTIFVGVISVRGIVSQTIDQVTLKTAKFAVDSFVPIIGKSISDAIATVAGYSLLLKSALGVLGLFLIIIIVLLPILKL.LIMAILYKLTAALLEP..I.S.DSKII...KCIDSAGDSLILIMSC..VIS..IS..I..MSFIMIAIVAST-g...........
R7F6Q4_9CLOT/56-375                  .......................................................IDIQELLNNAIK-GE--LDTNQ.LLKNIFPLLGTEIKEALKVMGSILIIVLIHSVLKSISDNLN.N.KSV.A...QITYYVQYILIATVIMTNFSSIITLTKEAVGNMISFIQLLFPLLMTLMLASG........SVVSVNLVQPIILFIINLISNIFQS........IIIPIILVGT...ALAIVSKIS.D..RIQIDKLSKFLKSSSVWVIGILLTIFVGVLSIEGTLGSSVDGITAKTAKAAVSSFIPVVGKVLGDAVDTVIGCSAILKNAIGIVGVIVVIAICITPILKL.AIITIIYHLTAALCEP..I.A.DSKIV...SLITQMADTFKILLAI..LCS..IS..V..MLIIGITLVINI-s...........
R5KK58_9CLOT/69-382                  .................................................fdyski---------------VDFSVTD.FLNAVKDTVLGSAQTPLEATALILVIILLSALFQSFKETIG.N.SGM.A...SALSTVSAITVALILIAKIRLTLSSACAAISVSADFVYAFIPTFCIIVAASG........NTVAAFSTNTLLLSLAQILNFISKN........IFIPLSNCFL...ALGICSGIR.N..ELNLGAFINNCKKYLITAISVCATAFVSVLSLKTAVAARADAIGLRSVRFAINSVVPVIGGAISEGLLSIQAYSSLIRSSVGVVGIIAVALVFLPSILEV.TFWRLFLSLCATVSQM..F.S.DSSVS...NVLKAFTDALLIMNVI..LIL..SM..V..TTIISIGILIAA-k...........
A0A098M7G0_9BACL/83-402              ....................................................tps-----LMDM-LVPGDDGLSLKS.VLSSLGAYMWHEVLYNGKLLVTIVMISVLSMILETLQTAFE.R.QTV.S...KVAYTLCYMVVLVIAVNSFNIAIGYAKDAIDRMIDFMMAMIPLLFALLASMG........NIVTVSVTHPLIVFMIHTVGTLIHT........IVFPLLFFSA...VLHLVSSMS.D..KYKLTHLANLLRNIGVGLLGILLTVFLGVISVKGITSSVTDGVTIRAAKYITGNFVPVVGKMFADATDTVISASLLVKNAIGLSGVIIILFLCAFPAIKI.LVLALIYNVAAAVMQP..L.G.ETPIV...SCLQTIGKSMIYVFAA..LAA..VS..L..MFFLAVTIMLTAG............
A0A1V4HQY0_9BACL/73-392              ..................................................kpptf-------MELLL-GTKGISLKS.IFKGLLSYVFHEIIVNGKLLASIVILTIFSMILETLQSSFE.R.NTV.S...KLGYSITYMVMIIIAINSFSVAIGYAKSAITAMIQFMIAIVPLLLTLLASMG........NVTSVAILHPLIVFMIHSVGTAIYV........FVFPLLFFSA...VLHIVSSLS.E..KYKVTQLANLLRTIALSMLGIFVTVFLGVISIQGTAGAVRDGVAIRTAKYITGNFVPVVGRLFSDATETVIGASLLVKNAIGLVGVVILIMLCAFPAIKI.IILAFIYNLSAAIMQP..L.G.DSPMI...ACLQTIGKSLIYVFAA..LAA..VS..L..MFFLALTIMITI-s...........
A0A1S6IUP5_9FIRM/61-382              ......................................................l-NFKELVLQVVK-GDVDLQVAD.IFTGLFKYLFKEVVANTSLLGKLVVLAVICAVLQNLMSAFE.K.GTT.G...KIAYAVSYLVLLTLAVGSFTLALNIGREAIDDMVQFMQALLPLLLTLLAAMG........GVASTAIFHPIIFGSITVIGTVIKV........IVFPLLFFSA...VLSILSYFS.E..RFQVSRLADLLKTVAMAVLGLCSTIFLGVFAIKGVAGSVADGVAIRTAKFATDAFIPVVGGMFSDALDAVIGSSLLIKNAVGIVGVIIIFILTIMPMLKI.FAVAFVYKLAGALIQP..V.G.DKQMA...DCLSGLGKSLLTVFAA..VAT..VG..L..LFFFAITIVVGMG............
A0A268KBB4_9BACI/72-392              .................................................sqkgsl-------YDFVK-GDKKFSFKD.WTQGVLKFLFHEFVVNGKLLGSLILLTIFSMFLQSMQNAFE.S.STI.S...KVAYSIVYMVLVIIALNSFHIVIEYTNEAIGSMISFVLALIPLLLALIASSG........GIISAAFFHPVILFLMNISGMFMQY........VILPLLFLAT...LLSIVSTMS.D..QYKVTQLAQLLRNWSIGLMGLFLTVFLGVISVQGASTAITDGVAIRTAKFVTGNFIPVIGRIFTDAADTVVSASGLLKNSVGIAGVGILLIIVAFPAIKI.LMIAFIYKFAAAILQP..L.G.GGPVI...KCLDIISKSVIYVFAA..LGI..VS..L..MFFLSITVIVAAG............
R6XRH5_9CLOT/73-392                  ......................................................g--FKKLLKRLID-GNVGVSFKD.FIGEIFSLILKGALGFLPSIITVVVISVMSGMLKGLNSGFL.N.ENT.S...EIVDFACFSAILTVIVSEAANMLTLTINTVGRVEKLSAALFPVLLTLMTALG........GASGVGFLKPLVGVFSIGLTKVVKT........FVLPCFTGAV...LLNAVGNIS.P..AVKLDKMADFFKKAGSIVLKTVFSAFFAYLLIGGVIGKTVDGVMINAARFGVKSYVPIIGGYVSDGFDVVLAGCALVKNAVGMTGLLILLSVVVAPVGKL.IAFDLILRFAAGVVEP..L.G.VSGIS...NMLTKISKCAGLLIAA..IAG..AT..F..AFFAMVL------tagts.......
C0GE39_9FIRM/58-380                  .....................................................fe--FRDVLNWFRPGQAEGLSVSE.VFQGLWRFMWREIYINLNLLGKLLFLAVVASLLKNLEKAFA.N.DSI.A...SLTQAIVYLALIVIAMQSFTVAVNLGRQTVDNMVEIILSVIPLLLVLLASLG........NFASAAIFRPLIIFAVNFFATIIRD........LAFPMIYLTT...ILSIVNHFS.P..RVTVSKLADLFRNVSVWVMGMTMTIFTGLLAVHGVASSVGDAVTIRTAKFMTGAFLPVVGGMLTDAVETVASATLILKNTVHLAGVLLLFYVVVFPLLKI.LALVFIYKLAAALIQP..L.G.ETNLS...DSLNTMGNCLALIFAA..VAI..VS..V..IFYLSITIIAGAG............
A0A1I1ZKV1_9BACI/73-393              ..................................................sqkgs------LTDFIK-GEKKFAPGE.WGKALLRYLLHEVIANGQLMGTLLLLTVFSAILKAIQNAFE.K.EAV.G...KVAYAVIFIILIVIALNSFYVAMDYVREAVSLMSHFIIALLPLLLGLLAASG........SIASAGIFHPLVIMLVQVSGIFVQN........IVLPLLFFSA...VLSIASQLN.E..HIRVTKLAELLRHVAMGSLAAFLTVFLGIISVQGTAAAVADGLTIRTAKFLAGNFIPVIGRMFTDAADTALGASILLKNTVGIAGVGILVIICAFPALKV.LAIGFIFQATAAVVQP..L.A.EEELI...DALSTLGRNVFSMFAA..LAA..VS..F..MFFLALTIIIVSG............
A0A1I4DJV8_9BACL/101-421             ...................................................sktp-----TFNELLT-GAKDFQMST.ILSGIFRYFFHELVYNGKLLASIVVLSIFSMLLETLQSSFE.K.NNV.S...KVAYAIIFMVLMIMAVNSFTVAIGYANAAISEMIHFMIAIVPLLLTLLASMG........NMVSVSVMHPLIVFMIHAVGTGIYL........IVFPLLFFSA...VLHIVSSLS.D..KYKVTQLANLLRMISVGCLGVFITVFLGVISVRGAGSAIVDGVTIRTAKYIAGNFVPVVGKMFSDASETVIGASLLVKNAVGLVGLVILLILCAFPALKI.MALALIYNLSAAVMQP..L.G.DSPII...ACLDTIGKSLIYVFAA..LAV..VG..L..MFFLAITMLIAAG............
A0A1I3PKK5_HALDA/63-382              ..................................................htnnf-------REFIE-SESSVKSSD.WFSGIIEFFFHELLVNGKLLASLLFLTLFSTLLHSVQSAFE.N.SVV.S...KIAYMVIYLVLLTLALESFHQVIDYTLGTIERMSSFMIGLIPLLLGIMASFS........HLMSISFFHPIIIALVQSSGLIVKY........LLIPLFASSA...LLLIVGSLN.D..TYKVDQLAELLRKTGMAIMGVFLTIFLGVISVQGTVTAVQDGITMKTARFVTGNFVPVVGRLFTDATDTILGASLVLKNTLGIAGVVILLGIAVFPAIKV.LAIALIYKIAAALLQP..L.G.DGPII...KAMDVISRHILYIFAA..LLM..VS..M..MFFLVIVIMVAAS............
A0A0M0KZE0_9BACI/62-382              ..................................................sqkgs-----LVDF-LK-GEKKFSFKE.WMTGFIKFFFHEVIANGKLLGTLIMLTIFSVFLQNLQNAFE.Q.KAV.S...KVAYALIYMVLIIIALNSFHIAISYTKEAIDTMIHFILALIPLLLALMTTSG........GIISAAFFHPVIIFLMNTSGLLIQY........IIMPLLFLSA...LLSIVSIIS.E..QYKVTQLAQLLRNISIGLLGIFLTVFLGVISVQGTTSAVADGITIRTAKFITGNFIPVVGRVFTDATDTVLGASLLLKNTIGIAGVGILLMIVAFPAMKV.LSIAIIYKLAAALLQP..I.G.GGPVI...TCLSVISKSVIYIFAA..LAV..VS..L..MFFLALTVIITA-s...........
R7M8A0_9CLOT/57-264                  ......................................................i-NVDKLFKSAIT-GK--VDNNT.IIKGIVHIAGKELLNCITVLGSIIVIIIIHSIIKSIGDSLE.N.KSV.A...QITYYVQYIMIVTLIMSNFSEILQMIKGSIQSLVGFMNSLVPLLITLMLATG........NFASAGILEPIILFIITFIGNFITA........ILLPFVLIST...ALAIVSKIS.N..KIQIDKLSKFFNSSVVWILGVVLTLFVGIISIEGSLSSTVDR----------------------------------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------nnge........
G7W855_DESOD/64-383                  .......................................................FSLVQIFED-LRSGELSLKPEN.LGKTLLTLLGHQVLVTAPLIGKLLVLAVLGAVLGQLQAAFG.-.GSV.G...KTAQVMTYLVLLSLAITSFREALTIASDTIEQMVGLMQTMFPVMMTLLITMG........NMTSAALFKPLIMGSLTVLATMIKT........VILPLFFLAS...VLKLFNNIS.E..QFKLSKLAGLFEFAGKLSLGVIMTVFIGVMTIQGVTGGVADSVVFRTAKYSADL-IPVAGKFFKDAVELVITSGLLLKNAVGIVALLAIVMICLGPVIKI.LAMILTFRLSSALIEP..I.G.EKPLA...DSLQDMSKSLIFILVT..VIS..VA..I..MFFMAAAVVVGTG............
A0A1I4JPL5_9BACI/68-388              ...................................................sqkg-----SLKEFIT-GEKQFAPKE.WGTAFLKYIFHEVTANGKLMGTLLILAVLSAVLKAVQNAFE.T.EVV.N...KAAYAVVFLVFIVIALNSFYLAMDYVKETVGGMVHFMIALLPLMLALLATSG........AAASSALFHPLVVFLVQSSGMLIEN........IILPLLFFSA...VLSIVSSLN.E..HIKLTKLAELLRRTAMGILAVFFTVFLGVISVQGATTAVTDGVAIRTAKFIAGNFVPVIGRVFTDAADTALGASVLLKNTVGLAGLAILFLLCAFPAIKV.LVISFIFHFTAALVQP..L.G.DGPLL...EALSVLGKTVLSMFAA..LAA..VS..F..MFFLALTLIIISG............
A0A0M2U643_9FIRM/65-386              ......................................................l-SIPKVLDD-IRHGRFSFGFGD.LLGGLGRYLFRELLTSSSLLGKIVILAVFCAVLKNLLAAFE.R.GTT.G...KLAYGVTYLVLITLALSSFTVAVNTAKGAIDQMVSFVQSLLPVLLTLMVAAG........GPTSAALVHPFVMGSLGLLSTLIRN........LVFPLIYFSV...ILIMVNQIT.E..RFQVSRLSDLFKQASMILLGLFLTIFVGALSLYGVAGAVADGVAMRTAKYLTGAFIPVVGKMLSDAVEAVVGSSLLATNAIHIVAMVGLFAMAAFPAVKI.IALVVVYKVAGALVQP..F.G.DSQMS...TALDAMGGALTMVFAA..VAA..VG..L..MFFIALSAIVGMG............
R7ETP2_9FIRM/72-385                  ..............................................msdalrras------------------SADY.LINTALGIVGGGIGDALRSFCTLVGLALAAAVLGCVRESLP.S.RGM.T...GALELAVNTAAAVAAVGTQYLRFEAVGTYFERQRMIMSSLLPLMGVLYAMGG........NSGGAVLNNSTVLLWLELINLFATA........LLMPAVAVMT...ALSLAGAFL.P..GVRTSGLSKFIGKTVGTVLGLAAVLLGTALGAQNVLTASGDKLGFRTAKFVAGSMIPVVGSTVGDSLRTLAASVGMLRSTVGVSGIVVLILLLLPTLLSL.LLSRLSFSAAAGVADM..L.G.SGELA...RFYRDMSSVYGLLIAA..AAL..SA..L..MFVFALTVFAL--ta..........
I7KA59_9CLOT/54-376                  ......................................................l-SLKKILDDYKSSGSLKLTFKD.FTKNIIGFSIKEILINYKLLIELLVIGIISALMHNLQNSFD.E.NSI.A...KIANFAIFLLITTIIIKSFTYAISIAAKAITDMVEFMNALIPSMISILIGTG........SVATATTLDPIIMFFIKFSSDIIKN........FVLPVTIIVV...AVHIVDNLS.D..DIKIGKLGDFINTINTLVLGFLMTVFIAIITVRGITANTFDEVALKSTKFAVDKLIPIVGGALSDAVATVASYSLILKDALSVFGVVMIVGICVFPLIKI.MVISLIYKFTCVVLEP..I.V.DKKIV...EGLNAASKSLTIVFAA..VLS..VA..V..MFFIMITILASAG............
A0A0H4P0Y7_9BACI/70-390              ...................................................sqtg----SLMDY-LK-GEKQFSIQA.WFSAIVKFSIQEVLKSGKLLGSLIVLTVLCALLQSLQNAFE.Q.GTV.S...KVAYAVVFMVLIVIALNSFHIAIQYSKESIERMTHFSLALIPLLLALIAASG........GAVSAAFFHPVMIFLMNTSGLFIQN........IVFPLLFLSV...VVSMVSLFS.K..EYKATQLASLLRNWSIGLLGIFMAVFLGVVSVQGTATAVTDGLAVRTAKFVTGNFVPVIGRMLTETADTVISASVLLKNTVGIAGMAIILIIAAFPAVKI.LLIALIYKVAASVLQP..I.G.AGPVI...TCLDIMSKSILYVFAA..LAI..VS..I..MFFLCITIIVTAG............
G4KPT2_OSCVS/45-356                  ..............................................saadplggg-------------------VSQ.ILQNLMGQAKSVLCQRLRNAVSILLVVLLCGAVDGFSESAG.A.-SG.P...KLVLAAGALSVTLLAAGSLESLIGMGGGTIESLNDFSRVLLPVLAAATAISG........SVTTATVQQVITVLFTGLLLKLIEG........LLLPLVYLYI...GALTAAACL.P..GGRLGSIAEALRKCITWVLCGALTVFTVYLSVAHIISGAADAAAVKMAKATVAGVVPVVGGIIAEAADTVLAGAGMLKNTIGIFGTLAVLAACAWPFLHL.GVQYLLYKLVGFLAGV..I.G.SPELC...KLIDGLGSAFGLVLGM..TGA..SA..L..LLLVSIL------ssvaav......
A0A176U881_9FIRM/72-392              .....................................................ig--FGELVKNLIH-ADRPISFSK.LLSDIASVLIGEVQENRAQAVSILLLVVCSAVLSSIASVFD.S.DQI.A...VQAWFVVFLMITASALAGFIQSCRLVTNCLNLMITFMKMLLPAFCLSMVCIT........GAASSSLYYQATFGMIGLIDAVLVY........AMIPIIKLYF...GVSILNGLT.G..EDRFAGMEELIKMLYEWSMKTLCAVIVGLQVIQGLIVPLASSAGPAFAQKLIGS-IPGIGSGIKSTAEIIIGTGTLIKNGIGMAGCIVLILVSIYPILQM.AAIVLIYYGIAAVASP..I.S.DKRMI...TALQAVSFTNRMLLKT..LCM..AS..F..LFLITIAVICAF-t...........
A0A1I0Z6N8_9BACL/107-425             ..............................................tlrelmfpk------------EGE-GWSVKD.VLLALARFFLHEVLYSGKLIVTIVLLAIFTMLLETMQSAFE.R.QAV.S...QVAYAIAYMVLLIIAVNSFRTGAGYAADAIAGMVQFMLAMVPLLLTLLASTG........GVTTVAVLHPVIVFMVHSIGTVIHL........VVFPLLFFSA...VLHLASTVS.E..RFKVTQLANLLRTASVGLLGAMLTLFLGVLSIQGATGAIADGVALRTAKFVTGNFVPVVGRMFSDAADTVLSASLLVKNAVGLAGVVILIFLCAFPAVKI.LTLALIYRLSAAVLQP..L.G.DTPIV...QCLQVIGKTLVYVFAA..LAS..VG..L..MFFLAVTIVLTAG............
R6XGP5_9CLOT/58-288                  .......................................................IDFNELFNSAIT-GN--INNKT.IINDILKILGKEIVGSVAVIGSIILIIIIHSIFKSLSEGLE.N.KTI.S...QITYYIQYILIVTLIMTNFSNILIMIKESIQNLVGFMNNLIPILITLMLTTG........NIVSANLMQPIILFIITFIGNFITT........IIIPLVLIAT...ALGIISKIS.D..KIQIDKLSKFLKSSVVWILGVILTIFVGLISVEGSLSSSVDGITAKTTKAAVSSFIPVVGKILR------------------------------------.----------------..-.-.-----...----------------..---..--..-..-------------rcsry.......
R6FK72_9FIRM/38-359                  .......................................................FSAENILNATME-GRSIFDDPA.IVENLKELFFLEIKSALLLCVEILSICIIIGVLKGLSGSFN.S.KSV.S...DISMLVCSMVIVGISINNFRTTYTLAIDSVTTMANTMGILMPIIIGILIATG........SITSGTILSPMIIGSITGTAFILKT........FILPALFAAT...VLSLINCLT.E..KDYVNKLSKLLRNASVAVTGLLLVVLTGIISIQGLLTDTSDGLLLNTAKFSLSNFIPIVGGFTSDTVELFLRCMSSIKSVVGVFGIILILLLLLSPLLKV.LVIAVIYKITAALAEP..I.T.DSKIA...ASLSDMGSCMISIGSI..MFF..TA..L..LFIMFITTIIKI-g...........
A0A1B9AR33_9BACI/71-391              ..................................................sqkgs-----FVDF-IS-GEKKFSLKE.WLSGILKFIFHEIIANGKLLGTLILLTVFSVFLQTLQSTFE.K.TSV.S...KVANAIVFMVLMIIALNSFYVAVDYVIDTIAAITDFLVALIPLLLALIASSG........GVLSSAFFHPMLLFLMNTSGALIEY........IVLPMLFLST...LLSIVSMLS.E..HYKVTQLAGLLRTWSVGLLGIFMTVFLGVISVQGVSTAVADGIGIRTAKFVTGNFIPVVGRMFTDAADTVIGASLLLKNTVGIAGVVILLIMTAFPALKI.LLIAMVYKVAAAILQP..L.G.AGQMI...KCLEIISKNIIFVFAA..LAI..VS..L..MFFLTVTVIVAAG............
A0A1H9PN03_9BACI/65-384              .....................................................qk----ESFTDLFN-RNEGFSIKE.WTLGFVKFFFHEILAHGKLLGTLILLTVFSMVLMNLQQAFE.K.YKI.S...KVAYAMTYMVLLIIALNSFYVAMGLAESTIETMSHFMVSLIPLILVLMATVG........SVTSVALFHPIVMFIVHSSGLFIQY........FILPLLLLST...LLAIVSTMT.D..HYKVSKLANLLRNIAVGGLGIFLTVFLGVLSVQGATAAVTDGIAVKTAKFITGNFIPVVGRMFTDAAETVMGASLLLKNTIGVLGLLVLLIICIFPALKV.LAIAVIYSFSAAVLQP..L.G.GGPII...DCLSIIGKNVLFIFAA..LAA..VS..L..MFFLSVTIMIISG............
A0A1T4WX58_9CLOT/51-373              .......................................................ISFSKMISTYKETGSTGITLKT.FLQSLLKYIFNEVTANSRLFVELLIIGILCAILQNIQNAFQ.S.DGI.S...KIAYYVCFLIMVIIIIKSFTVSIDIGKKAINSMIEFTNALMPALIVLLAAVG........GFSSAATLDPILMSSIKITSDIIRD........LIIPMTMITS...ILYIVNNLS.D..EIKISKLADLIKQINLWILAFIMTIFTAVVTIRSHASSTFDEVAVKSAKFAVDNFIPVVGKCLSDAVTTVAGYSLILKDAVSIAGLIIMVIICIFPLIKI.IIVALIYKFVSAVMEP..I.V.DKKII...NCLSAVGNSITMIFVC..VLS..VA..V..MFFIMITIIAQT-g...........
C6CU16_PAESJ/85-405                  ...................................................kmps-----FFEM-LKPGGEGLKLST.VFKGLLGYFFHEVLYNGKLLVTIVMLTVFSMVLETLQNAFE.R.NAV.S...KVAYSITYMVLIIIAVNSFHVAIGYAKDAIGTMIQFMLAMMPLLLTLLAAMG........NVLTVSILHPLIIFMIHTVGTVIYT........IVFPLLFFSA...VLHIVSAMS.D..KFKVTQLANLLRNIGVGIMGVLVTVFLGVLSVQGAKGAVTDGITMRTAKFVTGNFVPVVGRMFTDAADTVISASLLAKNAIGLAGVIILLFLCAFPAIKI.LTLALIYNVSAAAMQP..L.G.DSPIV...ACLQTIGKTMIYVFAA..LAA..VS..L..MFFLAVTIVLTAG............
Q18B59_PEPD6/77-398                  ......................................................v-NLKSFVKDLIS-GEKNILDLF.NKDGLKILMFDEFKASLKVVAVILVLALLSSILKSLENSFS.S.GAV.S...QIATYIIFITMVSLTLIGFKDVLQICYDAIDHTVGLMQVIMPILITFLLLIG........FPITSTTLNPIFIGGVTFINVFFKN........FLFVSITVAF...GILIINNLS.K..NIRLKRFFSFVKQINYVSIGAMFTVYLGLVSIQGLYVTSFDKFSVKTAKFAIGNFIPVVGGFVSDSVDILLSSSQLIKNIFGGIGLILLVGICLLPVIKI.LSVIVVYKLAAIIVEP..V.G.EDGIS...NFLNEVANLMIIMLAS..VIA..IT..V..MFFVTVAILTSI-s...........
C0ZBZ4_BREBN/71-391                  ..................................................lkseg-----FIQILMQ--QGDFSISG.VLQGMGKFIFHEILMNGKLLSSIIIITVFAMILETMQNAFE.R.NAV.S...TVAYSITYLVLMVLAINSFHVAITYAKDAIANMSDFMLAMIPLVIALLASVG........NLASATMFHPLIIFMINTSGMMISY........VVFPLLFLSA...MLSIVSLFS.E..RYKVTQLATLLRNIAMGVLGSFLTIFLAIISIQGATSAVADGVTLRTAKYITGNFIPIVGRVFSDAADTVLNASLLVKNAVGLAGVLILIMLCAFPALKI.LVLALIYNLSSAVLQP..L.G.NSPII...SALGTIGKSLLFVFAA..LAT..VG..L..MFFLAITIMIAAG............
C4IL72_CLOBU/112-434                 ....................................................ldp---VDYIKAFISNGKGNLSFDT.VMKAVLSLFFKEVRSVLALVISIVTIAILCALLKNLQDSFA.D.ESI.S...QVAFYACYALVIMILSKSFIISISVAQGVINDISNFMNALLPILVTMIALAG........GITQAATLDPFILGAVIFIPKIYTN........IIIPMILMGF...VLEFANNIS.E..EHKITNLCKLTKQCILWFQGIILTAFIALLTIRGITSSTMDAVTLKTAKFAVDNFIPIVGKTFSDAITSVAGYSLIIKNAVSSIGLVVVLLILLYPIIKL.ILMTFIYKISSALVEP..V.S.DSRIT...KSLECAGDSMVLIISC..VLT..VS..L..MFFILIAIMAQA-g...........
U2M6U5_9FIRM/61-376                  ...............................................ftdvggag---------------ESFTLSR.IWQVFSAYLSGRISRPFAMLGGLLTVILFAALLQSVQDNAR.H.RGT.G...QVYEFVCALAAVGVLTEPLCRSFAAVESALTQGAEFMMLFVPVFAGILAASG........TLSGAVAYQTAVVLLADSVMQLITR........VLLPLCTMGF...SLAIVDAVS.P..SVSVGGLLRLSRKCTTWILGLLMTVFLGVLSMQNWLGSSVDTAASKTTKYVIANFVPVVGSAVSDAYTTVRSSLQMLRSTTGVVGMVSLCVLFLPPLVQL.LLYRGVVAIGAAAAEL..F.G.TRSLL...RLLRGTQQALAIAFAL..LVC..FG..V..MFVVSTAIAMTI-g...........
R6MMR3_9FIRM/50-361                  ...........................gvspsgtadfgkeltrmlgravsgletp----------------------.------------LHAALRTGCMLLAVVLLCAVCGNFEPELP.V.RSV.T...----LGGALGITAVCTASLRSMIGLAADTLERVGTFTTMLLPVMSAALTASG........GMSSGSALYVGSTLFMDVLVRLIRS........VLIPMTYAFV...AVSTAECAA.G..DGRLSQLRECISWFICLALKGVVALFTAYLAITGLASGSVDAAAVKAAGSALGAAVPVVGGMLSDAAGSILAGANFLKTTAGIFGMLALVAIGLMPFLQI.GVHYLVLKLTAAVGGT..V.A.SGAHA...KLLENLSSAMGYMLAM..TGS..SI..L..MAMISCC------cfmka.......
A0A0A1MXH4_9BACI/76-395              .................................................qkisiy--------EWIKNGN-SFSIQD.ILMHFLRYLLHELIINGKLLGTLLMLTLFAVVLQSIQSAFE.Q.TTV.S...KVAYFVVFLVLLFIVLNSFYLATSYTKDAIDTMQSFMIALLPLVLGMMASFG........NVISVSFFHPIIIFFIHFSGVFISA........FVLPLLFLSA...MLIIISSLN.S..HFKVTHLANLFRNVAVGSLGIFLTIFLGVISVQGTATAIQDGVAMKTAKFVTGNFIPVLGRTFTDAADTILSASLILKNAVGMIGLFIILFIVAFPALKV.GVIAIIYKLAAAILQP..I.G.GGPIV...QCLNTVSTYILFILAC..LLA..VS..L..MFFLGIVIIVAAS............
A0A1S8M9T5_9CLOT/58-380              .......................................................FDIKDYVEYYMKNGKGNTSIDK.FGKALASYFMQDIASSLKLVSTLIFICIVCALLTNLQAAFS.S.EKL.T...QIAYFSCYAIIIIIIAKNFKVCVGTAQEAMKDISDMMGAVVPILLTLLVSSG........SLVESTVFDPVILFSINFTEKVFTD........VLIPIILLSF...ILEFINNLS.E..DYKISNLSKLLRKSVMWIQGMIMTIFIGIITIRGINAKAIDNVTAKTAKFAVDNFVPIVGKCLSDAISTVAGYSILLKNAIGTVGLIILIVMILFPIIKI.FLFAFVHKLVAAFVEP..I.S.DKRIV...NCLNSVGDCLILIGSC..LIG..VA..V..MFFIMLAIIIAAG............
A0A1H9ZZI7_9FIRM/68-388              .......................................................FNFKDYVQGFIK-GEKHFNVKT.ILEDTGNVFLGQLRKERGSIVQLVGIAIVAAIFTSFTNVFK.D.SQI.A...ETGFYVTYLLLFTLLTATFYKISAIAGTALDNLKDFMMSLLPTYAMGIAFAT........GSKTSMFFYETTLGVITIVDFLLIH........IILPMINVYF...VLLLANNIT.K..QDMLSKMSEFLEKIISWALKTVLAAVIGISVIQNLIIPVTDQVKKSVLLKTAQA-LPGVGNTMRVATESILQASLLIKNAIGAAGLIVIIVICLVPVIKL.AIYQLIYSFGAAIVQP..I.S.DKRIL...NCINAAAKSAKLLMSV..VMV..AA..V..LFLFTIVIVTST-s...........
R5PDC5_9CLOT/118-436                 .....................................................mp--ITEMVKKQVE-GDNKSVLSA.LLATISSVFFGELSQNKGLLLELVGIVLIGSIFVNLSNSFA.G.GFI.S...ENGFYITYMLMTSLLLTSFSMAYSITLAALDKVLVAVRLLVPAFLLVLQFIG........HATTAGGTYNLVLVGIWLIQAVIIR........LVLPLIEFYV...IVALVNNLQ.K..EDSFSKLCELVQSLIKWILRTIIVVVIGLNVIKGLLEPQMDILGKTAVNRALTA-IP--GSVVSVLAGTYLACGMIVKNSIGITGILILSGICLIPIIKL.FLLMFTVRITTALIQP..M.G.DKRYV...DGTTALANGIGMLMQA..LAS..AL..V..LFIITLAIMSGAT............
R6CK21_9FIRM/55-376                  .............................................iaedpnlgdp---------------QKLSFSG.ILSALWNALAEQMTEPLRVFARLCAVIMLSSLAASM----A.R.GGA.S...QTFSAVSVLGSVTVIYGSVYAAFQSVCGFLDRLGEFMLAYIPIYASVTAASGrlxxxxsgRLTEGGGYYASALGVCELIAFVSNR........LIMPFLSVFM...ALSFTAAIN.P..NLRFSSAAESLKNAVRFTLTALMTIFTGMITIKSFSGAAADGAAARAVKFGASNFIPIIGSSVSEAYSTVYAGVGVIRSSVGTLGIVAAGVMMLKPFAEL.ICIKIVLGMAKLIADL..L.G.ACEIS...ELMKSTGYAISAALST..MLC..FC..M..MFIISTAVVMMA-a...........
A0A109MST2_9BACI/75-395              ..................................................sqkgs------FMDFVS-GDKKFSFDQ.WLKGITKFVFHELLVNGKLLGSLILLTVFSMFLQNLQNAFE.Q.SSV.S...KVAYAIVYMVLIILALNSFHVAIEYTKDTIDLMISFLMALIPLLLALIAASG........GLISAAFFHPVLMFLMNTSGILVQF........IVLPLLFFAA...ILSIVSTLT.E..HYKVTQLAQLLRNFAIGILGAFMTIFLGVISVQGASSAVADGVTIRTAKFVTGNFIPVIGRMFTDATDTVISASVLLKNTVGLSGVIILLLITTFPAIKI.LMISFVYKLAASLLQP..L.G.GGPVI...KCLDIISKSMIYIFAA..LAI..VS..L..MFFLSITVIIASG............
A0A1V2LV16_9FIRM/60-381              ......................................................f-NLEEEVLLVVS-GKKEFSINT.IVDATIEMFIGEIDTYIGMLARFVLIIVLCNVLSNLSSAFE.S.KNT.T...KVAFFVCYIVILYSVAQGLVVMVELAQSTIGNLLNIMYVILPTLLTFMATSG........YVATSAALSPVIIGGITFISFVIQK........FMLSSVVGVI...LLQIISSMS.E..EFKIDNLVALFYKICKWILRSTFFLSIGIMGIYRMSMPYADVTMKRVGITLTTKFIPILGDAVGGAIDLIIQCAGMIKSAFGIGVIIWIIVLITMPFIKM.LVYIILYNFAAALVEP..L.G.DKKMA...KIALNIANGCEFIMSC..VGV..VA..I..LCISALIICMSI-g...........
R6TZ24_9CLOT/66-377                  .........................................dfsagvgemsnpvf----------------------.LLSAVLEMLGVKIRESAGALCVCIGLVLLAAVLSQLSHLAG.E.R--.A...ELRFCNRLCILCAVLSGSFGVLSG-VIDYFSQLTAMITASIPAMGMLYAVGG........NVGAAAANSATLTAALSVCGAFCGK........SVVPVFGTCF...ALSMMTMIV.P..GIDLSGFVNLIKKTWMTVFGFLSLLLTAALSMQTLLAAKSDSLGMKSAKYVAGNLIPVLGGTVAGTLGTLGASVELIRSSVGICGMLLLLLLLLPSLLHI.LVLRLVYMSAGALART..L.G.CGDEA...GLFGELTSLYGYLAGT..ACV..CT..V..VFFISFALLCGC-g...........
R5KXJ5_9CLOT/148-468                 .......................................................FNLEEISKDLVS-GE-NVDFSK.ASLKLLNIFGKEIISVFKSSILIFIIIVILAVIDSLQ-IEE.K.SDV.S...QIAKLVCFFAIATISISEFIRVLLDFKTVITNITTLMQIISPFLVAVLIATG........AINTVGIIQPLLLFLASLIGFIINY........VVVPLISLSV...AFNVISRIS.D..DIKLNKMSKILNSGGLWIIGVVFTVFLGILSLESSLSTSVDTLAVKTTQAAVSNFVPVVGKFFSDSFETVVGATKIISKVGGILGVIVVILVVITPVIKI.AAIMFIYKILAVLIEP..I.ChQKDVS...EYVELFADTYKTLLGI..LIG..VS..I..LFIISIGIILN--la..........
A0A1Y3Q7I6_9FIRM/56-374              .............................................svrellldpa-------------GGLRLDPVA.MARDWLQYLVGEVVVQSRLLAQLVVAAVLCALLQNVAGSWS.-.RAA.T...EFGFLVAYMVVIFLGLQSFAIASGIGRETLGDMSSFMLALLPLLSTLLAAVG........ALSSAALFHPLLITSVTLVVNTVDR........VVLPLLFLAA...AVGVAGHVV.S..EFPLSRLAGLLRHGAVTVLGLGFTLFLGVMVLRGAIAPVADGVALRAAKFLAGTFIPVVGGMMSDAVEVVVGGSLLLKNALGVLGLVALTLMLAFPLAKI.LALVVIYRVATALVQP..I.S.DTRLV...DALGTLADALTVLMSS..VAT..VA..L..MFFVGILVVVGVG............
R7IS83_9CLOT/75-394                  ......................................................v-NLGDMLNQAIQ-GK--VDNKT.LYQKIFKMFGKEITVSLKTLISILVIIVIHGILKSVTDNLE.N.KNI.S...QIIYFVQYILIVTLIMSNFTEIIKIVKNTADDLVGFINVLMPLLLTLMMYTG........SIATTSLLEPIILFAINFIANLIKN........ILIPIVLIIV...VFSIISKIS.E..KMQIEKLSKFLKSSVVWVLGIVLTIFVGVVSLEGTLSSSVDGITAKTAKSAVSTIIPVVGKVLGDVVDSVLGCGIILKNAIGLIGVIIVIGICITPIIKI.ATMCIMYSLASAVVQP..I.A.DDKIV...KVLDEMGGVFKLLLGI..LCS..LS..V..MLIVGITLVIKI-s...........
A0A0A2UVI8_9BACI/65-385              ..................................................irkgs-----FVEF-ME-NRDSLSVKD.WILGLLKYLFYEFLINGKLLGTLIFLTLFCMILQSLQNAFE.N.QTV.S...KVAYAVVYLVLIVLALNSFHLAVSYAKDAVEMMSSFMIALLPLMLGLMATFG........NLLSVSFFHPVIVFLIHTSGLLVSN........VVLPLLFLSA...LLMIVSTIN.D..QYKVTQLAQLLRNTSLGLLGAFLTIFLGVISVQGATSAIQDGVAMKTAKFVTGNFVPVVGRMFTDATDTVLSASLLLKNTVGIVGVLIILALALFPAVKV.LAVALIYKLAAAILQP..I.G.GGPVI...ASMETISKHILFVFAA..LLV..VT..F..MFFLAIVILVAA-s...........
A0A1V4IRX5_9CLOT/100-422             ....................................................ldp---VEYIKAYLKEGKGNLSIDA.LLNAVISMIFKEVKSVLKLVVSIVTIAIICSLLKNLQDAFS.D.ESI.S...QVAFYACYALIIIVLSKSFIISISVAKDVIANISDFMSALLPVLVTMITLAG........GITQATTLDPIVLGAVVFIPKLYSN........IIIPMILMGF...VLEFANNIS.S..EHKITNLCKLFKQVTIWFQGIIVTIFIGLLTIRGITSTTIDAVTLKTAKFAVDNFIPIVGKAFSDAIASVAGYSLIIKNAISSIGLVVIILILIHPLIKL.VLITFIYKLSAAIVEP..I.S.DPRIT...KSLEAAGTSMVLIMSC..VLT..VT..L..MFFILIGIMASSG............
R9KI72_9FIRM/81-400                  ......................................................l-DFQGLVQKLIN-GD-PIDKKG.LLKEILHMVFGEIAAFRSTLVQIVLLVVVFAILNNFADVFE.N.PAV.T...EISFYMVYMLLLVLLMKSFFILRDVSVDVIGDMMVFLKVLIPTFTMSMAFSG........QITTAAGFYDMTFLLIYGLEWVIQY........LVVPAVQIYM...VLELMNYLT.E..EELLSKMTDLLKSGVAWVLKLLFTIVVGINVVQNLLTPVIDTFKAGILAKTAGM-LPGLGASINAVTEIMVGSGIIIKNGIGIAAIAALLALCAGPLVKV.GVMTFLYKILAAMIQP..I.S.DKRMI...GCISSAGESGRLLGKA..VVT..TV..V..MFLVTIAMVTAAT............
A0A037Z4R9_CLOTT/58-380              .......................................................MDIKNYVNNYMKKGEGKFSIKK.FSKAIISYLLRETALSIKLMSILVIISIICALITNLEKAFT.N.ENL.S...NIAYFACYSLIIIIMARSFYIGVDLARDTINKMSDFMLALIPVILMLLVSIG........GIAEAAVMDPIIIGTINISARLFSN........ILIPLISMTF...VLQFVNNIT.E..EYKIDKLTKLLNQIVLWGQGILMTIFIGIMTVRGIASKTLDQVVAKTAKYAVDNFVPIVGKCLSDAVATVAGYSLLLKNSLSSIGLVILILIVILPVLKI.LVTALLYKLTAALIEP..I.G.DKRLV...NCIGSAGDSLILITSC..LIC..VS..V..MFFIMICIVAA--gg..........
A0A1W1VZ10_9THEO/79-399              .....................................................gw---RDIWER-LRRGELPVKPEE.VARGLARYFLRELWAGTKLLSQLVILAVAGAVLQNLQASLS.E.GTA.A...KVAHGVVFLALVGLALTPFTLALQAASQAIDRMVSFFQSLLPMLVTLLAATG........GLTTSTLLQPVLTYSLTIAGTVTRG........TIFPLIYLGA...ILGVVSHIS.D..RFQISRLAGLLRQFSLALLGLMLTLFTGVLSVYGIGGSVADGLSLRAAEFATASFVPVVGKILSDAVTTVAGTTLLLKTAVGVTGVVIIFFLVAFPLLKI.VSLALVYRVAAALVQP..F.G.EHQLS...DALEGMGGALLLLFAC..LIG..VT..L..MFYLTIGVIVLL-g...........
A0A1G9Z7I7_9BACI/64-382              .............................................ddhwldsvrd-------------GS-IFSLKN.WISGIMNFFIDEWIVNGKLLGMLIFLTLLSVFLKLLIGSFE.N.ESV.S...KVSYLVIFGVLLTIAITSFQQAVSYTTGAIDGMGNFMLALLPLMLSMMAAFG........NVASVAFFHPLLLVFVQVSGVLISK........IVLPLFFLSA...ILNIASTIN.K..EYNVSQLANLMKHAAFVILGIFLTLFLSVMSLQGVNAAVADGVAIRAAKFVTSNFIPVIGRMFTDATDTVFSASVLLKNSIGLAGVVLVMIITLFPALKV.LVLGLIFRLSSALLQP..V.A.DGPIV...DAIETMGKHILYILAA..LLA..VS..M..MFFFALVMLIIV-g...........
R6D997_9FIRM/42-358                  .........................................mdtsashetlwqgl--------------------GD.LWHSACAYVRTALETQASGAALLLGVVLLCSLAESCLAAAD.S.PGV.P...RYVSVAGVLAITLVAAGDFRRMMGLGVETMSQLEVFSKALLPTLSAAVAAGG........GYITAGARQVATVFFTDLLISLIRQ........VLLPLLYACI...AAAAADAVV.P..GHSLQKIGQGLRKCVAWALTALMLVFTGFLSVTGAATSAADALSTQLTRTAIATAVPVVGSIISDAAGTVLAGAGMLKGAIGVFGLLAVLAICLTPFITM.AVQYLLYKLAAFLAGT..V.T.QEPLA...DLIDALGSAFGLMLGM..TGS..CA..L..ALLISII------ssvsvv......
A0A1D9FP91_9CLOT/62-383              ......................................................v-DIKQFIMNLIR-GEATLSFSD.IIKGSTRFLFKEVVANWTLLAQIIVLASICAVLKNLQSAFE.N.EVV.G...KLAYNVCYLVIISITIKSFMIAIGIGRETIDVMVSFMQVLMPVLLAMLMAIG........GITTSAILHPILLGAIGFVGTIIKV........TILPLILFSA...VLTIVNHLS.S..KIQVTKLAGLLKQAAVVTLGFILTAFIGIISIQGITASTVDGVTIRTAKFAVDKFIPIVGGFLSEAMDTVIGCSLVLKNAIGAIGLISIFLLCLMPMIKI.LALVIVYKLCAAVIEP..I.S.ENGLV...DCLNSMSNSLILLFAT..VSS..VA..I..MFFLTITIIVSTG............
A0A1I0V6P7_9BACI/70-389              ...................................................ekts------IYEFIK-DNESFSIKN.TLSGLVEYLLHELILNGKLLGTLLMLTLFSIILQTMHTAFE.K.SAI.S...KIAYYVVYIVLIYLALNSFYLAVSYANDAIDTMSSFMIALLPLILGIMATLG........NVITVSFFHPIIIFLINLSGVLVSK........FILPLLFLSA...LLLIVSSLN.D..NYKVTNLANLFKQAGMGTLGVFLTIFLGVMSVQGASSAVQDGVAMKTTKFITGNFIPVVGRTFTDATDTILSASLLLKNAVGIVGVLIIILIAIFPAIKV.FAIALIYKLAAAILQP..V.G.DGPVI...TTLDTISKYIVLILAC..LLV..VT..L..MFFLSIVILVVA-s...........
A0A151AQF1_9CLOT/55-377              .......................................................IDIKAYVKDYMKNGDGKLSTKK.IFKALMSYGFREVIACGKLMYMIIIICIICALINNLENAFS.N.GNL.S...NIAYFACYSLLIILISRTFYIGVSIVREAIKDMTDFMAALMPVLLILLASVG........GFSQAAVMDPIIIGVINISARIFVN........LIIPIIGLSF...VIQFVNNIS.Q..EYKVDNLSKLLNKSALWIQGIIMTIFIGTVTIRSMATATIDAVTEKTAKFAVDSFIPIVGKSLSDAISTVAGYSLLLKNALSSIGLIILIAILIFPVIKI.VVMAFIYKLTAALIEP..I.S.DSRLV...KCIASAGDSLILINSC..LIS..VS..V..MFFIIISIIASAG............
A0A0V8JN32_9BACI/67-387              ..................................................sqkgs-----LVDF-LK-GDKEFSLQE.WLNGLVKFLLHEIISNGKLLGTLIMLTVFSVFLQTLQSAFN.Q.QAV.S...KVAYALVYMVLIIIALNSFQVAIAYATGAIETMSKFILALVPLLLALMASSG........GVISAAFFHPVILFLMNISGMLIQY........IVMPLLFLSA...LLSIVSTIS.D..QYKVTQLAQLLRNVSIGILGIFLTVFLGVISVQGATSAVADGITIRTAKFVTGNFIPVVGRVFTDAADTVITASLLLKNTVGIAGVVVLLLIVAFPAIKV.LALALIYKLAAALLQP..I.G.GGPVI...SCLSIISKSVVYIFAA..LAI..VS..L..MFFLCLTVIITA-s...........
R6G4F8_9FIRM/57-377                  ......................................................p-DFSSIFEKILS-MQFTEVFQQ.IGGWFIDIAFREVFSSKILITELIGVILFSAVFSNISSSFQ.P.YGV.S...DSGFFVTYLITFSIIFTNFTAMTTLFENTVILLSSFLKVLLPVYTLAVSLSG........NLSTGVVFYEYFIIVVLLLNWICIK........IFLPLLQYYL...LLELLNRFS.K..KQNISRLCEGLFLFLSKGVQVLFFLFFGFHLLETMIAPSFDAAKNNVLNKMIGL-IPGAGSVIQSVTGTVLGSSLVIKNALGAAGIVFLFLFLLLPLTKL.LCYVFFYFLLSVVLEP..I.A.DERFV...ECISAAVKCGLLLIKV..LCM..SS..V..LFIVIIALTTLT-t...........
A0A1H4LFS8_9BACL/72-391              .................................................ktpsfm--------ELLL-GTKGFSISS.MFKGILNYFFHELLVNGKLLASIVLLTVFSMILETLQSSFE.K.NTV.S...KLGYSIAYLVMIILAINSFSVAIGYAKGAITSMIDFMLAVVPLLLTLLASMG........NLTSVAILHPLIVFMVNSVGTAIYI........FVFPLLFFST...VLHIVSSIS.D..KYKVTQLANLLRTISIGLLGVFVTVFLAVISIQGGAGAITDGVTLRTAKYITGNFVPVVGRLFSDASETVIGASLLVKNAIGLTGVAIIMLLCAFPAIKI.LTLAFIYNLSAAIIQP..L.G.DNPII...ACLQTIGKNMIYVFAA..LAA..VG..L..MFFLAITIMITV-s...........
A0A0J5JWI8_9BACI/63-383              ...................................................sqkg-----TFMEFVK-GDKSFSLKE.WSKGFVKYLFHELLANGKLLGSLILLTIFSMFLQTLQNAFE.Q.KTV.S...KVAYSVVFMVLIIIALNSFHIVISYTQEAISAMTGFIIALVPLLIALIASSG........GLVSAAFFHPIILFLMNTSGLLIQY........VVLPLLYLAA...ILSIVSTLS.E..HYKVTQLAQLLRNVSIGILGIYLTVFLGVISVQGATAAVTDGIAIRTAKFVTGNFIPVIGRMFTDATDTVITASLLLKNTVGILGVATLVLLAAFPAVKI.LSIAIIYKLAAALLQP..L.G.GGTVI...KCLDIISKSIIYIFAA..LAI..VS..F..MFFLSITVIIAAG............
N9WGH0_9CLOT/76-398                  ......................................................l-DPKSYVESYIKNGQGNLTIKE.LGLIAVNLLFKEVRVVLKLVISVVAIAILCSLLKNLEDAFK.N.ESI.S...NIAFYACYSVLIIILSRSFLISIDVATNVINSISEFMNALLPVLVGMIALAG........GFVQAATMDPIVLGSVILIPKIYSN........FIIPMILVSF...VLKFANNLS.T..EHKIDNLCKLISQGILWFQGIIITIFIAMLTIRGITADTMDAVALKTTKFAVDNFVPIVGKAFSDAITSIAGYSLIIKNAITGIGLIVIVLIILYPIIKL.VLMTFIYKISASLVEP..I.S.DKRIT...SALSMIGESMVLLTSC..VIS..VS..F..MFFILLGIMASAG............
A0A1G7R9G8_9BACL/72-392              ....................................................kip----SFMDMLLQ-KDQSLSLKS.AFSGLMRYMWHEVLYNGHILVTIVILSVFSMILETLQTAFE.R.KQV.S...KVAYSICYMVILILAINSFHVAITYATEAITGMIDFMMAMVPLLFTLLASMG........NVVTVSVTHPLVVFMVHTVGTMIHS........VVFPLLFFSA...VLHIVSSLS.D..KYKLTQLANLLRTVSMALLGILLTVFLGVISVKGIAGSVTDGVTLRAAKYLTGNFVPVVGKVFADATDTVISASLLVKNSIGLVGVVILLFLCAFPAIKI.LTLALIFNLASAVMQP..L.G.DTPIV...SCLETIGKSMLYVFAA..LAA..VG..M..MFFLAITIMLSAG............
R6BUZ6_9CLOT/30-350                  .......................................................IDLETLLKQAFT-GDIKGALTG.VAQMTFGSVITDLASLKNTFLLLLLMGIGAALISHFIRIFD.K.HQV.A...DAGFYFLYLYMAAVLMKCFFSAAHTAAEAIQNIVAFIQVFIPAYFLSVGIAT........GTMTAGAGYQIILLIIFLVEKILLT........LLMPLINSYM...LLAVLNGCL.S..EERMTLLESGMEKMIRFLLKASLGIVAGISTLQSLLTPAIDSAKTGLLQKGLSA-IPGVGEVTDSVVDMAFGAAAIIKNGIGFTALLLLIAVALPPLCKL.LLTAFVLKAAGAFMGL..V.S.DKRMS...TCADRVGNAGRLLFQT..VGT..SF..L..LFMITISVAAFT-t...........
A0A1G5KEW0_9CLOT/61-382              .......................................................IEFRQLIIKLIR-GEVTFSFND.IIKGATQYLFKEVVANWKLMTQIIVLSSIYAILSNLHNAFD.N.DVV.S...KLAYNVCYLVIITITIKSFLIAINLGRDAIDMMVSFMQALLPVLLAILLAMG........GITTSAFFHPILLGAIGLIGTIIKN........IILPLIFFSA...VLAIVNNLT.T..NIQVSKLAGLIKQTAAVMLGFILTAFVGLISIQGITAATVDGVTIRTAKFAVDKFIPIVGSFLSDAMDTVIGCSLLLKNAVGAIGLITIFLICLSPMIKI.LALIVIYKLCAAVIEP..I.A.QNQLV...DCLNQMSNSLILLFAT..VSS..VA..I..MFFITITIIVGTG............
B8I3B7_CLOCE/70-391                  ......................................................f-DPGKIVSDAAK-GNLNFSFSG.VINGLIKYLLKEVFLNADILIKIIVLCIICAILKNLQNSFL.S.ESV.G...EMAFFVCYIVLVSVLMVSFSMAMKMCMEIIDNMVSFMHSIIPLLITLLATSG........SISSAGVFQPVLVMLIEIGATVIKN........FFIPLIFIVT...ILNIVNNIS.D..KIQLTKLAGFMKQICTWGLGFILTIFIAIVSIQGSMGAVVDGVTSKTAKFALGTFIPVVGKYLADAADTVVGCTLVIKNASGLIAMIGILIICLAPLLKI.LAMVVLYKLACAFVEP..I.S.DKKIT...NCLNDMSGSLTYILGV..TAA..VA..V..MFLIAITIVIST-s...........
E6TXP2_BACCJ/67-386                  ..................................................qrgsf-------MDFVT-GDKQFSVGE.WVNGFIRFLFHEIFANGVLLGTLVLLAVFSMILSQLQQAFE.Q.HTI.S...KVAYAITYMVLLIIALNSFRVTMEFAERTIEVMSNFMVSIVPILLVLMASSG........SVTSVALFHPIVMFLVHTSGIFVQY........VVLPLLFLST...LLYIISTMT.D..HYKVTKLAQFLRNIAVGSLGIFLTVFLGVLSVQGATAAIADGIAIRTAKFVTGNFVPVVGRMFTDAADTVMGASVLLKNTVGVVGLVILLLICSFPALKV.LSVAIIYTFTAAILQP..L.G.GGPII...KCLSIIGKQMLFVFGA..LAA..VS..L..MFFLSITIIVISG............
D9R8P8_CLOSW/64-384                  ......................................................l-SFQELMKDLMA-GNLNQVMGQ.AGKAMKDLLMGEIKNSGHMMGQIMVLGIIGAVFSNFSSVFT.G.SQI.S...ETGFFVTYLLLFTYLAASFFTSVTITGNVLGQVFDFTRVLMPAYFLAAAFAG........SSASAAASYEFTLFIITAAQWLLGQ........VLLALIRVYA...LLVMAGHIA.K..EDMLSKLTELLEQVVSWSLKTLVGVVLGFHLIQSMVLPYVDSMKTGAIQKLIGA-IPGVGQGVNSVAQMVLGSGVLIKNTIGAAGIIILLILSVIPLIKL.VVLMVLYQCVAALLQP..V.C.DKRIV...TCISDMAKGHRMLLSV..AAS..GV..I..LFVVTIALVCAST............
I8UKI1_9BACI/70-390                  ..................................................tqkgs-----LLEF-IK-GEKTFSLKE.WGKGIVKYVFFEVFAQGKLLGTLILLTVFSMLLQTIQSAFE.K.STV.S...KVAYAIVYMVLIVLALNSFRLGMTYAKDAIEMMMDFMTALLPLVLALMATLG........GMMSVAFFHPIVVFLVNSSGLLINK........FVLPLLFFSA...LLSIVSTMS.E..QLKVTQLATLLRNVAMGALALFFTVFISVISVQGATTAVSDGITMKTAKFVTGNFIPVVGRMFTEATETVMSASLLLKNTVGIAGVVMLLLLAIFPAVKV.LVLGFIYTFAAAILQP..L.G.GGPII...DCLQIIGKSVFYVFAA..LAT..VS..I..MFFLAITIIVAAG............
A0A1Y4S6G1_9FIRM/1-83                ......................................................m----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..----------------------------------------------------------------------------LRGTIGVFGLLVVLGLCLGPFLEL.GVHYLVYKLAAALAAT..V.S.GGSAS...TLIDGIGGAFGLVLGM..TGS..GA..L..LLLVSLVSAIS--mt..........
C4Z0I0_EUBE2/49-359                  ......................................................t-SFKELVRSVAS------SDTD.IGFNFTETVTEAIISNRTVLIQILLLSICAMFLTVLD----.-.KNA.S...DSAMLFISFILMTLIVAVFINAARTGYECVQMSVDIYKALCPVFFPAVAYSC........GASSAAAYYEIILFLMYIVNVLVKN........VLMRCNYVYM...ILGMFDTFS.E..KDKFNKMCQLITKIIKLSVKGMLMFFLGLNGIKSLILPLSDSLKMSVLFKAVSM-IPGIGNSAQTVSKTIAGSAVLVKNSIGVSAVIVMAVIIGIPLLKL.VVMALLYQILGAVLEP..V.A.DSRIV...KAVLVLSGSLENMIYM..IAV..TV..V..LMCLTMAIICFAT............
R6RQG5_9FIRM/44-364                  .......................................................FDFKETVKLFFS-GETDKSITG.LGQALLDSLFSELAAQKSLITRIVIIGVAAAVFMNVASAFL.K.GSI.A...QTGFYITFMLLMGTLMSGYVIAADLVTDAMNSLLEFMEAVVPIYTLSVGFAA........GSSSAASFYSIITILIVIIQKLLCD........FIIPMIYIYM...VFNFINNIT.E..ENVFTRICELLKTVIEWILKALLSCVIGMNIIQSMINPVMDSLKTSALGKAASM-IPGVGGVLTSVSGLVLGSGTLIKNSIGMASMIAVIVLCFIPVIKA.VAMSIGYKFAGAMLEP..V.S.DKRIS...NAVNGIYESIVLLAKT..LLY..GV..V..FFLLTMAIVCYST............
R6I0K0_9CLOT/55-374                  .......................................................IDIGQILNSAIS-GN--VDNST.LYKRILNILGGEVQVGIKSILGILAIIIIHSILKAISEGLE.N.DAI.S...KMIYYVQYIAIVTIIMTNFSDIVNLVKETTTNLIGFMNTLIPVLISLMLYTG........SITTSSILEPIILFMINFIGNLIQD........LFIPILLIIT...TISIVSKIS.D..KVQVEKIAKFLKSSTIWFLGIILTVFVGVVSLEGTLSSSIDGITAKTAKSIVSSGVPVVGKILGDVVDSVLGCGVILKNAVGLVGVIVIIGICILPILKL.SVLTISYQLVASVGGV..I.A.DEKIV...KLLEQIADIFKILLAI..LCT..IS..F..MVIIGTALLLKM-s...........
A5N7I3_CLOK5/76-398                  .......................................................IDVKTYVKNFLKSGEGGISFKK.ILSAVMSYGVRELKASLKLLVLLVIISIICTLLTNLQRAFS.S.EQL.S...NIAYFACYSLIIIIMSKSFYIGVDIAKSAINQMTSFMVALIPVLITLVASVG........GFVEAAVMDPIIIGAITISANLFMY........VIIPVISMSF...VLQFVNNLS.S..EYKIDKLTKLLNQGALWTQGIIMTIFIGIITIRGITSKTIDQVTAKTAKFAVDNFVPIVGKSLSDAIATVAGYSVLLKNALSSLGLIVIVAMILFPIIKL.IIMIILYKLTAALIEP..I.S.DGRLV...NCINSAGDSLILIMSC..LIC..VS..I..MFFIMISIVASAG............
L7VLG9_CLOSH/76-397                  ......................................................y-SVRQLMQEIVS-GNVQESMET.LPQKLINIFIAEIKNSFSLVVKLIIVVFLSAFINNLQGAFK.E.SAV.G...ELAYFACYAALVSMLALGFHMVLEYAGEVLDTIDSITGFAIPALLALLISSG........NVASGTALKPVLLFAIQATVKVFRN........IFLPLCLMAG...ILYIVSGLS.E..KIKVSGMASLIRQMVTWGLGAILAGYSSLVVIQGVTGAVIDGATVKTTKTAITTFIPVAGKYIADAADTVISCALVVKNTAGVLTMIVTLAACCIPIIKI.FIIVLMYRFTAAIIEP..F.A.EERFF...DCITDVSDCMKVVLGV..VGS..SV..F..MFLLSVGALLGA-g...........
A0A1M4U6H0_9THEO/65-386              ......................................................l-NIVNIIRDIIN-GKNILNMNQ.LIPDIFKVVFGEISLNIRLLIQIIALSVICALLINLQQSFN.D.ETI.S...QIAFIVTYMVIVILLLNSFKASMDVGKRTIDQMVNFMQALMPTLFAALVSSG........SAVSAATFNPIIAFSVEGISAIMRD........YIIPVIYWIS...VLSLINNLN.T..RLQIDKYIDFIRSIITTIIVLLPLMFLGVLTVEGITSPFVDNAAIKTAKFATGKFIPMVGSVMSDTFDAILRYTVILKNSIGVIGMLAVVFITVYPLIKM.FALLIILKISAAFIQP..I.S.DERVV...KGIEGVANSLTLLMSC..VVV..VA..V..MFFISLAILLATT............
N2AD95_9CLOT/123-443                 .....................................................lr--FGDVTAAMMS-GNLEETGKL.LLQYAGDQLTYEFQTNRKNLVYMLLIAVIAAIFTNFSGAFQ.S.RQV.S...EISFYVLYMLLITMCLTTFRVAMEGLEGKLLALLDFMRLMCPGYFMAVSLAS........GSSSSMMFYGMVLLLIYVVEMLVLR........LLLPLINVYI...MIQVMNYLV.G..EHVLSELADLIRKLITWILRSLLGCVIGLNVIQGLLSPTIDTLKRSTLTKAVEA-VPGIGSLFGGVTDVLLGTAVLIKNGIGMAGAVILILICSVPVIQM.AAMTFLYKFAAAMVQP..V.S.DKRIT...GCIRSVSEGYRLMLKV..LYT..TL..I..LFLITIAVVAAST............
A1HQ74_9FIRM/59-378                  ...................................................taat------IKETAA-KGLNFDWSQ.LWQKLISRLFRECAANIHLLGKLLFLAVLCALLQNLQNSFE.Q.STI.S...LLAYGVCFIFLAVIALNALYNALTMARETVDYMVGMMEALLPLLLSLLAGVG........ALTSAALFTPLMLFVVSSVGLVVKD........VVLPLLILTA...VLECVNFLS.D..KYRLSNLAGFFKQGGMVVLGLTLVIFIGIITIQGVAGSVADGITLRTAKYATSTFIPVVGKMFADTVELVMGASLLIKNAIGIFGVMAIITVCAFPLIKL.MSLILVIKIAGALVQP..L.G.DEKMA...KCLDGMGNNLLLVFGA..VLT..VA..L..MLFLAITMIVGAG............
A0A1S8TTC2_9CLOT/158-480             ....................................................lnp---VDYIKEYIKEGTGNLSFHN.ILNAVLSIVFKEVKSVLKLTLSIVTIAIICSLLKNLQDAFS.D.ESI.S...QVAFYACYALIIMILSKSFIISISVAKEVIINISDFMSALLPILITMISLAG........GITSAVTLDPIVLGAVVFIPKIYSN........IIIPMILMIF...VLEFANNIS.S..EHKITNLCKLFKQITIWFQGIIVTVFIGLLTIRGITATTMDAVTLKTAKFAVDNFIPIVGKAFSDAITSVAGYSLVIKNAISSIGLVVIILILLHPLIKL.ILITFIYKLSASLIEP..I.S.DSRIT...KSLEAAGNSMVLITSC..VLT..VS..L..MFFILIGIMASSG............
SP3AE_BACSU/72-392                   ..................................................sqkgs-----LMEF-IN-GDKSFSPQE.WLKALFSYLFHEVLANGKLLGTLILLTIFCVILQLLQNAFQ.Q.STV.S...KVAYSIVYMVLIILALNSFHVAINYATEAIQTMTSFILALIPLLLALLASSG........GAVSAAFFHPVILFLMNTSGLLIQN........IVMPLIFLSA...ILSIVSTMT.E..QYKVTQLANLLRNIAIGALAVFLTIFLGVISVQGASAAVTDGITLRTAKFITGNFIPVLGRMFTDATDTVISASLLLKNTVGILGVAILICIAAFPAIKV.LSLAFIYKLAAAILQP..L.G.GGPVI...TCLDVISKSVIYIFAA..LAI..VS..L..MFFLSLTVIITAG............
A0A089JER9_9BACL/93-413              ....................................................ktp----SLMDMLLP-GEKGLSFKS.VLTGLTSYMWHEVLYNGKLLVTIVMVSVLSMILETLQTAFE.R.KSV.S...KIAYMLCYMVVLVIAVNSFNIAIGYAKDAIDRMIDFMMAMIPLLFALLASMG........NIVTVSVTHPLIVFMIHAVGTLIHT........VVFPLLFFSA...VLHLVSAMS.E..KYKLTQLANLLRNIGAGLLGVLLTVFLGVISVRGITSSVTDGVTIRAAKYITGNFVPVIGKMFADATDTVISASLLVKNAIGLSGVIIILFLCAFPAIKI.LVLALIYNVAAAVMQP..L.G.ETPIV...TCLQTIGKSMIYVFAA..LAA..VS..L..MFFLAVTIMLTAG............
R7HAC7_9FIRM/105-424                 .......................................................ISFQEIINQ-IT-GEDGVTGQG.FFPVLNKTFLQVITGSKTAVVQIIILALFSAAIRCFGPSAC.K.EQI.S...DTAQMILSISLTAVLIASFYTACTISTDTLEGCISVYKAVVPVFFSAVAFAS........GNVTAAVYYEIVLMLITTVNLLFKS........VLIKVDQIYM...LISMADAVA.K..EERFTKAAELCVQVMKWSGRTALVVFTGLGGLKGMLVPVSETYKKKMLYRAVQT-LPGVGSSIETVTQTVWGAAKIIKNGIGMAAVIAVLIVCAVPVLKL.VLMAVLFKVTAAVIEP..V.A.DKRVV...KAVNALGTAVGMLLMT..VLA..AV..S..LFLLMLAMIVMMT............
A0A135L347_9BACI/66-386              ...................................................enkk----SLFDMVLP--SRDFKLQS.FFVGLLKYFFYEILYNAKLIGTIILLTVFSTVLQHIQTAFE.K.NTV.S...KVAFAISYMVLIIIAINSFTVAINSARDAIQEMINFMVALIPLVLTLLASMG........NAISAAMFHPLIIFLINVIGTVVYK........VIFPLIFFSA...VLSIVSSIS.D..KFQVSQLAKLLRNISVGALGVFLTIFLGVISVQGMSASVADGVTLRTAKYITGNFVPVVGKMFSDAADTVIGASLLVKNAVGMAGVLILLLIVIFPAVKI.LTLAFIYNLSAAIMQP..L.G.NSPII...GTLNMIGKNLIFVFAA..LAA..IG..L..MFFLALTIIITAG............
S6EZV7_9CLOT/82-404                  ...................................................ldpi----EYFKNYIKSGEGNLSFKS.IVGAIVSFLFREVKIVLSLSLSIIVISIICSLLKNLQSSFS.N.ESI.S...NIAFFACYALLIVILSKSFLVSIELAKNVIIEISDFMAAVLPVLVVMLGTAG........GFTQAATMDPIILGATFIIPRIYLN........IIIPLILMTF...VLQFANNIS.T..EYKIDNLCKLMKQTTLILQGLILTIFIGLLTIRGITTSTIDAVTLKTAKFAVDTFVPIVGKSLSDAISTVAGYSLIIKNAVSSIGLIVIILIMIYPIIKL.ALMSLVYKLTAALIEP..I.G.DKRIT...NSISAAGDALVLIMST..VIS..VS..V..MFFILIAIMASAG............
A0A1K1PIG7_9BACL/114-434             ..................................................skapt------FMELLQ-GAKNFSIGG.LFSGLFKYFFHELIYNGKLLVSIVVLTVFSMLLETLQSSFE.K.NAV.S...KIAYSISFLVLMIIAVNSFNVAIGYAKSAITDMIHFMIAVVPLLLTLLASMG........NAVSVTVLHPLIVFMVHAVGTAVHL........FVFPLLFFSA...VLHIVSGLS.D..KYKVTQLANLLRTVSLACLGIFITVFLGVISVQGATGAVADGVTIRTAKYIAGNFVPVVGRLFSDASETVIGASLLVKNAVGLSGVVVILMLCAFPALKI.MALAFIYNISAAVMQP..L.G.DNPMI...TCLETIGKSMIYVFAA..LAV..VG..L..MFFLAITIMIAAG............
A0A0A3J6W8_9BACI/1-295               ......................................................m----------------------.--NEILNVFTDPLIIAGKSIFLIVTYTVVFLAIEAFVPKFK.-.---.-...KWSDTMFIVVLVLTLGQTVMDAFSLMTQLSGIFSNFFLALYPIIMSLLVILN........SVFSFIAWSPIIFFIFELLILLCDR........ILIPAVSVAL...ILDFCTKFI.G..DMSFGKASDLIRGTVMTLITASVLAIVTVLSFTGVAFFTIDKAIADPVKKVIEQTIPIVGSLIVQGFSIFHKYQSTATTVAGFSAMTAFWVAAFYPAGKL.LIHAMTFKLLAAIIEP..F.T.SGTVS...GLVDDVGKSLLVLCAV..AFL..LG..I..AFVFIWLILMVM-t...........
A0A150Y9A4_9FIRM/1-190               .......................................................----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-----------MLFLIYLVQSVVCS........FVLPLIHVYL...MIRLMDELS.P..EPYLGRFAELGQTIISWILKTILVGVMGVNLIQGLLSPVIDEVRRSGLQRGLES-IPGIGNTLGGMTEIVMSALTLIRNGIGVAGALICVGICLIPVIQI.AVLALIYKLLAALLEP..V.S.DSRII...GCVAGAGDAAVLLLKT..VYT..SA..V..LFLITIVIVAA--i...........
G8LWK0_CLOCD/77-398                  ......................................................y-NPEKLIKD-LTKGEFKFDFAS.IFKRILLYLFKEVYVNIDLLIKLIVLAIICAVLNNLQSSFM.S.KSV.G...ELAFYVCYIVLVSVLLISFNSALKSGIQIIDAMVNFMYTSIPVLITLLISGG........NITSGGVLHPVLIAIVQFTAAIIKN........VFVPLIVLST...VISIVNNIS.D..KIQVARLASLLKNITSWSLGFILTIFVAVVSLQGSLGAVVDGVTSKTAKFAIGVFVPVAGKYLADAADTVIGCTLLIKNAVGVAIMIGIVSVSLIPMLKM.LAIIGVYRLACVFLEP..V.A.ENRII...KCIGEVAGSITYIFGI..VAS..VS..F..MFLLTVATLVTAG............
A0A0U5P0U3_9CLOT/78-398              .......................................................ITFQELVSSLIK-GEGAGAGKH.IMEFVADQFFYEFRQNRQNLVYMLLIAIIAAVFTNFSNAFQ.N.KQV.S...EISFYVLYILLITMCLNVFRIAMKGIEGQMSVLLDFMGVLCPSYFLAVAIAS........GSTSSLIFYNIVLFLIYAAEVIILR........FLLPIINIYI...MVQVINYLA.G..EEYLSQFAELLKKLVSWILKTLITVVIGINVIQGMLAPAIDTLKRSALTKTAQA-IPGIGNAIGGVTDVVLGTAILIKNGIGMAGAIIIISICAVPVLQN.IFMMLMYKLAAALVQP..V.S.DKRIT...NCISSVSEGYELIVKV..VLS..TV..I..LFLLTIAVITATT............
A0A1I0FHT3_9BACL/95-415              ....................................................ktp----SLMEMLLP-GKDGLSLQS.VLSGIGNFMWHEVLYNGKLLVTIVMISVLSMILETLQSAFE.R.KTV.S...KIAYMLCYMVVLVIAVNSFNIAIGYAKDAIDRMSDFMLAMIPLLFALLASMG........NIVTVSVTHPLIVFMIHTISSLIHT........VVFPLLFFSA...VLHLVSAIS.D..KYKLTQLANLLRNVGAGLLGILLTVFLGVISVRGITASVTDGVTIRAAKYITGNFVPVIGKMFADATDTVISASLLVKNAIGLSGVIIILFLCAFPAIKI.LVLALIYNVAAAVMQP..L.G.DTPIV...SCLQTIGKSMIYVFAA..LAA..VS..L..MFFLAVTIMLTAG............
A0A172TLZ4_9BACL/67-388              ..................................................skvpt-----FMEL-LIPGGDGFSLKD.MFQGILKYFFHEILYNGKLLVSIVILTVFSMILETLQSAFE.R.SAV.S...KIAYSITYMVIIILAINSFNVAIGYAKNAIESMIHFMMAMVPLLLTLLTSMG........NVTTVTLMHPLIVFMIHTIGTLIYA........IVFPLLFFSA...VLHIVSFLS.D..KYKVTQLANLLRTISVGLLGVFLTVFLGVISVQGATGAVTDGVTLRTAKYVTGNFVPVVGRVFSDAADTVISASLLVKNGIGLAGVVIIIFLCAFPAIKI.LTLALIYNVAAAVMQP..L.G.DNPII...GCLQTIGKSMIYVFAA..LAT..VG..L..MFFLSITIILTAG............
C9R8Z6_AMMDK/56-376                  ......................................................t-DFRQLVKDLIQ-GKLELTPSS.LLSALGRCLGQEIWQGGSLLGKLLVLGIVLAVLQQLGSAFE.Q.GTV.V...RLAFAVCFLALAATVASTLELALRIGRQTVEGVVSFLQALFPVLLTLLAATG........GMGAAALVHPTILLTLEVVGTLVKN........VVFPLLVFSV...ILSLVNQLS.E..ALPVSRLATLFRHAGLALLGICSTILLGIMGLQGVAGAVSGGLALRAAKYATGAFIPVAGSMLADAFEAVLSTSLLLKSAVGLAGMLVVLGAVAFPAVKL.GALSLLFKLAAALVQP..V.-.EGRLA...ACLDAVGAGLLGVFAV..VVL..VG..L..LALFSIGLVTG--la..........
V6MCD1_9BACL/69-389                  .....................................................lk--AKGFIQMLMQEGE--FSLSG.FLKGLMKFAFHEILMNGKLLSSIIIITVFAMILETMQNAFE.R.NTV.S...TVAYSIAYLVLMVLAINSFHLAITYAKDAIGNMSDFMLAMIPLVIALLASVG........NLATATMFHPLIIFMINISGMMITY........VVFPLLFLSA...MLSIVSMFS.E..RYKVTQLATLLRNIAMGVLGSFLTIFLAVISIQGATSAVTDGVTLRTAKYITGNFVPIVGRMFSDAADTVLNASLLVKNAIGLAGVIILVILCAFPAMKI.LVLALIYNLSSAVLQP..L.G.NSPII...SALGTIGKSLLFVFAA..LAT..VG..L..MFFLAITIIIAAG............
A0A1H0WJ22_9BACI/62-382              ...................................................sqkg----SLVEF-IS-GEKKLSLKE.WLLGFVKYLFYELIANGKLLSTLIMLTIFSTFLQTLQNSFE.K.SAV.S...KVAYALVYMVLIIIALNSFRLAIMYTEEAITTMTNFILALVPLLLALIASSG........GLASAAFFHPLILFLMNTSGMLIQF........VILPLLFLSA...LLSIVSTMS.E..HYKVTQLAQLIRNVSIGLLGAFLTIFLGVISVQGASAAVADGITIRTAKFITGNFVPVVGRMFTDATDTVISASVLLKNTVGIVGVVILLLLAAFPALKV.LSLAIIYKIAAALLQP..I.G.GGPVI...ACLDVISKSVIYIFAA..LAI..VS..L..MFFLSITVIIAAG............
E2ZIP8_9FIRM/56-358                  .....................................kdplksllallpgspaem----------------------.------------IRQMAHCYADVLLFLLLLIVLSFLVGGAA.D.SAL.L...ELAAAVGCG---TLLWGDLISLAQLICERMEGWKNYLLGFLPVYSGVLAAGG........EVNASTAASGLLLTGLCFLAQGTVL........VVSPLLQSYL...AVSMACCIS.T..QQGLSETCRVMGALLRRGLVWAGRIFAVLLGLQRAVTVQLDRSALRLGQLLTGG-VPVIGQALSDTAEVFLAGMQLLKSSLGFAALAVIGAEFLPLYLQL.LLHLLFLAGCRLLCGL..A.E.NRRCQ...ALFDCMAEAVKCMAAV..TAL..FF..E..LLTVGVGLLM---mtg.........
A0A0L6JLS8_9FIRM/53-374              ...................................................ydpn----GFITNAAK-GKFNLNIKS.ILNGVLRYFFKEIYINIGILIKLIVLIVLCAILKNLQSSFL.S.ASV.G...ELAFFVCYIVIVSVLIVSLNSVLTMGRGIIDDMVDFMQASIPILITLLISSG........NITSGGIFQPLLVVIVEIVATIMKN........IFIPIILLST...ILSLVNNIS.D..KVQISKLASFLKQTGTVILGLILTVFIAIITIQGSVGAVVDGVSSKTAKFAIGAFIPVAGKYLADAADTVLGCTLLIKNASGIAVMIGIVSICLVPIIKI.FALISLYKMTAVLVEP..I.A.ENRIV...KCINDVAGSLTFVLGV..VAC..VA..F..MFLIAITAIIAS-s...........
A0A1W1X103_9CLOT/58-380              ......................................................l-DIEDYVQNVMKSGDGKFSFKK.LITAVADYAVKDIIADVKLMTMLLIICVICALLINLQRAFS.S.ESL.S...NIAYFACYSLIIIIVAKSFYIGVAEVKDAVKGLSDFMMALMPVLLVLLATSG........GAVQSAVIDPIIMVTISITSEIIIN........VILPLIVLSF...VLQFVNNIS.E..DYKIDRLAKLLKQSVLWIQGFVMTIFIGIVTIRGISAKAIDEVTAKTAKFAVDNFVPVVGKCLSDAISTVVGYSAVIKNAISSVGLIILIAIVALPIIKL.FILAFVHKLTAALVQP..I.S.DKRLV...SVINAAGDTLILLAAS..LIS..IS..V..MFFIIIAIIASC-g...........
F4LVG3_TEPAE/66-386                  ......................................................y-SLNELIKV-IR-GEKSYDFNS.LLKGITEYFFREISINLHLLGELIILSMICAILKNIQSAFE.N.DNI.E...KVTYGFVFLVLSTIAIQSFNLALNIGKNAIDQMVSIIQALMPIILTLLASVG........GMTSVAVFNPLIFIGVTISSMWIRN........ILLPIIYFVA...VLGLISNFS.K..HLHVSALSTLLKQICVFLLGLFLSTFLGILVVQGAAASVVDGISIRTAKFASKNFIPIVGGIFSDTVDTIVSCSLILKNTIGFAGLVIILLTILFPVIRI.LTIVFIYKLAGAIIQP..L.G.EETMV...KCLNNMASHVTFIAIT..VGS..VA..L..MFFVAITVIIASG............
A0A259UUV1_9FIRM/59-378              ....................................................taa-----TIKDIAT-KGLDFNWQT.ISTTILSCLFKELATNVHLMGKLLFLAVLCALLQNLQNSFE.Q.SSI.S...LLAYSVCFIFLCVISLSAFYNGLTLARDTVGNMVGFMEALLPLLLSLLAGVG........ALTSAALLTSLMLLVISVTSVIVKD........IVLPLLFLTA...VLECVNYLS.G..TYRLSNLTGVLKQAGMMILGFVLVVFIGIVSIQGVAGSIADGLTLRTAKYATATFIPVVGKMFADTVELVMGASLLLKNAVGIFGVVAIALLCALPLIKL.LSLIIVMKIAGALIQP..M.G.DEKMA...KCLDAMGNNLLLVFGA..LLT..VA..L..MFFLIVTMIIAAG............
U5MSV0_CLOSA/101-423                 ....................................................lnp---VDYIKTYIANGKGNLSFDV.IGKAVLSLVFKEVKSVLKLIISVVTIAIICSLLKNLQDAFS.G.ENI.S...QVAFYACYALIIVVLAKSFIISISVAKEVISNISDFMSALLPILVTMIGLTG........GVAQATTLDPIVLACVVFIPKVYSN........IIIPMILMGF...MLEFANNLS.T..EHKITNLCGLLKQCTLWFQGIIITIFIALLTIRGITSKTIDAVTLKTAKFAIDNFIPIVGKTFSDAIASVAGYSLIIKNAISSMGLVVIVLLLLYPIVKL.VLMTFIYKLSAALVEP..I.S.DSRIT...KCLESAASSMILITSC..VLC..VS..L..MFFILIAIMAASG............
A0A0Q7SS52_9BACL/69-389              ...................................................ktps-----FMDM-LIPGNEGFSLKS.VFIAIGTFMLHEILYNGKLLVTIVMLSVLSMILETLQTAFE.K.NNI.S...KIAYSICYMVIIVIAINSFSVAIGYAKDAIEGMVSFMMAMVPLLFTLLASMG........NVVTVSVTHPLIIFMIHLVSTLIHM........LVFPLLFFSA...VLHLVSSLS.D..KYKLTQLADLLRNISVALLGILLTMFLGVISVQGASGSVADGVSLKAAKYIAGNFVPVVGRTFADATDTVITASLLVKNAIGLTGVIIILFLCAFPALKI.LTLALIYNITGAIMQP..L.G.DTPIV...GCLQAIGKSMIYVFAA..LAA..VG..L..MFFLAITILLTAG............
R6DW40_9CLOT/29-349                  .......................................................FSFSGYIDQILQ-GNLPFSVQD.TLQTILRGFAANIAQEKKMYMYLVLIALLGAILGNFAGLMQ.G.GQV.A...EVAFYAVYLLFFSVLLTAFTSIAQIAQATLESLFDFVRVLVPSFFSAMVFSQ........GSAGTEVYYQFTLCMIAAVDCVLVK........FVLPAIHIYF...LLQVANQIS.P..QDMFSKMADLIHDAVRFVMKAMFGIMMGINVIQGMIVPLTTKLEQSAFLKMAGA-IPGVGNTVSSVAGTMLCAGALVKNAIGAVGVIAVLFCCGIPLLRL.YLHKFLFQIVNAVIQP..V.A.DKRIV...QCISAMAQTVALLAYA..VFV..GC..M..MFVISIALMSVM-t...........
R5IX65_9FIRM/58-362                  .....................dpgeailavikwasglsvstlreavqtaslllta----------------------.------------------------------ALVCQLVRQSV.P.DDR.L...HIQAMTGALAITLLFATNMKSMLGLAASVLDEMEAYSKLLLPVMCGAAAASG........SLTGAGSLYMASSLFFSLLISLVRS........LLVPLVYAFI...GLAAAECAL.P..GGKLASVRRLVGWCITVLLKGVMYVFTAYLSLTGLLSGSSDDAAINAAKSTLSAAIPVVGGIASDASEAVLQSAKLLRATAGTFGILAVLALVLVPFFRI.TICYLTMKLTAAIAGF..A.A.GKEHA...ALIDAQSSAMGYVLGM..TGS..AA..L..MLLFSTC------cfmkva......
R6JQT3_9CLOT/112-432                 ......................................................l-SFWGLMKELMK-GNLKGILGQ.TGMGLKNALFSQVDRGGQMLFQVAAIGLIGAVFTNVSSVFK.G.GQI.S...DTGFFVTYLLLFTCLAASFSASLQVAAQVMEQILEFMKLLMPAYYMAVAFSG........GSMSALALYECMLGAVTGVQWLCST........VLLSMVRIYV...LMVLGSHVA.K..EALLSKLTELLEQAVVWSLRTLTGLVVGFHLIQAMILPYADAAGQAGMKRLMEM-IPGLGQGAGAMAQMVLGSGVLIKNTMGAAAVVVLAVISAVPVMKL.TVLMVMYQCVAAVMQP..V.C.DKRVV...SCVAGVSKGHKLLLQI..VLY..SM..F..LFMIAIAVTCAST............
R9N9C2_9FIRM/88-408                  ......................................................l-EFKETLAGILS-GDLSFSAGL.LNRLVADQLSYAFRSSRDNLIHMLLIAVIAAVFGNFSRTFK.S.RQI.S...DISFYAMYLLMIALTLNSFRMVTEWVSEGIEGITSFMSVFCPLYFLAVSIAK........GSVTSVAFYNLVLFLIFLTEFLILN........FLLPLIHVYM...MVRALNYLS.E..EDYLSKFAELIEMAAAWILKTLLACIVGLNVIQGLISPAIDSVKRSAVTRGAEA-IPGVGEIIGGMAEVAFGTAVLVKNGIGMAGAVISISLCMIPLVQV.AGIVFLYKLAAAVIQP..V.S.DKRIA...GCVETVGEGCRLLLRV..VFT..VS..L..LFLLTIVVVSAVT............
A0A135WRD7_9BACL/1-293               ........................................miaffqnivgsvlnn----------------------.-----------------------FIIVIIATLMALFID-FL.F.PTF.S...KWTRMFLLFIVITIVLQPAFEHLVLIQKIAHSISMTFLSIYPVLTAAMIASG........GAFGMLNFQPAMLLFANGAVFLTER........LLIPLLTAAI...VLDLASRLL.P..EVSFSKMSDLIRTTLLGLVSALVTAYSIFITTGGTMSWAMSGFASEPIKELVRQNVPFIGSFMTESLGAIGKYSSGAAIFAGGWLITSIWTIALVPTLKT.LFTAFLYRWTAALIEP..F.A.DEDIT...GVLDDIGKTLFVLCAV..SFL..IA..F..ALIYTAL------ftvilvk.....
A0A0K9GAV9_9BACI/72-392              ................................................sqkgsff--------DFIS-GEKKFSFKE.WLSGIIQFIFHELIANGKLLGTLILLTVFSVFLQSLQSTFE.K.TSV.S...KVANSIVFMVLMIIALNSFYVAVNYVTSTISQITDFLIALVPLLLALIASSG........GVLSAAFFHPMLLFLMNTSGALIEY........IVLPLLFLST...LLSIVSMLS.E..HYKVTQLAGLLRTWSVGLLGIFMTVFLGVISVQGISTAVADGIGLRTAKFLAGNFIPVIGRMFTDAADTVIGASLLLKNTVGIAGVVMLLIMAAFPALKI.LLIALVYKFAAAILQP..L.G.AGPII...KCLDVIGKNIIYVFAA..LAI..VS..L..MFFLTVTVIVAAG............
R5HR35_9FIRM/1-115                   ......................................................m----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..---------------------------------------------KAAKFTISNMVPVVGGVISDTAETLLAGASVLRNAAGVFGMLAVIGICVVPFLNL.GVHYLMYKCTAALAAT..V.SaDGRIT...GLIEALGTAFGLILAM..TAS..CA..V..LLVVAMVST----vsav........
X4ZNT4_9BACL/120-439                 ....................................................tps-----LMDMLLP-GGQGLSLKN.VLSGLLSYMWHEVLYNGKLLVTIVMISVLSMILETLQTAFE.R.KAV.S...KVAYALCFMVVMVIAVNSFNIAIGYAKDAIDRMIDFMMAMIPLLFALLASMG........NVVTVSVTHPLIVFMIHTVGTLIHT........MVFPLLFFSA...VLHLVSSIS.D..KYKLTQLANLLRNIGTGVLGVLLTVFLGVISVRGITSSVTDGVTLRAAKYVTGNFVPVIGKLFADATDTVISASLLVKNAIGLSGVIIILFLCAFPAIKI.LVLALIYNVAGAVMQP..L.G.DTPIV...SCLQTIGKSMIYVFAA..LAA..VS..L..MFFLAVTILLTAG............
A0A179SY26_9BACI/71-391              ..................................................sqkgs-----LLQF-LS-GEKELSFQE.WMKAFLKFLFHELLANGKLLGTLILLTVFSMLLQLLQNAFN.Q.SAV.S...KVAYALVYMVLIIIALNSFHVAIQYTNNAIQSMTNFILALIPLLLALMASSG........GLASAAFFHPVIIFLMNTSGLLIQN........IVLPLLFLSA...LLNIVSTLT.D..QYKVTQLAGLLRNISIGLLASFLTIFLGVISVQGASAAVTDGITIRTAKFITGNFIPVLGRMFTDATDTVISASILLKNTVGVIGVAILLLIAAFPAIKV.LSLAFIYKFAASILQP..L.G.GGPVI...ACLDIISKSVIYIFAA..LAI..VS..L..MFFLSLTVIIAAG............
F5SB04_9BACL/72-393                  ................................................qprdlfd--------LAGSSGKGATDWKA.YLTAFGRYLFQEVLYNGKLLGTIIVLTVFSMILRTLQTAFE.R.NQV.S...KIAYAIAFMVIIILAVDSFSVAVESAQTAISRMIHIMMALVPLVLTLLASMG........NLGSVGMFHPMIVLMIHIIGTLIHA........VVFPILFFSA...ILSIVSCLS.D..KYKVNQLAGLLRKVSVGILGSMLTVFLGIISVQGATAAVADGVTVRTAKYVTGNFVPVVGRLFSDAADTVVGASLLVKNAIGLVGVILLLLIIAFPALKI.LSLALVYSFSAAVMQP..L.G.NSPII...ECLSIISKTLIYIFAA..LAT..VG..M..MFFLAITIIVAAG............
F6CL73_DESK7/65-386                  .......................................................FNFKEMVMKLIR-GEIDLSAGE.LFRSLLSYLFREVVANSALLGKLVVLAIICVVLQNFTAAFD.R.GTT.G...QLTHTVTYLVLVTIAIGSFALAVQTGREVVDKMVTFMQALMPVLLTLLVALG........GVASAAIFHPVILVSITFIGTLIKN........VVLPLVFFSA...VLGLVSHLS.P..RFKVSGLAGLLRGAAVGLLGIMGTVFLGLLAIQGVAGAVGDGVVLRTAKFSLDAFIPVVGGMFSDALEAVISSSLLIKNALGIAGVVAVVMIMTLPLVKL.ISLAFIYKLAGALIQP..V.D.DSQVV...ACLSDLGNSIIIIFAT..VAT..VG..L..LFFFTIAILVGVG............
R6UG59_9CLOT/70-382                  .................................................swqeln----------------SMSFFD.IFGSIMNTIQQQSVTPLNCVVKIMGVVMLVALINSVKSSLG.S.SSL.T...AVLNSVATLTVSIILIQPVCQTIEYSTTIIKLSADFMLIFIPVMAGIMLTMG........QSLQAAGSYTMVMGAGTAVSQISNN........ILVPLLNTFL...GISVVSGIS.Q..RVNLSGFCELINKVLKWVLTFTMSVFTAILTMQSIISSSADSAGVKATRFAISSFVPLVGGALSEAYQTVRGCMGMLKSGVGVFAILATGTIYLPAIISC.LLWLAAINIAIALAGV..F.D.MGDII...KLLKSVTTVINSLIAI..LLC..CM..I..IFIVSSAIMLMAG............
R9K4H5_9FIRM/126-446                 ......................................................l-RFSDVTASMMS-GDLTETGKL.LLEYAGDQLNYEFRINRKNLVYMLLIAVIAAIFTNFSGAFQ.S.RQV.S...EISFYVLYMLLITMCLTTFRVAMEGLEGKLEALLDFMRLLCPGYFMAVSLAS........GTSSSLMFYGMVLILIYMVEVLVLR........LLLPLINVYI...MIQVMNYLV.G..EHVLSELADLIRKLITWILRSLLGFVVGMNVIQGILSPTIDTLKRSTLTKTVEA-VPGIGNLFGGVTDVLLGTAVLIKNGIGMAGAVILVLICSVPVIQM.AAMTFLYKFAAAMVQP..V.S.DKRIT...GCIRSVSEGYRLMLKV..LYT..TL..I..LFLITIAVVAAST............
A0A1H0MYZ2_9CLOT/84-406              ...................................................ldpi----EYFKSYLESGQGNLSFEK.VGGAIVSFLFKEVKTVLSLSISIVVIAIICSLLKNLQASFS.N.ESI.S...NIAFYACYCMLIVILSKSFLVSLTIATDVITKISDFMSALLPILVIMLGSAG........GFTQAATMDPIILGATLIIPRIYLN........VIIPLILMSF...VLQFANNMS.S..EHKIDNLCKLLKQITLWLQGIILTVFIGLLTVRGITSSTIDAVTLKTAKFAIDNFIPIVGKSFSDAIAAVAGYSLIIKNAISSIGLIVIILLMLYPVLKL.ILLALVYKLSAALIEP..I.S.DKRIT...SSINAAGESLILIMSC..VLS..VS..L..MFFILLAIMASAG............
D1PKW5_9FIRM/26-337                  naamqevsgwqlrdvlnwltdlagmnlqeplrfvwqvggylllagalgllvtgdt----------------------.-----------------------------------------.-.--W.H...RCLESVSLLGFGTISLGAMMSLTDAVVTTAQNCQNYLITFVPVYSGVAAMGG........QSAGALVYSGMFLTMSSFLAGMIRV........VLLPVMQIYF...CFTACACIW.G..NPGIEEAAALFAKILHWALRLCGIVFGTVLGLQNILAGSVDTAALRTGKSVLQGFIPVVGDAAAAALSGAAAAVQLLKGSLALAALAALSVAFIPILVQC.LLYTAAFAAAGVTASL..F.G.QKQCG...RLCRLYGEGSRLCASV..LVL..YF..F..MAFLSTALLLLT-g...........
F3BA00_9FIRM/60-380                  .......................................................IDFGETVKSVIN-GDMKFSVEL.LEKLISDQLFYEVRQNKKTIVHILLIAIIAAVFTNFSNVFQ.N.QQI.G...EISFYVLYLLLITICLSTFQILIDSVGAHLENLTMFMRVLGPLYFLAVAIST........GSGTSIIFYNLLLFLIYIVELLILN........FLLPLLHIYM...VIRVLNNLS.A..EEYLSKFAELIEFIVTWTLKTLLAAIIGLNVIQGLISPAIDSLKRGVLTKGMEA-IPAIGDALGGTAEIILGTSVLVKNGIGVTGAIVCITICVIPILQM.FVMAFLYKLTSAFIQP..I.S.DKRIV...GCVSGMGEGCQILLRV..VFT..TG..M..LFLLTIAIVTATT............
A0A1C7I7N5_9FIRM/171-490             .......................................................FSLEDALHKILS-GDKLFSKEY.FMTLIKNFLYKNLAAERDTMIHVVLLVLMAALFSNFSNVFN.N.GQM.G...EISFYIVYMLLLAALVHSFGTLSIEISEGLTGFVTFMKALMPSYFLAVTAAT........GSATAMVFYEVVLVLVYVVQVIFLK........GVLPGIHIYV...LLQLVNFLH.S..EDFLSKMAELVRTVVEWTMRTCIAVVIGMQIIQNMIGPAIDTLKRDVIGKTAAA-IPGIGNAINGVTEVALGTAVLVRNGLGVIGMIVILCVGLPPVIRL.GMTTLLYKLLAAIVQP..I.S.DKRMV...GALATIGDGCMLLLKV..LLT..ME..L..LFLITIAVLTI--s...........
A0A0A2U157_9BACL/69-389              ...................................................ktps-----FMDMLMP-GNEGFSLKS.VFIAIGTFMLHEILYNGKLLVTIVMLSVLSMILETLQTAFE.K.NNI.S...KIAYSICYMVIIIIAINSFSVAIGYAKDAIASMINFMMAMVPLLFTLLASMG........NVITVSVTHPLIIFMIHLVGTLIHM........LVFPLLFFSA...VLHLVSSLS.D..KYKLTQLADLLRNISVALLGILLTMFLGVISVQGASGSVADGVSLKAAKYIAGNFVPIVGRTFADATDTVITASLLVKNAIGLTGVIIILFLCAFPALKI.LTLALIYNITGAIMQP..L.G.DTPIV...GCLQAIGKSMIYVFAA..LAA..VG..L..MFFLAITILLTAG............
B1I3B1_DESAP/59-380                  ......................................................l-DFKSLVASLAR-GELGYTPGN.LAAAIWRYFFKEVLASAALLGKLVVLAVICAVLQNISGAFE.K.STT.S...RMAYTAVYLALITIALGSFVIALNTGREAIENMVVFMHAMLPVMLTLLCAVG........GFASAALIHPVIVIVMNAAANVVKN........VVFPLIFFSA...ILGMISHLA.T..GFSLSRLADFLRFVGLGIMGVLTTVFLGVLTIQGVASAVTEGIAFRTAKYASQAFLPIVGKMFSDAMEMIVGSSLLVKNAVGLAGLVLIFLMALFPLLKI.IVLVFIYKLAAALVQP..L.G.ESRLS...ECLNTLGNSIVAVFGV..VAT..CA..L..LFFFALALMAGL-g...........
N4WAX1_9BACI/65-385                  .................................................mdkadi------WSM-IR-NEDGLSLES.WFQGVLRYLFYELIENGKLLATLILLTLFCLLLQTIQNAFE.K.QMV.S...KIAYAVVYMMLIIISLKSFHLAATYVTDTVDLAKNFLIALLPLMLGLLASLG........NLLTISFFHPIIIFLIHTSVLIISN........VVIPMFLISA...ILQIVSTIS.Q..EYKATKLANLIKNIAIGILGVMLTVFLGVISVQGAASAIQDGIAMRTAKFVTGNFIPVIGRIFTDATDTVLSATMIIKNGIGLVGVVILIAIVLFPALKI.FVLALIYKIATAVLQP..I.G.DGPVI...ECMEIVGKHILYLFAA..LLM..VT..F..MFFFTIVILIIS-s...........
Q5WF51_BACSK/70-390                  ...................................................sqkg----QLIDF-LK-GDKQFELKE.WGVSLVKYLFHELIVNGKLMGMLLLLTIFSYILQSFQTAFE.H.QTV.S...KTAYAVTLLVLAMIAMNGFHTAITYATEAINSMVHFTIALLPLLLAMMASIG........GASTSALFHPIIIFLVHTSGLIVNA........VVLPLLFISA...VLGIVSTFS.D..HYKVTRLANLFRTGAVGLLGICMTVFLGVVSVQGTTTAAVDGLTLRTAKFIASNFVPVVGRMFTDATDTVASASLLLKNTIGMSGLVILLAICAFPAIKV.LSIAFIFQISAAVLQP..L.G.DGAII...DCLGIIGKAVLYVFAA..LAL..VG..F..MFFLAITLMVAAS............
R9JPC6_9FIRM/33-353                  ....................................................tds---MDFIEDVLK-GNWALDPAL.FWRYIAGTITGVFDDWRRLFISVLVLFILVALVSNLMSALK.N.EGA.A...KAAKTFFIVCQLVVLINAFHEVLGIVEEAMTRMIEFLKLMIPAYMICIAAAG........SGLTALIFYKLLLGFLCLIEGIVAA........SLTTVVEGYV...MLGVVESVW.G..EERFKGLMDLIKKGLQWVLKMMIVVMSGSSILQVIITPVVDKTNNAVIQKTAGA-IPGIGDVIESVSSVTLASAIAVKNSLGVLILVALILLIAAPVIKS.FMILLIIRVSGALGSI..C.G.EKQMM...KCVEYISEAGFMLLRI..LIT..VT..T..LFFVTIAAVTNAT............
M1MJK6_9CLOT/91-413                  ....................................................lep---AEYIKAYIKDGKGNISLNT.MFNAVTSLVFKEVKEVLKLMVSIVTIAIICSLLKNLQEAFS.D.ESI.S...QIAFYACYVLMIIVLSRSFIISISIAKAVINDISNFMSALLPVLITMISLSG........GITAATTLDPIVLGAVVFIPKVYSN........IIIPMILMVF...VLEFANNIS.N..EHKITNLCKLFKQITIWFQGIIVTIFIGILTIRGITSSTIDAVTLKTAKFAVDNFIPIVGKAFSDAITSVAGYSLIIKNAISSIGLIVIILILLYPIVKL.MLITLIYKLSAALVEP..I.S.DSRLT...KSIEAAGNSMVLIISC..ILT..VT..L..MFFILIGIIASSG............
A0A0B0HTX2_9BACL/68-388              ..................................................kvpsf------MDI-LLPGGEGFSVKS.VLAALGSFMWHEVLYNGKLLVTIVMLSIMSMILETLQSAFE.R.KTV.S...KVAYALCYMVIIVLAINSFNVAIGYAKEAIDRMIDFMMAMVPLLFALLASMG........NVITVSVTHPLIIFMINTVGTLIHT........LIFPLLFFSA...VLHLVSSLS.D..KYKLTQLANLLRNISVGFLGVLLTIFLGVISVQGITSSVTDGVTIRAAKYVSGSFIPVVGKMFADATDTVISASLLIKNSIGLVGVIIILFLCAFPAIKI.LVLALIYKVSAAVMQP..L.G.DSPIT...TCLETIGKSMLYVFAA..LAV..VG..L..MFFLAITIMLTAG............
A0A285TUN0_9BACI/1-296               ......................................................m----------------------.--NDLLNIFIDPLKIAGQSIILILTYTILFLVIEAFIPKFK.-.---.-...KWADTLFIIVLILTLGQTVMDSFSLMGQLVNIASDFFLGVTPILTSLLVVLN........SVFSFIAWSPVILFIFEMLMLLCKN........ILIPAVTVAL...VLDFCTRFI.Q..DVSFSKASDLIRGSVMTMITALLLGMVTVLSFTGVAFFTIDQAIASPAKKVIEQTIPIVGSLIVEGFSIFQKYQSTATTVAGFSAMTAFWIAAFFPAGKL.LIHALTFKFLAAIVEP..F.S.GGTIS...GLLDDVGKSLLLLCAV..AIL..LG..I..AFVFIWLILMV--imq.........
A0A0D1WB59_ANEMI/73-392              ....................................................egk----SLFEM-VT-GEKAFSFSG.VVQGLGFFLFHELLINGKLLGAILIITVFAMVLETLQTAFE.K.NSV.S...TVAYAISYLVLIILAVNSFRVAIDFAQGAIQDMVNFMLALMPLVLALLASTG........GITSAALFHPMVVFLVNTSGTLIST........IVFPLLFLST...VLSIVSSFS.V..KYQLTRLAQLLRTISLGLMGSFLTIFLAVLSLQGATAAVADGVALRTAKYIAGNFIPVVGRVFADAAETVVGASLLVKNAVGMAGVLVLLLLVAFPALKI.LILAFVYNLSSAVMQP..L.G.NSPIL...SCLGIIGKNLLFIFAA..LAT..VS..L..MFFLAITIVISA-a...........
A0A1I3U4D1_9BACL/68-387              ..................................................qspgf------IQLLMQQGE--LSISG.VLKGMGKFVFHEILMNGKLLSSIIIITVFAMILETMQNAFE.R.NAV.S...TVAYSIAYLVLMVLAINSFHVAISYAKDAITDMSDFMLAMIPLVIALLASVG........NLATATMFHPLIIFMINISGMMISY........VVFPLLFLSA...MLSIVSLFS.E..RYKVTQLATLLRNIAMGVLGSFLTIFLAVISIQGATSAVTDGVTLRTAKYITGNFIPIVGRVFSDAADTVLNASLLVKNAVGLAGVVILIMLCAFPALKI.LVLALIYNLSSAVLQP..L.G.NSPII...SALGTIGKSLLFVFAA..LAT..VG..L..MFFLAITIIIAAG............
R5DFA7_9FIRM/82-402                  ......................................................y-NLEEMLRK-ITEGDYEEFLSQ.AGKMLRDKLFQAVESGRKYLIPIVFLAFLAALFHNFSQVFE.S.GQL.S...ETGFYVLYLLLIALCLKVFLAVTEWVSTGVEGLTAFMGVFCPLYFLAVAIAK........GSVTAIAFYQLVLFIIYLVELVIAK........ILLPMIHIYM...ILRLLNYLS.K..EDYLSKFAGFLEMLVSWTLRTMLAAVVGWNLVQGLIGPSVDDVKQSLVTRGMEA-IPGVGDLLGGAAEVTIGTLVLVKNGIGVVGALFAVLLCLVPLVEV.GLVVLLYKFTAALLQP..V.S.DARVI...GCIESVGDGLRLFMRV..LFT..TG..L..LFLLTIVVVAATT............
A0A1I5UNI2_9FIRM/18-331              ............................................dvstllqgihs-------------------PGF.VFEQISELFAKGFLVDRKSFVTLAVLCLLFGAISQLILAFG.E.NGF.G...QYGGTMFFICGAGICMRLFLHCYTLVGGCLEAVCRFLTVLTPVYGMSILFAD........GMGAASMIYAALMGEITVFEMLLKS........VCLPCAKLLL...AFHFSNACT.G..QHLLKRLGRLLFDGTTCLMKGMLSLVCGFNVVQALVALGSEAVIQNGVKKAAML-LPGIGPVSSACFGMITGVAHALKNSIGAVGLLCVGLIFLPPLLSI.LGYLAAFRILEACLRP..F.A.TDSMV...TMLTGAYESILLLFKV..LVY..AV..T..FVFVSLSILTML-t...........
K4L228_9FIRM/88-407                  .......................................................FSLTEIFES-IKNGEVNFSLQG.IGSSIVKALLKQVVTNAPLIAKLLVLAVICAIINQLQSAFT.-.GEV.S...RIARMLVYLVLLALAMTSFRIALDVGNASIDNMVSFMQIILPAMYTVLLTMG........SLTSAALFKPMVIGSLIFLATVIKN........IVLPLFFLSI...ILRLFNNIS.E..QFKLSKLASLLEFGGKLSIGIVMTVFIGIMSVQGVTGGVADGVTLRTVKYAADL-IPVAGKFFKDAVEIVASSGLLLKNALGIVAMIAIIVITFLPAIKI.IAMMFTFKLAAALVEP..L.G.EKELA...DSLQDMSKGLLYIFVT..VTS..VG..I..MFFMTIVIIVGTG............
A0A0A3J3I1_9BACI/1-290               ......................................................m----------------------.------SALLKPLTESISMLIMLLFLFLLIVIIEGVAK--Q.S.---.K...QFLSTIFLFLILVIVTKHLVEAFTLMKDLASMFSHFFLGFIPLVSTVLVIVQ........SVISFVAWSPAIVFVLQLLVYVCDK........LLIPSLFTAL...VFDVCTRLY.P..QVSFLKIAELIRKTVFSIIAASILLLSSILTFSSVAFFSIQETLSTPLKKVIEQNVPIIGSLLVEGMSLLKNFQSTATTITGFTTITALVLMSFYPAATL.LIKAFTFKLAGAIAEP..F.V.DSRIS...QLLDDIGKTLFILCAI..GLV..LA..I..GFIVIWLIL----ffi.........
A0A150M7H4_9BACI/74-393              ..................................................ktgdv-------TDFIK-SAGSFSFKD.WGTGLLKYAFQELLINGKLLGSLLLLTIFSMFLQMLQNSFE.T.ASV.S...KIAYAIVFIVLLIIALNSFHIAVSYAEKAVGRMVHFTLAFIPLFLALMASGG........AVVSAGFFHPVLLFMANVSGMFVQK........IVFPLLFLSV...LLNVVSTLT.E..HYKATQLAGLLRNWSIGLLGLFMTVFLGVISVQGGAAAVADGVAVRTAKFLTGNLIPVFGRMLTDAADTVIAASLLLKNMIGVAGVVMLLFSVLFPSVKI.LLIAFFYKLAASIMQP..L.G.GGPII...ECLSIISKSVLYIFAA..LGI..VS..M..MFFLSLTIIIIAG............
W4EQD6_9BACL/1-294                   .....................................................md----------------------.---WLQEILVAPFKDTLFTLVSLLFYALLFLLLNFIMPQF-.-.---.K...EWTRVFFFIAILTTTLKPVYQSFTMMQALSENMIAFFSALYPILMSAMAISA........GAMSLMAWHPMLLLLIQFAVFLTGR........WLIPLLTASL...IFDFLSRFM.P..EISFARMADFIRVLVLSVVSATVMCYSMFLVMNSVVSVSFTGAALGPLKKMIQQNIPFIGSFITESLSTFRKYSSTTATVTSTGLMIGIFTAAIIPTLKI.LMTGLSFRFLAALMEP..F.S.DKDIA...SFLDDIGKTLFVLCAV..SFI..IA..F..AFFFTAILAV---il..........
A0A2A9CI29_9BACI/70-390              .................................................sqkgsf------L-EFIK-GEKQFSLKA.YLLGLLKFLFHELLVHGKLLGSLILLTIFSILLQNMQNAFE.H.KAV.S...TVAYGIIYMVLIILALNSFHVAIQYTESAIANMMGFLLALIPLLLALIASVG........GVASVAFFHPIVLFLVNTGGLLIQK........FVLPMLFLSA...VLAIVSTIS.E..QYKVTQLSNLLRNIAIGTLGVFFAVFLGVISVQGASTAVADGVTIRAAKFVTGNFIPVVGRMFTDATDTVLSASVLLKNTVGLAGVVILLMICAFPALKV.LSLVLIYNIAAAVIQP..L.G.GGPII...QSLNVISKSILFIFAA..LAI..VS..L..MFFLAVTIIIASG............
R6ZV06_9FIRM/59-379                  ......................................................i-DAEALFMMILE-GKVLTAVGE.LASQLKGCFVSEIAGMRQVFLSILVLGVLSALFSGFSDLFA.G.QQM.V...EAGFYFLYLFLIMLLTRVFMTVSEIATQAVENIILFVRLLIPTYFVAVGTAC........GTTTAAFYYEMMLVLSYLVERFLGA........FLIPFIYSYV...LLALLNGIW.I..EEKLTLLLDFMKKAIQMALKISLGAVTGLSLVQAVIVPVADQLKISAMRKALSA-LPGVGNLAEGVTELMIGSAVLIKNSMGVFLLLVLLAGSILPLLKI.LLAAGAVKLGAAVAGI..V.S.DKRLS...GCTDRVGEGCLLLFRC..VFT..AM..A..LFLIVIAVVAY--mv..........
C8WXI0_ALIAD/87-404                  .....................................................ps-----LIQSVLEHGG--PSFHG.MVSGLVHYFFQEVVDDVGLFGGLLILSVAAVLLRMMQSSFA.E.ESV.G...EVAQMVVSFVLAALVTRSLVETFGSARQAIESMNHFMLATMPVSIALLAGSG........SLASAAFFQPMLIFCVHFVSNVVFL........VVFPLVFLAA...VLELASSMA.P..RYPLTRLASLARTAGLAVLSFALVVFVGVTAVQGTGRGIADGLALRTMKFGVGTFVPVVGKAISDAAETVLGASLLVKNAVGIAGLVVIALMAAFPAMKI.LAVSAMYSAGAAVMQP..V.G.ETPII...ACLGALGRTMLLVFAS..VAT..VA..L..MFFFAICILLAA-a...........
A0A0M3DKQ0_9FIRM/65-386              ......................................................v-DLKTFMKDLIS-GKKTMLDLF.DKEGLKLFLFDELRASLKVASIIFVLALLSSILKSLDNSFS.S.GAI.S...QVTTYIVFIVMVTLTLVGFKDVLNICNTTIDSMINLMQILMPILITFLVVMG........FPMTSTVMTPIFMGGVTFINIVFKN........FLFVSITIGF...AILVINNLS.N..SIKLKKLASFIKQINLITIGAIFTIYLALVSMQGMYVKSLDGFAVKSTKFAIGNFIPVVGGFVSDSFDIILSSSQLIKNLFGGVGLIILVGICLIPIIKI.ISIILVYKTSAMIVEP..V.G.EDSIS...NFLNEISNLMAIMLAC..IIA..IT..I..MFFVTIAIVVSI-s...........
A0A1E5LKG6_9BACI/51-371              .................................................shkgsf-------YDFIKSG-TDFSFQA.WITGFLRFLFYELIANGKLLGTLILLTVFSMLLQSLQNAFE.Q.KSV.S...HVAYALIYMVLIVIALNSFHIAISYTNDAIQSMISFMMALMPMLLALMASIG........GITSVTFFHPLIIFLVHTSGLLIQY........VVLPCIFLSA...LLSIISTLT.D..HYKVTQLAQLLRNISIGLLGTFLTIFLGVISVQGATAAITDGIAVRTAKFITGNFVPVVGRMFTDAADTVLSASLLLKNAVGIVGVAVLFLIAVFPAIKV.FALAVIYKIAAAILQP..L.G.GGPVI...TCLDIISRSVIYIFAS..LAV..VS..F..MFFLSVTMIIAAG............
R7JX31_9FIRM/57-376                  .......................................................FSFAGTVRSLLQDGD-PFRTFR.AGNAVLSCAKTAFLAQKGLMKELFLLVLAGAVLGSFSSLFE.G.KQV.R...DASFYMVYLLALALILKNFQSSGENLKAVITSLVAFMRILTPSYYLAAAAAG........GASSAVMFYQMLLLVILAVEKLLLA........LVLPMIHIYL...LIALVNDLS.G..EEILSHMTELLETCVNGLLKSSLGVLVGMQMIRNLIAPALDSLRQMALWRTAGM-IPGIGNAVNAVTELVAGSAVLIRNCFGVTAMLVLLAAGMVPAVQL.LVSGLSFRLLAAAAQP..V.S.DKRIA...GCLAAAGKGYAMLLRL..LLT..VE..V..LFLLTIAILAG--t...........
R5TZG3_9CLOT/87-407                  .......................................................LSFKQMMKDIMA-GRLGDVMGQ.IGTSIRDALFSEVRNNSHMMGQIIILGIIGAVFSNFSNVFT.G.SQI.S...ETGFFVTYLLLFTYLAASFFTSITIAGSVVNQILGFMKALMPAYFLAAAFAG........GSVSAVASYEFTLFAITVAQTITAS........VLLPMVKVYA...LLVMAGHIA.K..EDILSKLTDLLNDVITWSLKTMVGIVLGFHLIQGLVLPYVDSMKTGAVQKLIGI-IPGVGQGASAVTQMVIGSGVLVKNTMGAAGVVVLVIITLIPMLKL.VILMILYQCVAAVLQP..V.C.DKRIV...SCISDMARGHKILLSI..AAS..AI..V..LFVVTVAVVCAST............
A0A1I2MV85_9FIRM/66-387              ......................................................t-DFRSLVTGIAT-GKISLQPTE.IFNQCIKYIFREVVANSALLGKLVVLAVICAVLQNLTGAFE.K.GTT.G...QLTHMVAYLVIITLAIGSFGLAIHMGREVVDKMVIFMQALLPLLLTLLVAVG........GIASAAIFHPVIFLTIAVFGTVIKN........VILPLIFFAA...VLEIVNGLS.K..HFQVSRLAGLCKGAAMGLMGLMSTIFLGVMALQGVAGAVGDSLTFRTAKFATGTFIPVVGGMFSDALEAVIRSSLLIKNAVGIAGVLIIAMIVVIPLIKI.ITIALIYKLAGAVIQP..V.G.EDRIS...DCLNGLGNSLITVFAA..VAT..VG..L..LFFFALAIVVGL-g...........
R5E784_9CLOT/57-376                  .......................................................ISFQDIFRILMT-GDVESALQS.ALEKFYQGMLSEVMENRILLIKLMLLIVIAAIFHNYSSILK.V.SYV.G...EQGFYITYLMIAMLLMQSFSLVYDMAEEMICYVKDLMECLLPAFYMSVVLCS........GFTTSQMVNSMFLYMLSILEKLLLY........LVLPTIRIYF...LVVVLNQIQ.S..KDRFSKLAALIKQAVQFVLKAVGTGIIGLNVMKSILVPVYDNAKYNVLQKGLSV-IPG-GSSFSALGTILLGAGVLIKNCVGISVVILLLVLGGIPLLKM.FTFYISFKIILALVQP..I.S.DNRII...AGIQGACDSTGVLVRA..AGT..SL..V..LSVLSVAIVILT-t...........
R6MJ91_9FIRM/83-403                  ......................................................l-HFQDLVESVIR-QDENLSAGQ.IRNFVTDQFFYVLKVNKPVLASIIFLVLIAAVFSNFSEVFQ.N.CQI.S...QTAFFLVYLSVITVGIRNFQAAAVEVQHGLENLILFMRVLCPVYFVCMAVAV........GSISAIAFYNLALFLIFLVELVILK........WIVPLIQIAL...LMEILNNLT.E..EEFLSKAAELLRLVIGWSLKSLLALVTGIGFIERIISPAADQVKRSVWTKGVGM-IPGIGDVVSGTSEVVLGSAVLLKNGVGIAGALLVTGVVMIPVINM.GILTLLYKGTAALIQP..V.S.DKRIV...EAISFTGEGYHMLLKT..VLA..TA..V..LFLVTLAVAASA-a...........
A0A0F2JML4_9FIRM/64-383              ......................................................f-SLVRIFDD-LKSGKLSLRPEN.IGHTLLALLGHQILGTAPLIGKLLILAVLGAVLGQLQVAFE.-.GSV.G...KTAQVMTYLVLLSLAITSFREALSIATGAIEQMTSLMQTMFPVILTLLITMG........NLTSAALFKPLVMGSLTVLATMIKT........IILPLFFLAA...IIKLFNHIS.E..QFRLNKLAGLFEFAGKLSLGVIMTVFIGVMTVQGVTGGVADSVVFRTAKYSADL-IPVVGKFFKDAVELVITSGLLLKNAVGIIALIAIIIICLGPLVKI.LAMILVFRISAALIEP..L.G.EKALA...DSLQDMSKSLILILVT..VAS..VG..I..MFFMSVAVVVGTG............
F2F909_SOLSS/1-296                   ...................mqtiysiftepiqslvyslllvaiyilmyllllalv----------------------.-----------------------------------------.P.KET.A...LI-EQLFIILFIVVFAQNVVDAFVVLYELIAILQNFFMAILPIMSFMLLTIQ........TVFTAIAWNPIIILFVQVILFISTN........VTIPALILAL...IFDVCTKIY.P..AISFSKAADLIRSSILSVMIASVIALTSILTLSGVAFIQLNDALKSPIKKLIEQNIPLIGNLIVEGLSFFQKTQSTVSTFVGLSFLTIIWGAAFYPATVL.LLHALLFKIIGAIIEP..F.T.NMRIS...GLFDDVGKTMFVLCAV..AFLlgFA..I..MFIVLLFI-----ffmq........
A0A1Y4J1I4_9FIRM/36-346              .................................................vtaeef---------------QSFSAPQ.LLEKLLGTAKEQFEQPFRLLASVSATVLIAAAALSLL---P.G.SDW.R...TPLETVCLLGISTAALQPMLPLLEQLTERIQECQTYLISFVPVFSGVMISCG........QPTQAAVYSGMFLTMAAFCAQMISV........VALPLVRAFL...ALTVAGGLC.E..LGGLSDGCAVLHRIVKWILGLLSILFGGVLGLQSVLAQNTDTLAMKTGQFLLSSGVPVIGSLASDAMGSVLSGLRVLKGTLGFAAIAVLTVTFLPLLIRC.FCFYLAYLLSAALAKA..F.G.LSRAG...RVLEGMGQATGLCISF..LVF..FF..M..LTVLSTALMILL-g...........
A0A285BJF6_9FIRM/60-381              ......................................................t-DVKTYIMNVLK-GKETFNAKD.IFNNILKILFKELMTSSGLLMQLILLAILSAVLTNLESSFE.R.EGI.S...QIAHLAVYAVLIIVAIKSFMGVLNIGRDAINSMVDFMQAILPVLITMLVSVG........AYVSASFFQPAIIMAVEFTAQVIRD........FIFPAILFMT...VIKIVSRIS.D..KFSLNKLSDFTKTVCTASISILLSIFIGIITIQGITSSIADGVISRTTKYAVGTFLPIVGSILSDSIDAIMGASFLIKGAISTFGLIAIILISIMPIIKI.LTLMIIYKLSAAVIEP..I.A.DKRIV...DFISDIATSIAYIFAA..LVS..VT..I..MMFLSITAVINA-a...........
F3AI43_9FIRM/76-396                  .......................................................MDFSKMVKE-VEKGDLPMSFEA.VGQFVKDQVAYEFGQSKKSLVYILMLAVIAAVFANFSGIFP.N.RQI.S...EISFYLLYLLLFNVCLNGFRMMTDLTAQRLTILTSFMKVLGPVYFLAVAVAN........GGVTSAAFYNLVLFLIFLVELLILN........VLLPFVQVYT...ILELLNHLS.S..EEYLSKMADLIHTGIDWSIKTLLACVVGLNLVQGMLLPVIDSVKRGVVTKTAEA-IPGIGDAIGGMTEVVLGTTVLIKNSIGITGAIICVGICAVPFLQV.AVVAFLYKLVAAVIQP..V.S.DQRIV...GCISGIGKGYQLLLRI..IFT..TG..L..LFLLTIVIVTAST............
A0A0M0XB78_9BACI/75-395              .................................................sqkgsl-------YEFLK-GEKSFSFQE.WVSGFIKFIFHEFIVNGKLLGSLILLTVFSMFLQSLQNSFE.K.STV.S...KAAYAIVFMVLIIIALNSFHVAISYTQEAIDTMISFIMALIPLLLALIASSG........GIVSAAFFHPVILFLMNMSGLFIQY........VVLPLLFLSA...LLSIVSTLS.E..NYKVTQLANLLKNWSIGLLGTFLTVFLGVISVQGASAAVTDGITLRTAKFITGNFIPVIGRMFTDATDTVISASVLLKNTVGIAGVAILIIIAAFPAIKI.LMIAFIYKFAAAILQP..L.G.GGPII...TCLDIISKSVIYVFAA..LAI..VS..L..MFFLSITVIIAAG............
A0A0J1DPX1_9FIRM/47-365              ....................................................ldl-------KGILAGGEGGAGVGE.LFRQLLALLLQEVVVSLALLRQLVVVAALSALLTQLGGSFG.E.TAV.I...NLAKAICFLVIIILGLQSCRAALALAADTIDKMVSFMYAILPMLASLLAAAG........GVTSAVIFHPVLVAMVGAVASTVRY........VLLPLIFGGA...VIGLLAHFS.T..ELPLSRLAGLARQVTVTLMGLLFVVFSGVMAVRGAISPIADGIGIRTAKFLTKTFVPVVGGMFSDAVEVVAGGSLLIKNAVGAFGLAMVFFLMAVPVLKL.WAVVLIYKAVNAVTQP..I.V.DERVV...AAIASLEHSLTLVLAA..LAT..AG..L..MFFLVITVLVGL-g...........
A0A143XYL5_9FIRM/43-363              ......................................................l-NFVEMVTELMS-GDSQSIFST.GLEWIHQLLFSEIEANRTILLNVILIAVIGAVFTNFSSVFR.N.SDI.S...ETGFFITYLLMIGILAVAFSAAVSIATAMLDTILGFMKVLLPTFFLAVAFVG........GSLTSAAFYETAFGAISVMEWILKN........IIIPMIGMYV...TLLFVNQIS.E..QDYLSKTAELLKLVIEWGIKTILGIILGIQVIQGLILPFADAIKTNAIQKAVKI-IPGVGDSASAISQMVIGGGVLIKNGIGTAALIIIIAITIIPLFKL.AIITIFYYIAAAIIQP..M.S.DERMG...NSITAVAEGSKLLIRV..IFV..SG..F..LFFITIVVVCQT-t...........
A0A069DHL9_9BACL/70-390              ....................................................qlp----SFMDMLLP-GGEGLSLKN.IFSAIGRFLLHEILFNGKLLVTIIMLNIMSMILETLQTAFE.K.STI.S...KVAYSICYMVIVVISINSFNVAIGYAKGAIDQMIDFMLAMIPLLFALLASMG........NIITVSVTHPLIVFMIHTISMVIYK........IVFPLLFFSA...VLHLVSSLT.D..KFKLTQLANLLRIIGVGLLGVVLTIFLGVISVQGATSSVADGVTIRAAKYVSGNFVPVVGKVLADATDTVISASLLVKNSIGLAGVIIILFICAFPALKI.LTLALIYNVAAAIMQP..L.G.NTPIV...GCLQAIGKSLIYVFAA..LAA..VS..L..MFFLAITIMLTAG............
F0Z5K4_9CLOT/74-394                  .......................................................MDFKSLVSALID-GDGKNAGEL.IMEFLADQFAYEFRYNRQNLAYMLLIAIIAAIFTNFSNAFQ.N.KQV.S...EISFYVLYMLLITMCLNAFRIAMSGIEGHLETLLDFMRVLCPSYFLAVAIAS........GSSSSLIFYNIVLFLIYIVEVLILR........FLLPIVNIYI...MVQVLNYLA.G..EEYLSQFAELLNKLVSWILKTLVTCVIGINIIQGMLAPAIDTLKRSAITKTAEA-IPGIGNAIGGVTDVVLGTAVLIKNGIGMAGAAVMIAICAVPIVQM.LLMTLMYKLTAALVQP..V.S.DKRIT...GCISSVSQGYELLMKV..VFS..TG..L..LFLLTIAVVTAST............
A0A174LIJ0_9CLOT/87-407              .......................................................LSFKQMMKDIMA-GRLGDVMGQ.IGEGLRDALFSEVRNNGHMMGQIIILGIIGAVFANFSNVFT.G.SQI.S...ETGFFVTYLLLFTYLAASFFTSITIAGNVVNQILGFMKALMPAYFLAAAFAG........GSVSAVASYEFTLFAITVAQTITAA........VLLPMVKVYA...LLVMAGHIA.K..EDILSKLTELLSDVITWSLKTMVGIVLGFHLIQGLVLPYVDSMKTGAIQKLIGI-IPGVGQGASAVTQMVIGSGVLVKNTMGAAGVVILVIITLIPMMKL.VILMLLYQCVAAVLQP..V.C.DKRIV...SCISDMAKGHRILLSI..AAS..AI..V..LFVVTIAVVCAST............
R5QY43_9FIRM/71-391                  .......................................................ISFEEVVFSFLS-GEPGEMLEL.LTGYIRDEIAYEFLYSKKTLVYIILIAVMAAVFSNFAGAFQ.S.RQI.S...GISFYVVYMLLITLCLMSFRTAVYGISEKLESLTTFMRVLCPGYFLAVAFSS........GSATSIFFYNLILFLIYISELVIVR........FLFPVINVYI...MVQMLGNLT.E..EDLFSEFADLLKKAVTWTLRTIVACIVGVNVVQGLLAPAIDTVKRSALTRTAEA-LPWIGNVMGGMAEVTMGTIVLIKNGIGMAGAFIAVLICAVPILQM.LLSALLYKMAAAAVQP..V.S.DKRIT...ACIRGVSEGYEMIVSV..IFT..VG..F..LFLLTIAVVAGVT............
D5DS78_BACMQ/67-387                  ..................................................sqkgs-----LVDF-LK-GEKEFSLKE.WLGGLVKFLFHEVLANGKLLGTLIMLTVFSVFLQTLQSAFN.Q.QTV.S...KVAYALVYMVLIIIALNSFQIAISYATGAIETMTKFILALVPLLLALMASSG........GVVSAAFFHPMILFLMNTSGLLIQY........VVMPLLFLSA...LLSIVSTIS.D..EHKVTQLAQLLRNISIGVLGIFLTVFLGVLSVQGATSAVADGITIRTAKFVTGNFIPVVGRVFTDAADTVISASLLLKNSVGIAGVAVLLLIVAFPAIKV.LTLAFIYKLAAALLQP..I.G.GGPVI...SCLSIISKSVIYIFAA..LAV..VS..L..MFFLCLTVIITA-s...........
A0A0J8DAL1_CLOCY/53-375              .......................................................FNVGEIVEKYKETGSIGVTFKD.VLASLGKFILKEVVANSRLLVELLVLGILSAILQNIQNAFN.N.SGI.S...KIAHYACFCTIVIIIVKSFTIVINLAKGTIDQMTEFASILIPPLIMLIATTG........QVISAATLDPITILILSVSSSVIKN........FIIPCTTFVV...VLNIVNSLS.D..EPKVMRLASLIKQISLWALGFIMTIFITLITIRSNTAATIDQVTLKTTKFFVDNFIPLVGKSLSDAITTVVGYSLVLKDAISILGLLIMIWICIFPLLKI.IMISLIYKFVGAVMEP..V.V.DKKII...NCLSSVGSSFTVIFSS..VLC..TA..I..MFFIMITIITST-g...........
A0A1M6MJ38_9FIRM/55-375              .......................................................FDFMDYVNDLIA-GRRTFSITG.ILDDLKQVVSNEVKNNINTFTGLISIAVIAAVFTNFSYAFK.N.IQV.A...DTGFYVAYLLLFSVLTGSFITASSMAAETLSSLLELMKALVPSYFMAVAFCS........GAGTSMVFYQVTLFLITFADILLIK........IIIPLINIYL...VISMANNLS.K..EDLLSKLTDLLETLMSWGLKTLVGVVVGFNAVQGLITPVSDKMKKSLVFKAAEA-IPGIGDIFGGVAESVLGAGVLLKNAIGVAGVVVIVTLCAVPVLKL.AVMTLIYKVSSAAVQP..I.S.DKRML...KCISASGDACLFLLQT..VIV..GA..V..LFIITITIVAATT............
A0A1Y4N759_9FIRM/94-405              ..................................................fssll----------------DLDFSR.LAGEVMKLITGQGKTPFGVFASVCGVMIIFAILDGFREGLK.S.SPM.S...EVMGTVSVLAVTSIIVLPVTKLIENCAGSLMVSTSFLLAYLPVFAGIVISSG........NSVSGAAYYSVMIGVGNVISLLASR........VIVPFMNVFL...GISVMGGMS.P..QLKLGGISSAISRAVKWILAFSMSVFSALLTFNTLLTSSADSVATRAVRFTVSSFVPVVGSALSEAYRTVKSGMGLLKSGIGVFVIISIAVIFLPVLIQC.VLWLLSLNLCKLVGEI..L.G.QNTAV...TLLNGVSSVLGMLIAL..LLS..VC..T..IFVISTTIILVAG............
Q894G0_CLOTE/58-380                  .......................................................MNVRKYIESSMKTGEGDISIKK.IGKALVGFLFKELATSIKLMSIIVIIAIICTLITNLEMAFS.N.ESL.S...NIAYFACYSLLIVIMARSFYLGVDLARITIERMSNFMLILIPVLIMILFSVG........GVAEAAVMDPVIIVSINVASKIFAK........ILIPLISMVF...VLQFVNNIT.E..EYKIDKLTKLLNQIALWGQGILMTVFIGIMTIRGITSKTLDKVVAKTAKYAVDNFIPVVGKCLSDAVSTVAGYSVLLKDAISGLGLIMLIVMVSFPTIKL.LINAFVYKLTAALIEP..I.G.DKRLI...NSISSAGDSLILISSC..VIC..VS..I..MFFIMISIIAAAG............
A0A0B3VKE9_9FIRM/67-388              ......................................................t-NLTTYIKDLIS-GKANILDLF.DKDKIKVTIFSELKTSIKIAASILVLALLSSIIKSLENSFS.S.SSI.S...TVTNYIVFITVVTLTLISFKDILALCYATIENVIGLVNVIIPIMISLLVLVG........FPITSTALNPIFIGGIAVINIVFKK........FVFVAISLAF...AILVINNVT.N..NIKLNRLSAFIKQINIVTLGAVFTLYLGLVSIQGLYVTSFDKFTVKTAKFAVGNFIPVVGGFVSDSVDILLSSSQLIKNVFGGVGLVILVGICLIPVIKI.LSVILVYKVCAIAIEP..I.G.EDNIS...SFLNDVANLMIIILAT..IIA..VT..I..MFFVTIAILTSI-s...........
R5ABQ4_9FIRM/53-372                  .......................................................VSFSDLLAEILS-GEFDFTFAN.IKEKALELTFGELRMQGRLLAQLVLIVILSAILKQCSDSFQ.G.KNV.G...EMGFYVCYMVLIVAILTSFYSISQSVVERMRGLCGVFGAMVPIFLVLSASSG........NLTQGALMGPTLMGGATALSVGISY........VLIPAIQLSI...ALEMTDHIS.E..KPILGKFAELLRQCISWGMKGAAMLFMLLLSLQKIGGGALNGLAAKTAKIAVGA-VPVVGGVMGGAVETAAAMAGTLKSGTLVAAVVLLLLLCLPLLIKL.LVILLVFRLTAAAAEF..I.C.EERLV...ECIAAAGEYIGLLLGI..VFL..GE..G..MFFFSALLLL---gg..........
A0A1Y3XFY1_9FIRM/50-361              ................................................dlsagld---------------LDGSIDQ.ILDTGSEELGGVIRKALRSGALLLAVVLFCSLAEGMGA--G.Q.GPV.N...GV-ALVGALAVTAIATADANSLIGMGREAIEHMDSFSKLLLPAVTAAASAAG........SPSGAVARQLATMLFSDLLITLINR........VLLPLVYTYI...AACVAWAAV.G..NEGLKRVAATLKWAVTTVLTGTLILFVTYLTISGVIAGTTDALTVKAAKFTMSSMVPVVGGILSDAAETVLAGAGVLKNTVGVFGMLVVIGICLVPFLQL.GFHYLTYKVSSALSAA..L.S.GSRVA...ALIDQIGGAFGLILGM..TGA..CA..L..LLLISMI------savsla......
A0A0K8JIK4_9FIRM/61-379              ...................................................mvti-------HDLVE-KGLNVDWSQ.IGNILVSVFFKEIAAHLHLCGKLLFLAVLCALLQNLQNSFE.R.SNI.S...LLAYSVCFCFLAVIALTAIYNVLEMARQTVGTMVSFMQALLPILISLLAGVG........AVTSAALLTPLMLFLISMVSIIVKD........VVLPLLFLTT...ALECVNYLS.S..TYQLSNLTTVLKQGGIIVLSLSLVVFIGVITIQGVSGSVSDGITLRTAKYATATFIPVVGKMFADTVELVMGASLLLKNAVGIFGVLAILMICVWPLLKI.FSLIVIIKLTGALIQP..M.G.DEKMA...KCLDLMGNNLLLVFGG..VLT..AA..L..MFFLAITMIIGVG............
A0A154BUE9_9FIRM/65-383              .....................................................pd-----TLKNIAG-KGLSLDWQT.LWQAALSRLFRELAMNLSLMGKLLFLAVLCALLQNLHSSFN.S.SGV.S...LLAYSICFIFLMVLVLNAFYNVILVARQSVEYMIGFMQAMLPLMMSLLAGVG........AITSVALFTPFMLFVIGITGVVVKD........MVLPLLMVTA...LIECVNYLS.D..QYKLSNLAGVLKQSGMVVLGLTLVVFIGVISIQSVVGSVADGITLRTAKYATATFIPVVGKMFADTVELVMGASLLIKNAVGVVGVLAVVTLCALPVVKL.ISLITVIKVTGALVQP..M.G.AEKMA...KCLDTVGNNLMLVLGA..VLT..VA..L..MFFLSITMIIGAG............
R6QUD5_9FIRM/47-367                  .......................................................FSYEELVKKLIT-GNIKGAFSM.VRQSVGDQLFSILSENRNFMRQLITVAIIAAVFKNFSDAFF.Q.GNT.G...DTAFYVTYMILIGLMANSFFFLNSITDQVISTLIDFMKGLITAYSIAVVATT........GVSTSVALYEMYLFVIYIISLLVQS........VIFPAVKILF...VLKIVNHIS.L..EEKLSRLCDTLEWAVRALLKALLAVVLGIQMIQAMLLPAVDSVKDGIFKKGVSM-IPGVGQGVSTVTTTLIGSAVVIKNSIGVAGIFVLCVIILVPLMQI.GGILLSYIGTGILLQP..V.S.DKRIT...GSLDAVIKSGKLLLRT..VFT..LS..I..LFILSIAIVAFST............
I8RJN5_9FIRM/59-379                  ....................................................lts----DTIHTIAA-NGIHVSWQN.VWQALVHNFFREVTLNTHLMGKLLFLAVLCAVLRNLQNSFE.Q.SSI.S...ILSYSVCFIFMSSIALTAFYNALKLASQTVEYMVGFMESLLPLLISLLAGVG........ALTSASLFTPLMLFVISSMSVIVKD........IVLPLLFLTA...ALECLNYLS.D..TYRLSNLSGVLKQLSMIVLGFSMVIFIGIITIQGAAGSIADGLALRTAKFATATFIPVVGKMFADTVELVMGASLLLKNAVGIFGVIVVFMICVFPIIKL.LSLILVIKISGALVQP..L.G.DEKMA...KCLDAMGNNLLLVFGA..VLT..VA..L..MFFLAITMIIAAG............
A0A1Q9JZ55_9FIRM/56-375              .......................................................ITFRELVQMLID-GE-KIDKGE.LLRNLLDVVFHEVLSFRLELLQIVLLCIVFSILYNFTNIFE.N.PAV.T...QISFYMVYMLLMVLLLKSFWVLKDVVLAVLDDMLVFLKLLVPTFSLSMVFSG........QMTAGSVFYELTFLLIYGIEWLMNG........VIVPAIQIYV...VVEMMNYLT.E..EEMLSKMTELLKEGIEWVLKLVFTTVIGINVVQNLLAPVIDGFKSTLISRTAGM-IPGLGTSINAVTEIMVGSGIIIKNGVGVAAILVLVVLCAGSVIKV.WVMTFLYRLVGAVMQP..I.A.DKRML...GCISGTGEGGRLLGKV..TVT..TV..V..MFLVTIAMVTAAT............
R6IQE6_9CLOT/63-374                  .................................................fetvta-----------------LDAKS.CVQVLGRLARQNIQTPLRALLSVLSFTLLSAFLTGFSGSGL.L.GQN.S...SVYSTASALVIAALIAAQCADTVSLCCATIGICADFVFAFFPAFLVILTVSG........SSLTGVSTNTLLLGLAQGLNILSAK........LFVPLINCFL...ALSLCSGVR.S..SLNIDGALRVVRKGLISLISFCAGAFVTVLSVKTAVASRADALGLRSLRFAINSVVPVIGSAISEGLLSIQSYAGLVKSTVGVVGIIGVIALFLPALINV.IGWRVSIAVSVAVSEI..F.D.DRTVC...KMLRAFGDAFLLMNVV..LIL..SM..V..TTVISIGILIAA-k...........
R9LS01_9FIRM/68-380                  .................................................dyrkll----------------TLSPSD.FFKEIWGAVRERVRMPLTVFGSVLGIILLCSLLDCLRISLW.D.GTL.N...TVFTAVSVVCIAAAIASPIIDCITTTARAIEDCSTFLLSFIPVFSSVVTVSG........QPVTATTYTAFLFMACQIVSQIVSG........TLVPLMGIYL...AFCITGSLA.P..GLDVAAVSRVIKSTVSWALGLLLTLFVGLLSLQTMVASGSDTVVSKTAKFLIGSFVPVIGGALSDAFAMTQGYMRLLRTTVGAFGILIALLTFLPVFLQT.TAWYLAVNLTSAVSEM..L.G.IKPIA...EILKSSSATLGVLVAV..ILC..FA..L..LVIISTSLVLMT-s...........
A0A090ZHC3_PAEMA/72-392              ....................................................klp----SFMDMLLA-QDQSFSLKT.GLTGLMKYMWHEVLYNGRILVTIVLLSIFSMILETLQTAFE.R.NQV.S...KVAYSICYLVILVLAINSFHVAITYASNAIGGMIDFMMAMVPLLFTLLASMG........GAVTVTVTHPLVVFMVHAVGTAVHT........IVFPLLFFSA...LLHIVSSLS.D..KYKLTQLADLLRSISMALLGVLLTVFLGVISVKGIAGSVTDGVTLRAAKYLTGNFVPVVGKVFADATDTVISASLLVKNSIGLVGVIILLFLCAFPAIKI.ITLALIFNLSAAVMQP..L.G.DSPIV...TCLETIGKSMLYVFAA..LAA..VG..L..MFFLAITIMLTAG............
R6TAR7_9FIRM/43-362                  .....................................lendisengesavaslga--------------------EY.IASLAASALKAAFAYSVKPLAAVIGVLLLSALLNSAGAAAA.G.GEA.V...ALSSAV---SVTVTLFGAITPLFKLTSDTLSGIGLIMKGILPVMTGIYAMSG........NITAASVNSTWLMLLLTFLETLTES........LLMPLLCTCTgfiAVTTLSRFT.G..APDMSGVSGELKKALTFLLAAAGTVFTTVMAHQTALAKSADSVALRSLKFASGNMIPVIGGALGEAADGYLAGVSLIRSASGTLAAAAGISYVLPALLKI.AVLRAGLSAVAAGAEI..M.G.RGKEA...AVVREAGEVLGIAVAL..ICT..AS..V..LSVIAVGVFAG--s...........
R6Z6G0_9CLOT/54-373                  ......................................................t-NLSDILNEAMQ-GK--INNQT.IYKKIIKILGKEVSSNIKILISILIIVVIHGILKSITDSLE.N.SNV.S...QIIYFVQYILIVTLIMSNFTEIIKLIKETASNLVGFINVLIPLLLTLMVYTG........SITTSTVLEPILLFVSNFIGNIIAN........ILIPVVLIIV...VFSVISKIT.E..RIQIERISKFLKSSVVWFLGIFLTIFVGIVSLEGTLSSSVDGITAKTAKAAVSSLIPVVGKVLGDVVDSVLGCGIILKNAVGAVGVIVIIGICIVPVIKV.AVLSIMYSLASAIVEP..V.A.DTKIV...KLLEEMSGVFKLLLAI..LCS..LS..V..ILIIGVTMVVKI-s...........
D4M5J1_9FIRM/80-400                  ......................................................v-RFRDLTEMLIS-GNTKGLGER.FLEFFSGQVFSVFQKGRKNLARLLLITVAAAFFSNFTSIFQ.N.RQT.A...EAGFYILYLVVIAICLEAYQSMNLYAEEKTGELVQLMQVFCPSFFLAVAFTG........KSSSALMFYNTILFLIYLVELLVLH........FLLPAVKIYG...MVRVLSCLT.G..EDLFSEFAELLEKCIQWSLKSMIAAVSGISLIRGFLNPAIDSLKMTAAGRTLEA-VPWIGDVAGGTMDVALGVAVLLKNGIGVAGMIFIAVLALIPLVEF.LILAFLYQLVAALVQP..V.S.DRRIT...TCISGVSSGYQLMVKV..IAS..TT..L..LFVLSIALVVAVT............
A0A0M4G6V6_9BACI/68-388              .................................................sqkgsl-------YEFLK-GDKQFSLEE.WAKGFMKFAFHEFISNGKLMGSIILLTIFSMFLQSLQNAFE.K.STI.S...KVAYSIVFMVLVILALNSFHIVIDYTNEAIRTMSTFILALIPLLLGLIAASG........GVVSAAFFHPVVLFLMNVSGFLVET........VVLPLLFLST...LLSIVSTMS.E..HYKVTQLAGMLKNWSIGLLGIFLTVFLGVLSVQGATSAVSDGIAIRTAKFLTGNFVPVIGRVFTDAADTVIGASVLLKNSVGIFGVVLLLLIAAFPAIKI.LMIAFIYKLAAAILQP..L.G.GGPII...SCLDMIGKNIIYVFAS..LGI..VS..L..MFFLCIAVIVASG............
R6RCG0_9FIRM/63-376                  .................................................fdfeni---------------SSISFKQ.IIDYISSVFSKNAQGPLRCCLILICFIILSSIVKSFDMHLS.S.DSV.S...DMYATVSNLVIAIFLVTQIYPSMKLACSAIKLCSDFTYAFFPAFCIICATSG........AAMTSFSVNGSLLLFSQTLNFISSN........VFLPIVNSFM...GISVCSSIR.R..DLNMGSIVSALRNLITKAISALSAIFVSYLSLKTAVASRADALGLRSVRFAINSVVPIIGSSISEGLLSIQSYSSLIKTSVGIVGIIAISAIFLPAIINI.TLWRLSISAANICSKV..F.F.DSESS...TVLEAFSSVLLIINVL..LIL..SM..V..TTIISLGILVAS-k...........
R5XJW5_9FIRM/66-381                  ...............................................ldfdykkl---------------LDFSLSD.VLAVLKNMVTDSIKAPLKGCAAVIVIIMLSALFQGFKQTVE.S.GEM.A...SAVSTVSAIAVSLILVSEIKFTVSAGCAAIEVCANFIYAFFPAFCIIVAASG........STVAAFSTNTLLLSMAQILNFISQN........IFMPLSNCFL...ALGICSGIR.N..ELNLGALVSNLKKYLITAISVCSGVFISVLSIKTAVASRADAIGLRSIRFAINSVVPVIGSAVSEGLLSIQAYSSLIRSSVGVAGIAAVAVLFLPPILQV.MFWRLFLTLCASVSDI..F.G.DKSVS...CVLNAFADAFLIMNVI..LVL..CT..V..TTIISIGILIAA-k...........
A0A255ILA0_9FIRM/50-370              .......................................................VDFKEMIVNIIK-GKEPLNVET.LLQTLVNKAFGQISYVKKTILHIMIIAIAAAILNNFSSVFN.N.NQI.A...DISFYVVYMLLLTVLMKSFVSVTTIAESAVNSLIEFMQSLVPAYFLALNVAG........KTTTAMIFYQVILMIITGIHLLFSR........FILPLINVYI...VLMLVNNLS.K..EDFLSRLAQLLKGTIEWLLKAMLTVVVGFNVIQSLVAPAIDSFRTTALNKTVSA-IPGVGNAVNAVTDMVIGSAVIIKNGVGVAALIVLIVISLVPLIQL.WTFSVLYKLAAAVIQP..V.S.DARMV...SSIGSVSDAVKLLIKV..LTT..SL..I..LFMITIAIVTATT............
Q3EN76_BACTI/63-383                  ..................................................sqkgs-----FM-EFVK-GEKEFSLKE.WMIGLLKYLFHELAANGKLLGTLIMLTIFSALLQSLQSAFS.K.SSV.S...KIADAVVYMVLIIFALNSFYVVMTYARETIQTMVDFILALLPILLALIATGG........GVVSVSFFHPVIIFLMNTSGLLMNY........IVLPLLLLAT...ILSIVSTMS.D..QYKVTKLSKLLQNVSVGIIGIFLTIFLGVLSVQGTATAVADGIAVKTAKFVTGNFIPVVGRMFTEAADTVISASGLLKNTVGIIGLVILCLIVAFPAIQI.FCIAFIYKFAAAVLQP..V.G.SGAII...QCLDIIGRSIIYVFAC..LAI..VS..F..MFFLSITIIIAAG............
W0ED05_9FIRM/95-415                  .......................................................FSLGQMFDD-LREGKLSLDPQK.LGRSLLSFLGQEILKSGPLMGKLLVLAVLIAVLQNLQNAFS.S.ESI.G...KMVKSLSYLVLMVIALAAFQETLEIATDAIDQMTSFMQTLFPVMLTLLMAMG........NLTTAALFKPMVIGSLTLLATLMKT........VILPLFFLTA...VLKLFNNIS.S..DFKLGKLASLFEFTGKLGIGVLMTVFIGVMTIQGLSGGVADGVTLRTAKYSADL-IPVVGKFFKDAVEIVASSGLLLKNSLGIIGVLAIALLCIGPAVRI.AAMIFVFKISAALVEP..L.G.LKELS...DSLQDMSKSLTYIFAS..VAS..VA..I..MFFISIAIVVGSG............
G2SX14_ROSHA/73-394                  .......................................................FSFSVMVQELLADGIGVTSMEK.IGQWLCDALLYEIKTGKTILVEVVLLAAGFSMLKNFSGTFE.K.NYV.S...DICFLLVYGVLCVLLLKSFEIYGTVAEEALNGSIDFMKALIPAFGISMVFSS........GAESSAAFYQLAFLVIYLVEWLFLS........VLLPFIRVYV...VTELFNHFF.E..DEKFQNFTELLAGVISWGMKSAMMAVLGLNVMQGLLAPAKDRLLNGAVSRAAMM-IPGVGNVLGGIGELMFGAGILIKNCVGVTALIVLLAVGCIPVLKL.ACMSVLYKLAAAVAEP..V.A.DKRIV...GCIKSMAQGGVLYLKL..VCY..GI..V..LFFATIALQTA--av..........
A0A1I3NCW7_9FIRM/58-369              ...............................................glsvgeil----------------KLSPSS.LWNGIAVQMGRILSSARAQLFSILAVVLLCALLSVVSS---.G.GGE.S...LPFGLIANLTIFAVLLDPLISCITVCASTLRSAAQFMLAYVPVYAMVAATGG........APATAGAYQMIVLAASQFSAQFSSA........TLLPLLQCYL...VLSLAGGLG.K..NKGIRSLSSGVKKVVNWSLVLMMTCFAGILSLQSFLGAAADTAAVKTVKFLAGSFIPVVGSAVTDAWAALQGSVRIIHASVGSFGVAVAVCTFLPALITV.TVLRAVVAFAATVGEM..L.S.VSEVE...DILSGCGNVLSVLTAL..LVS..ML..L..VSVISTATLL---flc.........
A0A1V4IAP4_9FIRM/58-379              ......................................................v-NLKTFIVDVVR-GKRNIFDLI.NKEALTTYLFKELRTNLKIFISILVLSMISSILKNLDNSFS.S.GTI.S...KISNYTIFLIIVSLTFIGYKEVLSICKGTIESMVAFMEIAIPIEIALLVTLG........FPITSAVLNPIFLGGIAFITLIFKR........FIVISMTLAF...SLLIMNSIS.K..HIKLKRLFSFIKQMNIFTIGTVLTVYLGIISIQGLYITSFDKLSMKTVKFAVGNFIPIVGNFVSDSIDIVLSSSYVLKSVLGSVGLLILVGICLTPIIKI.ISILLVYKLASIVIEP..I.A.DESIS...EYLNEIGNLMAIALAA..LIA..TA..I..IFFITIAILASI-g...........
R9MEB3_9FIRM/64-384                  .....................................................ig--FRDTVCAIIS-GEQECTVRV.LRQLILGQITYAFDVSRENLVHILIIAVIAAVFHNFSTVFK.N.RQI.C...EISFYVLYLLLIALCLSSFQIVIDWVSEGVESLTGFMTVFCPIYFLAVSLAK........GSVTAVAFYNLVLFFIYIIEVVIVY........FLLPVIHIYI...MVKVLDFLS.S..QEYLSKFAELIEVAVSWLLKTLVACVIGVNVVQGMISPAIDTVKRSAVTRTAEA-LPGVGDAVGGVAEVVVGTAVLVKNGIGTVGMIVCLSLCIVPLAQM.AAIALMYKLAAAVIQP..V.S.DKRIV...GCVECVGDGCRLLMRV..IFT..VG..L..LFLLTIVIVSYV-t...........
A0A150N0R3_9BACI/62-380              ..................................................kgpla--------DFIS-GERQWSPAE.WLKALASYLFYELQVNGKLLGTLILLAVFSTVLQSLQNAFA.Q.QEV.S...KIAQAVIYMVLLLIALNSFRLAADYALEAVRTMSHFIIALVPLLLALLAASG........GVVSAAFFHPLILFLMTTTGTVVEY........VTLPLLLLAA...LLGIVSTLS.D..RYKATQLANLLNKVAIGLLGVILTVFLGVMSVRGATAAVADGVALRAAKFVTGNFIPVVGKLFTDAADTVVAASMLLKNAVGLVGVAILLMIAVFPAVKI.FAIVVVYQLSAALLQP..L.G.GGPVL...SCLNIIGKSIAYVLAA..LLI..VS..L..MFFLSLTVMIMAG............
A0A1R1AND5_9BACL/87-407              ....................................................hip----SFMEMILP-GGDGLKLTD.MLSGLLKYLWHEVLYNGKLLVTIVMLTVFSMVLETLQNAFE.R.NAV.S...KVAYSITYMVLIIIAVNSFHVAMGYAKGAIESMIQFMLAMVPLLLTLLASMG........NVVTVSVLHPLIIFMIHAVGTLIYT........LVFPLLFFSA...VLHIASALS.E..KFKVTQLANLLRNIGVGVMGVLLTVFLGVISVQGATGAVTDGVTLRTAKFVTGNFVPVVGRMFSDAADTVISASMLAKNAIGLAGVIILLFISAFPAIKI.LTLALIYNIAAAVMQP..L.G.ESPIV...TCLETIGKTMIYVFAA..LAA..VS..L..MFFLAVTIILTAG............
A0A0A3HQE4_9BACI/1-295               .....................................................mh----------------------.---EILNIFLDPLKIAGQSIIFILIYTIMFLIVEAFVPKFK.-.---.-...KWADALFVIILVLTLGKTVVDAFSLMGDLVNVASDFFLAITPILTSLLVVLN........AVFSFIAWSPVILFIFEMLILLCKK........ILIPAITVAL...ILDFCTRFI.Q..DISFSKASDLIRGSVMTLITASLIAMVTVLSFTGVAFFTIDQAIANPIKKVIEQTVPIVGSLIVEGFSIFHKYQSTATTVVGFGAMTAFWGASFYPAGKL.LIHALTFKFIAAIVEP..F.T.GSTIS...GLLDDVGKSLLLLCAV..AIL..LG..I..AFVFIWLILM---iil.........
A0A0H3J229_CLOPA/56-378              ......................................................l-DIKDYVKDFMKTGNGKFSVEK.LFKGVLAYFFREVIASFKLMIMLLLICVICALLTNLQKAFS.N.EGL.S...NIAYFACYSLIIIIVARSFYIGVNEVKAATNNLTDFMAALVPVLLTLLAAGG........GLVQSTIMDPIIILAINVAARIFMD........VLLPLILIGF...VLQFVNNIS.E..EYKVDRLAKLLNQIVLWIQGLVMTIFIGIVTIRGINAKAIDQVTAKTAKFAVDNFVPIVGKALSDAVTTVVGYSVVLKNAISSIGLIVLIVIVIFPIIKI.LALALIHKLTAALVQP..I.S.DKRIV...NCINAAGDTLILLMSC..LIS..IS..V..MFFIMIAIIASSG............
R6NXX0_9FIRM/62-379                  ............................................igingidsnel---------------SQISFGE.VVNEIVKLVGENSAGPLKAVISLTALLLICSLLSSYKNSLS.S.ELS.S...SLGIAAVLCATCTAALPVIEVISD-MSTVVKTASSFMLAFVPVMVMIMSSTG........HAVSGASYYAMMIGAGEGVGQLSSK........VIVPFLNMFL...GVSVTASVC.S..ESKLTGITSIISKAVKWILGFVMTVFTAVLSFKQMITTSVDDVSTRAVRFTLNSFIPIVGSALSDAYKTVQGSVNLLKSGLGIFVIVSIAFVFLPIILNS.LLWIFTLSAGKLLAEI..L.G.INQVK...DLLEGVGTVLSTLLAI..VLC..IM..S..VYIISTALVLLM-g...........
A0A1I0FUG0_9BACI/70-390              ...................................................lsnk----ELT-DFMK-EDASVSIQS.WINGLLKYLFHELLANGKLLGSLILLTLFSVILQTLQNAFE.S.QTV.N...KVAYAVVYLVLITLALSSFQLAVSYTNDAIDAMSNFMLALLPLILSIMASVG........SITSIAFFHPIILFLINVSGFLIST........FVIPLIFLSA...ILHIVSSLN.E..NYQATKLANLLRNIGLSVLGVFFTIFVGVISVQGATTAITDGLAVRTAKFVTGNFIPVIGRMFTDAADTMLSASMLLKNTIGIVGVIIVLGVALFPAIKV.FVISIIYKLAAAILQP..V.G.GGPVI...HTLDLISKHIMYIFAA..LLV..VT..M..MFFFAIVILVAA-s...........
A0A1M7YIW2_9FIRM/55-375              .......................................................FDFMDYVNDLVS-GKRTFSITG.ILDDLKLAVTNEVKNNINTFTGLISIAVIAAIFTNFSYAFQ.N.MQV.A...DTGFYVAYLLLFSILTGSFITASSMAADALSSLLELMKALVPSYFMAVAFCS........GAGTSMVYYQITLFLITFVDVLLIK........IIIPMINIYL...VISMANNLS.K..EDVLSKLTELMETLMSWGLKTLVGVVVGFNAVQGLITPVSDKMKKSLVFKAAEA-IPGVGDIFGGVAESVLGAGVLLKNAIGVAGIVVIVILCAVPIIKL.AVLTLIYKVSSAAVQP..I.S.DKRML...KCISASADACMFLLQT..VIV..GA..V..LFIITIAIVAATT............
A0A132NG31_HYDSH/58-374              ..........................................vrglfrealqglp-------------------WSE.AARGVFRYAVGELVALGGLISTLLLLTVFSTVLEHIQGAFE.H.RAV.S...RVAQYVTFLILSALVLDSFRLATESAHRAIQGMEGVMVALLPVLLSLLAATG........GGLSSGLFHPLVLFFVHTSAVVIDQ........VVFPLFFFSA...VLALVSLFS.E..QYAVTNLGRLLNRLAITALSVFFTVFLGVLSVQGTAAAVADGVALRTAKYVVSSTVPVFGRMFSDATETVMGAAMLLKNAVGLVGVFLLFLAAAYPAAKV.FVIALVYQFSAAVLQP..L.E.NGPVV...RALESIGGALMFMFAV..LTA..LG..M..MFFLSLVVILVA-a...........
A0A1T2XNH6_9BACL/70-390              ....................................................htp----KFMDMLLPDGK-GFSVKT.VFQGILKFLLHEVLYNGKLLVTIVILTVFSMILETLQTAFE.R.NAV.S...KVAYSISYMIIIIIAINSFNVAIGYAKEAIESMIHFMMAMIPLLFTLLASMG........NVVTVSVMHPLIIFMINTVGTLIYA........VIFPLLFFSA...VLHIVSTLS.D..KYKVTHLANLLRNISIGLLGVLLTVFLGVISVQGFTGAAADGVTIRTAKYITGNFVPVVGKMFSDAADTVISASLLVKNAIGLVGVIIILFLCAFPALKI.LTLALIYNISGAVMQP..L.G.DSPIV...TCLQTIGKSMIYVFAA..LAA..VG..L..MFFMAITIMLTA-a...........
R7RQ73_9CLOT/53-375                  .......................................................FSFSELVNEYKATHSLKGVIKS.LIEGSKKYIFKEVIANSRLMIELLILGIFCALLKNMQSSFS.S.SSV.S...KIAFYACYLVIVVIIIKAFALIVELSRTTIDQMIEFVNSLMPTLMILVASVG........GFATATMLDPAIMFISKLFSDVIKD........FILPLTFLIV...ILNIVNNLS.D..EIKISKLVKLMEQITLWALGFLMTVFVAFITIRSSTSASIDQVTLKSTKFMVDTFIPVVGKSLSDAVSTVAGYSLLLKDAISVVGLVVMLSICLLPLIKL.VILALIFKFVGAIMEP..I.V.DGKIV...DCLSSVGGSVSVLFAS..ILS..VA..I..MFFIIITMIAST-g...........
A0A1S9CTM7_9FIRM/57-378              .......................................................FDLRSEVSKILT-GERIFSLPE.TLSLIVNLLAGEVYGYASVVVRFIFIVLLCHILNNLSSAFE.S.KNT.T...KVAFFVCNIVVLYSVSQSLVLIVTLAQDTIHSLSQIMLVVLPTLLAFMATSG........YIATSSALSPVIVSALTMVTFIIQN........FMLPTIISII...VLQIISNMS.D..EFKIDNFIKLFYKMSKWFLKTIFFVSLGIMGIYKMSLPYVDVTMKRVGLTLGAKFIPILGDAIGGAIDFIIQVSGMIKNAFGIGVILWIVLIIAMPLAKM.FVYTVLYHFAGAIIEP..L.G.DKKMS...KIATDIAKGCEFIMSL..VGM..VA..I..LCIVALVICMSI-g...........
R5XPD2_9CLOT/60-379                  ......................................................i-EVEELLNSAIK-GD--IQNGK.IIKNIWKIFGSEIINSISVIGSVIIIVIIHSIIKSISDGLE.N.KSI.S...KITYYVQYILIVTLIMTSFSDILSMVKESIENLVGFMNLLIPILITLMITTG........NITSASMLQPILIFIITLIGNFIKD........VIIPIVLVST...ALGIVSKIS.D..RLQIDKLSKFFKSSVVWILGVVLTLFVGLVSLEGTLSSSVDGITAKTTKAAVSSFIPVVGKILGDAVDTVIGCSVILKNALGIVGVIIIIAICVKPIIKL.VILMAMYYLGASLCQP..I.A.DGKII...KLLEQMGDTFKLLLGI..LCS..VS..V..MLIIGVTLVVKI-s...........
F7KQ70_9FIRM/66-386                  ......................................................l-DFKETLMGVIS-GDLTFSAQL.LNRLVSDQLGYAFRSCKDNLVHILLIAVIAAVFSNFSNVFQ.S.RQI.S...EISFYALYLLLIALALSSFQVVVEWVGQGIDSLTSFMGVFCPLYFLAVAIAK........GSVTSIAFYNLVLFLIFLVELLITS........FLLPVIHIYM...MVRVLNYLS.S..EEYLSKFAELIQVSVSWILKTLLACIIGLNVIQGMISPAIDSVKRSAIARGAEA-IPGIGDAIGGVAEVALGTAVLVKNGIGMTGALICIALCVVPLAQI.ACIAFLYKLAAAIIQP..V.S.DKRIV...GCVETVGDGCQLLMRV..VFT..TG..L..LFLLTIAIVSAVT............
A0A075R3C7_BRELA/67-387              ..................................................lkqkg-----FMQL-LM-EDGGLSPSG.MLKGILKFFFHEILMNGKLLSSIIIITVFAMLLESMQNAFE.K.NTV.S...VVAYAIAYLVLMVLAMNSFHVAITYAKDAIQGMSDFMLAMIPLVLALLASMG........NMASAAMFHPIIVFMINISGFLIST........IIFPLLFLSA...MLSIVSLFS.E..RYKVTQLAILLRNVAMGVMGSFLTIFLAILSIQGATTAMADGVTIRTAKYITGNFVPVVGRMFTDAADTVVSASVLVKNAVGLAGVIILLLLCAFPAMKI.LILALIYNFSSAILQP..L.G.NSPII...KALGTIGKSLLYVFAA..LAT..VG..L..MFFLAITIIIAAG............
A0A0M4FJE5_9BACI/85-405              ................................................sqkgsll-------EF-VN-GDKKFSPGE.WGKALFAYLFHEVIANGKLLGTLILLTIFSVLLQLLQNAFQ.Q.SAV.S...KVAYAIVYMVLIILALNSFHVAITYANQAIESMTGFILAIIPLLLALMASSG........GIASATFFHPVILFLMNTSGMFIQH........IILPLIFLSA...ILSIVSTMT.D..QYKVTQLAQLLRNIAIGSLAIFLTVFLGVISVQGASAAVADGITLRTAKFITGNFIPVLGRMFTDATDTVVSASVLLKNTVGIIGVAILVVIAAFPAIKV.LSLALIYKVAAAILQP..L.G.GGPVI...SCLDIISRSVIYIFAA..LAI..VS..L..MFFLCITVIITAG............
K6DBF0_9BACI/72-392                  .................................................sqkgsl-------YDFVK-GDKKFSFKQ.WGQGVLKFAFQEFVANGKLLGSLIMLTIFSMFLQSMQNAFE.K.SAI.S...KVAYSIVYMVLVILALNSFHIAISYTTEAIGTMTSFVLALVPLLLALIAASG........GLVSAAFFHPVILFLMNMSGTFMQY........VILPLLFLAT...LLSIVSTMS.E..QYKVSQLAALLRNWSIGLMGLFLTIFLGVISVQGASAAVTDGVAIRTAKFVTGNFIPVIGRMFTDATDTVVSASVLLKNTVGIAGVAILLIIVAFPAIKI.LMIAFIYKFAAAILQP..L.G.GGPVI...KCLDIISKSVIYVFAA..LGI..VS..L..MFFLSITVIVAAG............
A0A1I2J6I8_9CLOT/56-378              ......................................................m-TPKEFVEYIVKNGEAPYTMKD.YVSIITKYFFKELSATMKIMISIIIVGLLCGLLKNLQGAFS.S.EKL.C...DIAYFACYGVLIVLLSKGFLMAIGIAKDAIGNITNLMAALIPVLFSLIIGVG........GVSQVATLDPLVLVVVNIVPRIYVT........FIIPLILMGF...VLSFVNNIS.K..DYKISKLTKLCKQAVLWAQGIIMTIFIGIVTVRGITSSTLDAVTAKTAKFAVDNFIPVVGKALSDAVATVAGYSLILKNAISTLGLILIIFIILVPIIKL.FLTSIIYKLTASLLEP..V.S.ENRIT...DCITSAGDSLILIMSC..LIC..IS..V..MFFIMISIMASAG............
B7GHF1_ANOFW/60-379                  .................................................qkgsfw--------QFIN-GEKELSLSE.WLQAFIKFLLYELMANGKLLSMLILLTIFSLFLQSLQNAFS.H.HAV.S...KVAHAVVYMVLMIIALNSFHVAVTYAKEAIQTMTSFMIALLPILLALMASSG........GVVSVAFFHPIVLFFMNITGTVVER........FSLPLLFLAT...ILSIVSLLS.E..HYKVTKLANLLRNISVSSLGIMLTIFFGVLSVKGATTAIADGIAIRAAKFVAGNFIPIIGRMFTDAADTVVTASVLLKNTVGLFGVALLLLIAAFPAIKI.LVIALIYQLAAAILQP..M.G.GGIVI...SCLSIMSKSIMYVLVA..LMI..VS..L..MFFLSMTVIIAAG............
A0A0M1P3L1_9BACL/76-395              ....................................................tps-----LMDMLLP-GGDGLSFKG.VMSGIGKYLWHEVLYNGKLLATIVMLSIMSLILENLQSAFE.K.STV.S...RVAYTICYMVVLVIAVNSFNIAIGYARDAITQMIDFMMAMLPLLFALMASMG........NVVTVSVAHPLVIFMVHTVGTLIST........IVFPLLFFSA...LLHLVSSLS.E..KYKLTQLGNLLRGISMGVLGVLLTVFLGVISVQGLTSSVTDGVTIRAAKYVTGNFVPVVGKMFADATDTVISASLLVKNSIGLAGVIIILFLCAFPAIKI.LTLALIYNVAAAVMQP..L.G.DTPIG...TCLQMIGKTMLYVFTA..LAA..VS..M..MFFLAITILLTAG............
A0A1Y4GZF4_9FIRM/55-366              .................................................spdeml----------------DMQPAD.WLRKLWDSFSQQVTAPLRVFVRLALVLVLGSVAMAPAG-TG.D.RAL.I...PVLELVCLLVCAAACVQPMQQLMEQAQQQLFYCRTSLVTAVPWMASLMAGGG........RVASSAVFSGFFLSIVLLLSELAAG........VVFPLMQILL...ALFTAAGVC.R..FPAMDAAASFCQRSIKWMLGLGCTLFVTLLGVQNLMASASDSLAMKTGKFLITSSVPIVGQAVSGAISALAAGTQLARGTAGLALIAIIGASFIPVLLSC.LAFWAAFSAAGVIART..V.E.CGRCA...QLLRGAASCASLCGLT..LLF..YG..L..LVLLAILMMM---lgg.........
R5BD74_9CLOT/28-345                  .......................................................FTLKELMER-FM-GTGAMDAEG.IWQRLIAAITGALKQNMLSYLAIIAAAFICAIICIMS---A.E.DGA.G...GAGALVCAAIGTSAAAAKLSVLIASAYGAMDSLCSCMELIAPVLSAAIAASG........EAASSAALSPLAAFLSGTVAGVFKS........TVLPLCAGAG...VCAMLSALT.G..EEKLSKLFKLIKSLIRWLSGAVFTLYFATVGIWGIGARSSDSVAVKTAKYAIDKGVPIVGGAVSGTVDTVLEGASLIKNSAGLAALVTLALVVLSPLASM.ACNAVCARGTAAVCSA..L.G.DARIS...TLMERVADAINGLFAS..VLA..VA..A..MFMATCALALGT-a...........
A0A150KMG5_9BACI/68-387              ..................................................sqkgs-----LID-FIK-GDKDFSLNQ.WFHGILKFFFHELIANGKLLGSLIILTIFSMFLQSLHNAFE.Q.GTI.S...KVAYAIVFIVIIILALNSFHVAIDYAKNAITMMINFIVAIIPLLLALISTSG........GVTSAAFFHPVILFLMNTSGILVQY........IVLPLLLLST...VLSIVSTLS.-..EYKATQLAQLLRNCSIGLLGIFMTIFLGVISVQGTATAVADGITIRTAKFVTGNFIPVVGRMFTDAADTVISASALLKNTLGIAGVAIVLIIAAFPAIKI.LVLAFMFKFTAAIIQP..I.G.NGPVI...RCLDTISKNMVYVFAA..LAI..VA..F..MFFLCITIIITAG............
D5WV76_KYRT2/147-459                 ............................................vgfvengsgsw---------------------G.VLKGLARFVLDEWGKSLGLLGMLILLAIFAAVLETLQGSFA.H.PEV.S...RIAFAGVYLALLVLAVQSFFGAVGAARGAVQTMIDFMLAVLPLLMALLAAVG........AFSTAAVLHPLTIGITHVVGYVTTT........VVIPLIFFSA...VLDITSLLS.D..RYRATQLAGVLRSAAITVLGLCLTVFLGVIAISGGTRAVADGVAIRVAKFATASFVPVVGKMFSDATETVVGASLLLKNVVGVAGAVVMLMICAFPALKI.LTVAMVYNIAGALVQP..L.G.TSTLA...QSLGAIGKTLMILFAA..VAT..VG..M..MFFLAITAVITV-g...........
R6MGD7_9FIRM/32-352                  ......................................................l--FNQTVERSMT-GDLSLNPTD.ILNMLSDDIMGEIRECTDDVIILFIIAAISGIITTISTSFG.N.KST.S...EAAFFACFTLMSAAAIKCFGTAMEYGTTVVTAMTDFITKFSPLLMIMIATSG........KAVSASTFQPVMSAAVYVVSIIIEK........CLVPLIAFSS...VLAVAGNIS.D..KVQLSGFCKVVKSISKWLMAAIITIFTGISAIYGFSSPALDAVSGKAVKFAVGSLVPVVGTFLSDTLETVVSGTRLMKNAVGTSGIIVMCVICVLPILKI.GVIQLMLKLTSSIAEP..L.T.DKRVS...SMLWEVSESVTTIFAV..VVM..VA..V..LFMINISIMITST............
A0A1Y4S253_9FIRM/80-400              .......................................................FQFENTVLDLIT-GKQAFTLES.FLEALIAQAGNNWETEKQILLSILILGIAASLFSSFATVFQ.N.QQI.A...EVSFEITYMLLFLILLQVFTGAADLAASVIGSLRQFMDALIPAYCLAVTMAS........GTTTAVVFYQFLLGLIYVLEWLIQE........GLLGLIQVHV...ILVFINHLS.K..EEYLSQMSELVVKAVGWVLKSVLAVVIGYNAIQGIISPVIDSLKSTAFSRVAQM-IPGIGNVAGSVTDVLLGSAVLIKNGIGAAALIVIVLLCMAPLLKL.GLLVVILELAAALIQP..V.S.DKRMT...GCVAGVGDGIKLLFRA..VFT..VA..V..LFVITIVVVTV--sv..........
A0A1M6F4X3_9CLOT/57-378              ......................................................i-KIKDFVKTLYK-NPEAISFKE.ILNRLWVFTWKELMLNIDLLGKIIILSVFCALLQNLHKGFD.N.ESI.A...ILAYNTCYVIIIIIAIGSFTVVSKLCINTIDKMVSFMQSLLPTLITLLLTVG........GITSSSLFQPIVYTSLTFIATVIKT........IIIPMITLSA...VLSIISNIS.N..KVKITKLASLVRGISVGLLGILLTIFTGIISIQGLAASSLDGLTAKTAKFAVDSFIPIIGDFLSEAFDTVVSCSLIIKNGISIIGLIILMLICLLPIIKI.FSIFAIYKISGALIQP..I.I.DNELV...QCMSDISTSIFIMLCC..VVA..VG..I..LFFISITIIMCI-g...........
A0A1K1U087_9BACL/74-391              ................................................pgffdll-----------F-QEKEISFKA.FFTAFAKFFFHEVMYNGKLLGAIVVLTVFSMLLQTMQNAFE.N.NQV.S...KVAYAIVFLVIVVLAVDSFSVAIEAAKSAIEKMIHFMFALVPLLLTLLGSMG........NLTSVTLFHPLIIFMIHVIGTIIYT........FVFPLLFFST...ILAVVSTIS.N..KYKVNHLAGLLRKVAITVLGGLLTIFLGVISIQGATTAVADGVTIRTAKYITGNFVPVVGRTISEAADTVAGASLLMKNTIGLAGVVILLMICAFPALKI.LTLAFIYNFSAAIMQP..L.G.NSPVI...ESLSAIGKTLIFVFAA..LAA..VG..L..MFFLAITIVITSG............
M1ZBX8_9FIRM/69-389                  ......................................................i-NIKENIISTIK-GQNKLDVNQ.IKEGVIKIFFNEILNNLNLISQILIITVACSILTNLQSTFE.K.DTV.A...QLAHYACYIILAMLMINSFMLALDLGKKTVAQMVNFMQIILPILLTLLTAIG........GANTRFIFHPMVIGVVNIIGSLIKN........LVFPLIFFTF...IIGVISNIS.E..KVQFSKLSELMRQIIIVLISASFTVFIGIITMYGI-GANIDGVTIRTAKFAVDNFIPIIGKFLSDAVEAVIGCSAILKNGIGMIGLVVLFFICIAPAIKI.TVLIFIYKVIAALVEP..I.A.SINIS...SSFSEVSKSLLLLLIG..ILS..VA..T..MFFITITVIVEA-g...........
Q8EQ33_OCEIH/67-385                  ..................................................ktsfy--------DFIK-NINSFSIKD.ILSQFLHYLFHELILNGKLLGSLLMLTLFAVVLQSMQSAFE.K.TTV.S...RVAYFVIFLVLIFLVLNSFYLATSYTKEAIDTMKGFMIALLPLVLGMMASFG........NVVSISFFHPIIIFLINFSGVFISV........FVLPLLFLSA...MLVIISGLN.E..NYKVTHLANLFKSVALGTLGVFLTIFLGVISVQGTASAIQDGVAMKTAKFVTGNFIPVVGRTFTDAADTILSASLILKNALGIAGLVVILFIVAFPAIKV.AAIALIYKIAAAVLQP..I.G.GGPIV...QALNTISTYILYILAC..LLA..VS..L..MFLLAIVIIVAAS............
A0A2C1KQ27_9BACI/74-394              ..................................................sqkgs-----LLQF-LS-GEKELSFQE.WMKAFLKFLFHELIANGKLLGTLILLTIFSMLLQLLQNAFN.Q.STV.S...KVAYALVYMVLIIIALNSFHVAIEYTTNAIESMTNFILALIPLLLALMASSG........GIISAAFFHPVIIFLMNTSGLLIQN........VVLPLLFLSA...LLSIVSTLT.D..QYKVTQLAGLLRNISIGLLASFLTIFLGVISVQGASAAVSDGITIRTAKFITGNFIPVLGRMFTDATDTVISASVLLKNTVGVIGVAILLFIAAFPAIKV.LSLAFIYKFAASILQP..L.G.GGPVI...TCLDIISKSVIYIFAA..LAI..VS..L..MFFLSLTVIIAAG............
A0A1M5T3S6_9CLOT/70-392              ......................................................l-NPKAYIENVMKSGESGLNIKD.ITKYFLKYITREIGSTFQFLLVLIVVALLSSLLQNLQEAFK.T.GEV.S...NIAYFACYAIIVVIMTKSFLLGVNLGKDTIFRIKEFMNALVPILIMLLASMG........AFTQAALMDPVIVFISNIGVTFICN........IIFPLILISF...VLNFVNNLC.E..ESKVEKLGKLIKGGVLWAQGTLMTVFVTFLTIRGITAKGLDEFTIKTAKFAVDTFIPVVGGCLSDAVSTVAGYTGLVKNAVGTLGLVMIIIIGIFPIIKL.AIMAIAYKFTAAVIEP..I.S.NKKIV...SCISSAGDSLGLIIAS..VVC..VS..V..MCFIMICIVLST-t...........
U5LFS3_9BACI/72-392                  .................................................sqkgsl-------YEFIK-GDKEFSLKE.WMLGGLKFLFHEFLVNGKLLGSLIILTVFSMFLQSLQNSFE.K.SSV.S...KAAYSIIFMVLVIIALNSFRVAVDYSIEAISTMTSFILALVPLLLALIASSG........GLVSAAFFHPVILFLMNISGLFIQY........AVLPLLFLSA...VLSIVSVLS.E..NYKVTQLANLLRNWSIGLLGLFVTIFLGVISVQGASAAITDGVTLRTAKFITGNFIPVIGRMFTDATDTVISASVLLKNTVGIAGVAILLIIAAFPAIKI.LMIAFIYKFAAAVLQP..L.G.GGPVI...ACLDIISKSVIYVFAA..LAL..VS..L..MFFLSITVIIAAG............
A0A1Y4TMJ7_9FIRM/51-370              ........................................iqeyldepeisaeef---------------SSMSLPE.LIAALWKTVSGEFLAPFRLLGQIGALLLLASAALTFAP---.S.DGW.R...QCIELIAVAGCFLLSADGTLELVGQVSAAISDWRLYLASFLPIFAGVMVSCG........QSAGALVCTGLFFSMASLSAQLICS........VAMPLVRAYL...ALNSAAGIS.G..VPPLQEATQGLTRCVRSLLRGVSVGFAAVLGLQNTLAAQSDNLAMRAGGAVLSSSIPVVGAAAQDAMASVLAGLRVVKGSLGFAAIAVLAAAFLPLFARC.LVMRLVLAAGGLLAKA..F.G.LPRSG...AVLEGAAEGAGLCLSF..LVF..FF..M..LVVLSTALMIATG............
A0A0N8GGW5_9BACI/72-392              ..................................................sqkgs-----LID-FMK-GEKEFSFKA.WFSGIFKFAFQELVMNGKLLGTLIMLTIFSMFLQSLQNAFE.G.GSV.S...KVAYSIIFMVLIIIALNSFHVAIDYTRDAISTMVHFIIALIPLLLALIAASG........GVVSAAFFHPVIIFLMNTSGLLIQN........VVLPLLFLSA...LLSIVSTLS.S..HYKVTQLAQLLRTWSIGLLGAFMTVFLGVISVQGATAAVTDGITIRTAKFVTGNFVPVIGRMFTDATDTVISASVLLKNTVGIAGVAIVLIIAAFPAIKI.LMIAFIYKLAAALLQP..L.G.GGPVI...ECLDTIAKSVIYVFAA..LAI..VS..F..MFFLSLTVIIAAG............
A0A0Q3RWX9_9BACI/3-292               ...................tnlllpvkeviqtftyillfgfiflclewlipkskr----------------------.-----------------------------------------.-.---.-...-LLKLLFIYLICFLCLEPAYRTLEMIQTLTSQLVTLFLGMYPVLTAGIAVSG........GALLVTLWNPAVVFFSTFTAFMAEK........VLIPSIMAAF...LLDLISRIH.P..ATSFSKLSDLIRMTLIGITSVILVLYSFFITVNGVITWTVGGAVNESVKRLIQNSIPFVGSLLTESISTMKTYSSSASVITGNSLLISVLVLVSIPTIQT.ILIAFLYRLLAAILEP..F.L.DSGIS...GLLDDIGRTLFVLSII..SVL..IA..F..AFFFTIILTM---lfa.........
R5XG71_9CLOT/75-396                  ......................................................l-NLKQYIKDLIK-GEAKLTDLI.NIQSLKNLILQQLSASLKVIIMIIVLALLSSILKSLESSFS.S.GEV.T...KIVNYIIFITMVTLVLVNFKDVLSIAYTTVNSIISIVNILIPILLSLMVVGG........LTATSATLSPVFVGGVSVINLVFKN........IIFTLITLAF...CVLVVNNLS.K..NIKLKRFSELLKKANIVIVGAVFIIYLGLISIQGIYVTSFDKFTVKSAKFAVGSFIPVIGNFVSDSVDILLSSSLLIKNIFGSIGLILLIGICLVPIIKI.FSIIIVYKIGAAIVEP..I.G.EDNIS...SFMDETSKLMTVILVS..VLA..VL..I..MFFITISILTS--ls..........
A0A090IWB8_9BACI/77-395              ....................................................kes------FTDYID-KVNEFSFKE.WAIGILKFIFHEMIVNGKLIGTLIMLTIFSMLLQSLQNAFE.T.TTV.S...KIAYSIVFMVLMIIALNSFHLAVQYASGAIQNMIHFTIAFIPILLALIATGG........GVISAGFFHPVILFLTNVSGLFVDR........IVLPLLFLSV...LLSIVSTLT.S..QYKATQLAGLLRNWSIGLLGVFMTVFLSIVSIQGSATAVADGIAIKTTKFVTSNFIPVVGRMVSDATDTVISASVLLKNTVGLAGVGILLLLTLFPAVKI.LIIAFVYKFSAALLQP..L.G.GGPII...TCLDIISKSVIYLFAA..LAI..VS..I..MFFLSLTVIVVAG............
A0A0M8QAK6_9BACI/1-297               ....................................................mqa---------------------Q.ILSFLTDPFFLLLKMTLILCGYVVIILIVNMVLPEFE----.-.KGT.R...ILFFLIVLATVGPVVVDSFRLIDEI----AQGISHIFMAFYPILTSTFLLSS........SVMAIASWQPFILFFVQVLTIVSAK........WLIPAVLLAV...VFDVSSVIV.K..DISFTRIAEFIRFTILSIVSASVICYIILMSASGVAAFSVNRAVAEPVKKLIEENIPIVGSFIVDSFSMFQQMSQFSTSITSISAFVAVVTVAFIPTVQL.VVSAYSLKLLAAILEP..I.A.FDDIC...KLLEQVSKSLFTLCAV..SFL..IAfsF..MFSCFFLIV----fvq.........
A0A2A8ILY9_9BACI/72-392              .................................................sqkgsl-------YDFVS-GEKKFSFKQ.WGLGVVKFAFQEFVSNGKLLGSLIMLTIFSMFLQSMQNAFE.K.STI.S...KVAYSIVYMVLVIIALNSFHIAIVYTNEAIGSMISFVLALVPLLLALIAASG........GLISAAFFHPVILFLMNISGMFMQY........IILPLLFLAT...LLSIVSTMS.E..QYKVSQLAALLRNWCIGLMGLFLTVFLGVISVQGASAAVTDGITIRTAKFVTGNFIPVIGRMFTDATDTVVGASVLLKNTVGIAGVGILLIIVAFPAIKI.LMIAFIYKFAAAILQP..L.G.GGPII...TCLDIISKSVIYVFAA..LGI..VS..L..MFFLCITVIVAAG............
A0A1V4IUW2_9CLOT/56-378              ......................................................l-DIQQFVKTYMKTGNDSSFLKK.LYTALLTYTFKEVVSAVKLIVVVIIIAIIAALLNNLQNAFS.N.DSL.S...NIAFFACYAMLIIVLSKSFLVGLNLAKDTINSISNFMLALLPVLVMLIASVG........GITQAASMDPIIIAAVNICTRFYVL........LVIPMILMGF...VLQFVNNVT.S..DGKVDKLAKSINKLALWLQGGMMTGFVALLTIRGITSKTLDEVTVKTAKFAVDNFIPVVGKCLSDAISTVAGYTVLLKNALSAAGLIIVVIVMIFPIIKI.FIIAAAYKLTGAIIEP..I.S.DKRIV...NSICSVGDSLILINSC..LIS..IS..I..MFFILISILASSG............
R7LA14_9CLOT/63-382                  .......................................................FNVDDIFNKAIK-GE--IDNES.IIKKFLSIIGKEIIDCIGVLGTVIVIIVIHSILKSISDGLE.N.KTV.S...QIVYYVQYILIVTLIMVNFADIISMVKNSIDSLVGFMNSLIPILITLMLTTG........SFTSASLLEPILLFLITFIGNFINM........IIIPFVLIST...ALAIVSKVS.E..RIQLDKLSKFFNSSIVWILGIVLTIFVGLASVEGSLSSTVDGITAKTTKAAVSNFIPVVGKILGDAVETVIGCGAILKNAVGIVGVIVVISICMAPIIKL.AILMGLYYLSAAVCQP..I.A.DEKII...KLLDQMGDTFKILFAI..LCS..IS..I..MLVIGVTLVIKI-s...........
A0A0U1KMX5_9BACI/74-391              ....................................................vsl-------RQFLQ-DQNILSMKD.WFKAIITYIGYEILASGELLGTLIVLSLCSIVLHMIQNSFE.S.STV.S...KVSDLVVILVLFVLAMQSFQVASSYVTETVMQMRDFMVALLPLMLGLMASFG........SLTAVSFFHPIIVSCMHITVLLINY........LIIPLFFISA...ILQMVSALN.D..SFQVTKLAQLLKNTGLALLGILLTIFLSVVSVQGATSAIQDGVAMKTTKFVTGNFIPVVGKLFTDATDTVLSASLLLKNAVGIVGVIILIVIVLFPAIKI.FVISFIYKISIAIIQP..L.G.NGPVL...KCLDIMSKHILYLFAA..LLT..VS..L..MFFLMIVIIVIA-s...........
R5NR28_9CLOT/58-352                  .......................................................IDISQIFEETVS-GK--LDNTK.IIKYIIAILGDNMKGAITMIAGIIVVVIIHSILKAISENLG.N.ESI.A...KIAYYIQYILIITLVMKNFSDIITGIKTSIQNLSAFTNTLIPLLSTLMITTG........NIVTSRMIEPMLLFLITFISNLIVN........VIIPIILVAT...ALGIISKIS.D..EVQVDKLSKFFKKGSVWVLTTVLGLFMTLTTLEGGVTSGLDGVTLKAGKSIVSNAIPVVGGILGDAIDTVLGYSNIIKNAVGIVGIIVVMCICIQPILNL.TALTITYYLGAALCQP..I.A.DEKIV...RV--------------..---..--..-..-------------nrangrni....
A0A101E9G6_9FIRM/1-145               .....................................................mg----------------------.-----------------------------------------.-.---.-...----------------------------------------------------........-------------------------........----------...---------.-..---------------TASLGIFLTLFVGFLGMQGIAGVVVDSVTLKTAKFMTGTFVPVVGKMMADALEVIVGTSLLLKNAVGLIGIIILLVLCAFPVIKI.ISLVIIYRLAAALVQL..I.G.ESGVS...DALQTMGNALTLVFAA..VAG..VG..L..MFFIAISVVVGMG............
V6T1K6_9BACI/72-392                  .................................................sqkgsl-------YDFIS-GEKKFSLKE.WFKGILNFAFHEFIVNGKLLGSLILLTVFSMFLQALQNSFE.K.STI.S...KVAYSIVFMVLIIIALNSFHVVVDYTNDTISTMIQFILALIPLLLALMATSG........GLISAAFFHPVILFMMNTSGMFIQY........VVLPLLFLST...LLSIVSILS.D..HYKVTQLASMLRNWSVGLLGILLTVFLGVISVQGASSAVTDGVTVKTAKFITGNFVPVIGRVFTDATDTVISASMLLKNTVGLAGVAILLIIAAFPAVKI.LMVAFIYKFAAAILQP..L.G.GGPVI...TCLDVISKSIIYVFAA..LGI..VS..L..MFFLTITVIIAAG............
A0A1V2YDN3_9FIRM/61-382              .......................................................FDLREEVSLILS-GQSRWQLGD.ILGFIVNRLLGEFFTYISVVIRFILIIIVCNILSNLSSAFE.S.DNT.T...KVAFFVCNIVVLYSLMQSLILVVDLAYSTIETLQSIMLVILPTILAFMASSG........YIATSAALSPIIVTGLTVITFVIQN........LMLPSVVGII...VLQVISNMS.D..EFKIDKFIQLYYKISKWMLKTIFFASIALMGIYRMSLPFVDTTMKRVGVTLSAKFIPILGSAVSGAIDMIIGISGMIKNAFGFGVIVWIVLLVSMPLIKM.LAYTLLYYFAGAIIEP..I.G.DKKMA...NIATDIAKGCEFVMSI..VGV..VA..I..LCTLAVAICMSI-g...........
A0A1B1Z619_9BACI/67-387              .................................................sqkgtf-------FEFVK-GDKEFSIKA.YMIGLLKFMFHEMAVHGKLLGTLILLTVFSMLLQSIQNAFD.K.SAI.S...KVAYSIIYMVLIILALNSFHVAISYAVEAIDTMLSFMIALIPLLLALMATVG........SIASVAFFHPVILFLVNTSGLLIKN........FVLPLLFLSA...LLSIVSTMS.E..HHKVTQLAKLLRNISIGSLAFFFTVFLGVMSVQGATAAVADGITIKTAKFITGNFIPVVGRMFTDATDTVMSASILLKNSVGIIGAALLLLIAIFPAIKV.LILAFIYSMASALLQP..L.G.GGPIV...ECLGIIGKSVMFIFAA..LMT..VS..I..MFFLAITIIIAAG............
A0A0M2SK36_9BACI/69-389              ...................................................sqkg-----SLDDFIK-GEKEFSLKD.WLTGIIKFMFHEFIANGKLLGSLVLLTIFSIFLQTLQNSFE.K.STV.S...KVAYAIVFMVLIIIALNSFHVVMDYTNKAIGTMIQFILALIPLLLALIAASG........GVVSASFFHPVILFLMNTSGMFIQY........VVLPLLLLSA...ILSIVSILT.E..HYKVTQLAGLLRNWSIGLLGLFLTVFLGVISVQGAATAVSDGIAIKTAKFITGNFIPVIGRVFTDAADTVISASVLLKNTVGLAGVVILLFIAAFPAVKI.LLISFIYKFAAAILQP..L.G.GGPVI...ACLDVISKAILYVFAA..LAI..VS..L..MFFLSITVIVAAG............
R8NWR3_BACCE/63-383                  ..................................................sqkgs-----FM-EFVK-GEKEFSIKE.WMIVLLKYLFHELVANGKLLGTLIMLTIFSALLQSLQSAFS.K.SSI.S...KIADAVVYMVLIIFALNSFYVVMTYARETIQTMVDFILALLPILLALIATGG........GVVSVSFFHPIIIFLMNTSGLLMNY........IVLPLLLLAT...ILSIVSTMS.D..QYKVTKLSKLLQNVSVGIIGIFLTVFLGVLSVQGTATAVADGIAVKTAKFVTGNFIPVVGRMFTEAADTVISASGLLKNTVGIIGLVILCLIVAFPAIQI.FCIAFIYKFAAAVLQP..V.G.GGAII...KCLDIIGRSIIYVFAC..LAI..VS..F..MFFLSITIIIAAG............
Q65HI0_BACLD/74-394                  .................................................sqkgsl------LEF-VK-GEKHFSPEE.WGKALFSYLFHEVLANGKLLGTLILLTIFCVLLQLLQNAFQ.Q.STV.S...KVAYAIVYMVLIILALNSFRVAVTYANEAIQTMTSFILSLVPLLLALMATSG........GAASAAFFHPVILFLMNTSGLFIQY........IVLPLLFLSA...ILSIVSTMT.D..QYKVTQLAQLLRNAAIGTLAAFLTVFLGVISVQGASAAVTDGITLRTAKFITGNFIPVLGRMFTEATDTVISASLLLKNTVGILGVAILICIAAFPAIKI.LSLALIYKIAAAVLQP..L.G.GGPVI...SCLDVISKSVIYIFAA..MAI..VS..L..MFFLSLTVIITAG............
X0RKT1_9BACI/74-394                  ..................................................sqkgs-----LM-DFLK-GEKEFSLKE.WGLSLVRYFFHEILVSGKLLGSLILLTIFCLILQSLQNAFE.K.HTI.S...KVAYSITYLVLMIIALNGFRLAITYAEEAVQSMTSFMVAMLPLLLALMASIG........NVTSAALFHPLIVFLVHTSGLLIQF........VVFPLLFLST...ILYIVSTLT.E..QYKVTKLAQFLRTIAIGVLGVFLTVFLGVISVQGASSAITDGITVRTAKFIAGNFVPVVGRMFTDAADTVLSASLLLKNTVGVAGLAILLILCAFPALKV.LGLAFIFNFTSAILQP..L.G.GGPII...ECLAIIGKAIIYVFAA..LAI..VC..L..MFFLAVTIMISA-s...........
A0A0U1P1E8_9BACI/72-392              ..................................................sqkgs-----LVDF-VK-GEKKFSFQE.WGKGILKFVFQEFVANGKLLGSLIMLTIFSMFLQSMQNAFE.S.SAI.S...KVAYSIVYMVLIIIALNSFHIAISYTNEAIGTMISFVMALIPILLALMAASG........GLISAAFFHPVILFLMNTSGLLMQY........IILPLLFLAT...LLSIVSTMS.D..QYKVTQLAQLLRNWSIGLMGLFLTVFLGVVSVQGASTAVTDGVTIRTAKFITGNFIPVIGRVFTDATDTVVSASSLLKNTVGIAGVAILLIIVAFPAIKI.LMIAFIYKFAAAILQP..I.G.GGPVI...TCLDIISKSVIYVFAA..LGI..VS..L..MFFLSITVIVAAG............
A0A1Y4LIK4_9FIRM/41-354              .............................................vtetdglgqg-------------------VQS.ILETGLDQAGSLLRHSFQTGLKLLAVVLLCGLAESAAL-DG.K.AGG.L...KAVEVAGALAVTALTVSDMNAMIGLGRETIQQMDAFAGLLLPAMATLTAATG........GVTGAAVRQGVTVLFSDLLITAIDR........LLVPLLYAYV...AACCAQAAL.G..NEGLKKLSALIKGAITFLLTAGLLVFVGYLAASGAIAGSADAAAVKAAKLAISRAVPVVGGILSDAAETVLAGAGVLRGTVGVVGTLVVLAICIVPFLQL.AFHYLTYKGAAVLTGT..V.A.GSGLS...RLMDEIGGAFGLILGM..TGS..CA..L..ILLFSIVSA----vsava.......
E5WIF8_9BACI/75-358                  .................................................sqkgsl-------YEFIK-GEKEFSLKE.WAAGAMKFVFHEFIVNGKLLGTLILLTVFSMFLQSLQNSFE.K.STV.S...KAAYSIVFMVLIIIALNSFHVAITYTQETISTMVSFIMALIPLLLALIASSG........GVVSAAFFHPVILFLMNVSGLFIQY........IILPLLFLSA...LLSIVSTLS.E..HYKVTQLANLLRNWSIGLLGMFLTVFLGVISVQGASAAVTDGITIRTAKFITGNFIPVIGRMFTDATDTVISASVLLKNTVGIAGVAILLIIAAFPAIKI.LMIAFIYKFAAAILQP..L.G.G----...----------------..---..--..-..-------------ra..........
A0A0J1IMP3_BACCI/83-403              .................................................sqkgsl-------YDFMT-GNKNFDLQG.FFHGMLQFAFHEIIVNGKLLGSLILLTIFSVMLQMLQNSFE.K.SSI.S...KVAYAIVFMVLIILALNSFHVAITYASDAISNMTHFILAFVPLLLALMAASG........GAISAAFFHPVILFLMNTSGMLIEY........IVLPLLFLST...LLHVVSSLS.E..QYKVTQLANLLRNISIGILGIFLTIFLGVISVQGASSAITDGITIKTAKFVTGNFIPVIGRMFTDATDTVINASLLLKNTVGIAGVVILLLLVAFPAIKI.LMISFIYKFAAAILQP..I.G.GGPVI...KCLDVISKSVIYVFAA..LAI..VS..L..MFFLSITVIIVA-s...........
A0A1M4SD22_9FIRM/59-379              .......................................................FNTKEFLRNLVK-GNISFNPKD.IVRNIWLVFFKELRLSLILLAKILIITLISSILTNLQSTFE.N.ASV.A...ELANYISYVLIAILVISSFDQVMDLARNTVDNMVGFMQVILPILLTLLTAAS........GPNTKMLFHPMILMTVNFIGILIKT........IILPLIYFSF...IISIISNIS.N..RMEFSKLSELGRQVITFIISGALTLFIGIITIYGLG-TKMDGLTIRTAKFAIDKFIPIVGGFLSDAVEAVVGCSAILKNGLGVIGLLILLFICILPIIKI.LVLLFAYKLISVVIQP..I.G.SSNLV...EFFNQVGKSLLLILVS..LIS..TG..T..MFFITITIIVET-g...........
W7YWA5_9BACL/69-389                  ...................................................ktpt-----FVDMLIP-GGDGFSIKN.VFSALMKFMWHEVLYNGKLLVTIVMLSIMSMILETLQSAFE.R.KSV.S...KIAYSLCYMVIIVLAINSFNVAIGYAKEAIDRMIDFMMAMMPLLFALLASMG........NIVTVSVTHPLIVFMINTVGTLIYT........IVFPLLFFSA...ILHLVSSLS.D..KYKLTQLANLLRNISVGFLGALLTVFLGVISVQGITSSVTDGVTIRAAKYVSGSFIPVVGKMFADATDTVISASLLVKNSIGLAGVIIILFLCAFPALKI.LTLALIYNVAAAVMQP..L.G.ESPIT...TCLETIGKSMIYVFAA..LAA..VG..L..MFFLAITIMLTAG............
R5W373_9DELT/54-374                  ......................................................g-SFVEKVKQIIN-GELD-SAES.FFEVLLSMTGSTVSQIFPQLAAIFCVLVICGVARHTSDGLI.S.GET.E...KVISFVGITVVVISVLSLVVDAYRQVQTMLSQVAALTDASMPILLTLVIANG........GNAASAVCQPSMVMYSSFVINIVQG........VLLPLSVFGL...AFVVVSNIS.S..DLRVTKMADFVNSASSWILGIVFTLFSAFTAVQGITAATVDGVSYRAAKFAAKNYIPILGGYISEGFDIVVASTSLIKNAFGAVGMLVVFFMALQPLVTL.LCVNLGLQALSAVSEP..I.V.EERYI...RLLSGISKSLTFLAVL..VVA..VA..F..MFCILAIVAIS--ca..........
A0A1H1MS11_9BACL/75-395              ....................................................kmp----SFMEM-VTPGGEGLKPAS.VLKALFAMLAHEVLYNGKLLVSIVLLAVFSSILQTLQSAFE.R.QAV.S...QVAYAVAYMVLIVLAVNSFHVAIGYARDAIETMIQFMMAMVPLLMTLIASTG........SIATVTLLHPVIIFMVHLVGTLIYT........VVFPLLFFSA...VLHIASAMS.D..RFRVTQLANLLRTVGAGLLGVMLSVFLGVISIQGATGSMTDGVTMRTAKFISGSFVPVVGKSFSDAADTVISASMLAKNAVGLAGVIILIFLSAFPAIKI.LVLAAIYNVCGAVLQP..L.G.SSPIT...VCLSTIGKTMLYVFGA..LAA..VS..L..MFFLAVTIILTAG............
R5JFX9_9FIRM/95-412                  ......................................................l-SFSRVYER-LENFDVDGLFAD.IGDSILGTISDEILGNRAMLAELIIIIVIGGIMSVVAS-QN.N.SGV.K...ESSFYVIYLALSGLMLGSFAVVYDLAGSVIQRINDYMMAFVPSMSVVLEMTN........GSRTAVYAYEAIILTAYLCEKVLGR........IVLPLIKSIA...LISLANKLN.T..EGYFSKLIALMTSVVNWIIRILLALVTGVNVVKGMLAGAADSVERTGFLKAVAM-LPG-GRAYSVIADIFVSSGVVVKNILGIGGCVVLISILIVPVIKV.IIIMFLYRVTAAITGP..V.G.DRRYS...DGVSIMAADIALLLKS..LMV..AL..L..MFLICITIIL---yf..........
A0A1H3K9M4_9FIRM/66-387              .......................................................IDFSKVITSLIK-GEKVFDEEK.IITGIFKLIFREVVANSELLAKLLILSIICSVLTNLQSAFE.K.DTV.G...EIAFYVCYIILISLSIKSFVIAMQITWNAINNMVILMQTLLPILLVLLVAVG........GITSSSLFKPIILGTLSIISTLIRD........GILPLVLYST...IIGIICKIS.S..RIQITKISSLIRQISVGIMGISLTIFIGIISIQGATASKVDGVTIRTAKFAVDKFVPIVGKFLSDIMETVVGCSVVLKNAVGAIGMISLFLICIIPIIKI.LSLILIYKIAGALIEP..M.T.NSRIV...DCLSEISKSLVMLLAI..VTS..VG..V..MFFIAVTIIIGAG............
R5EC19_9FIRM/35-343                  .............................lmpedtgsfaaglmellrdavlglrp----------------------.-----------DLKEASKVSLGVIAAVMMVSLLQSFS----.-.GSV.K...TVANLAGATAIAAGLLLSANSLIRLGSQTVTEISEYGKLLLPVMTAAMAAQG........GAASSTALYAGTAVFDSVLSSLISR........MLGPMVYLFL...ALSAANGAI.G..ENILGKLRDLVKNVVSWSLKTILTVFTTYMTVTGVVSGTTDAAALKATKVTISSVVPVVGGILSDASEAVLVSAGLMKNAAGIYGILAVLAVFLSPFLKI.GVHYLILKLTAAVCGI..F.G.EKGLT...ELIGDFSTAMGLLLAM..TGS..EC..L..LLLISTV------cflk........
A0A073JZ77_9BACI/57-377              ..................................................sqkgs------FMDFVK-GEKEFSVKE.WMIGLLKYLFHELIANGKLLGTLIMLTIFSALLQSLQSAFA.K.SSV.S...KIADAVVYMVLIIFALNSFYVVMTYARETIQTMVDFVLALLPILLALIATGG........GIVSVSFFHPIIVFLMHTSGLLMNY........IVLPLLLLAT...ILSIVSTMS.D..QYKVTKLAKLLQNVSVSVIGIFLTIFLGVLSVQGTATAVADGIAVKTAKFVTGNFIPVVGRMFTEAADTVISASALLKNTVGIVGVVILLLIVAFPAIQI.FCIAFIYKFAAAVLQP..V.G.SNSII...QCLDIIGRSIIYVFAS..LAI..VS..F..MFFLSITIIIAAG............
A0A143HBQ1_9BACL/4-292               .......................fliepfkeqffalrsfflyailflcinwllpt----------------------.-----------------------------------------.-.--M.K...EWTRFFFLIVVIMVTIRPVFKAFTQMQHITEQLMDVYLVLSPLLTSSLLLGS........GIFSVLSISPVFLIFLQTILVVVTK........YLIPMLIATF...VFDFITRML.P..ELSFAKMSDFLRMSVLSVVSVSVLIYTMLLATNGVLVGTFSGEIAEPVKRLLQQNIPIIGSLVTESLNTFKKYSSTALITTSTGLLVSVWSVTILPTLNI.LILGFCYRFLAAVLEP..F.T.DSKVN...GLIEDVSKTLFILCAV..SFL..IA..F..AYFFTIMMVVL--mv..........
A6NV00_9FIRM/56-369                  ..............................................itpdtglee------------------GLQA.ILDTGSDEVFGVVRKAVRSGVLLLAVVLLCALADGMKAAGQ.L.GGG.I...DVVAVAGALAVTAVAVADVNTLIGLGREALDNMNMFSKVLLPTITAAAAASG........APSGAAARQLATVLFSDVLMSLITH........LLIPLVYAYI...AAATAYAAL.G..NEGLKRIGGVLKWVVTTVLTSVLIIFVGYLTVSGVIAGTADAATVKAAKFAVSSVVPVVGGILSDAAETVLVGASVLRNTVGVFGMLTVLGICLVPFLQL.GIHYLAYKLTAALTGT..V.S.AGRVT...GLIDSIGGAFGLVLGM..TGA..CA..L..LMLVSIVS-----aisvv.......
F4XAH8_9FIRM/38-351                  ................................................dygvstd-------------GGLGQGVQN.LLEAAVDQLGGLLRHSLGTALKLLAVVLLCGLAQGLEE---.D.KPV.G..lGAVELAGALAITALTVSDMTTMVGLGRETISKMGDFADLILPAMATLTAATG........SVTGAAVRQGVTVLFSDLLITAVDS........LLVPLVYAYI...ALSCAQAAL.G..NGGLGKLAGLVRGTAVFFLTAMLLAFTGYLTASGAIAGSVDAAVVKTARMTISRAVPVVGGILSDAAESALASTSVLRGTVGVAGMLVVLAICLTPFLQL.ALHYLAYKLAAALAGT..V.D.HSRLG...ALMDSIGGAFGLLLGM..TGS..CA..L..MLLLSIVSA----vsa.........
E7GNS3_CLOSY/81-401                  .......................................................FTFKELIKELIK-GNFSEVFHE.CLLTLRDSLFGEITKNGKWIGQVLILGLIGAVFANFSSIFS.N.SQI.A...ETGFYVTYLLMFTFLASSFLTGISITKELLSHIIEFMRALVPTYFLAVSFAG........GSITSAAGYGWMLFSISIVEWLVLK........LLMPLLRIYI...LFVLAGHMV.K..EDIFSKMTDLLDSSIRWGLKTMMGVVLGFHLLQNLVTPYADALKNTSLQRFVSV-IPGLGQGAAAVSQMVMGTGVLIKNSIGAGAVIILVLISAIPLLKL.VILCLFYQGAAALLQP..V.C.DKRMV...ACISEVGNGCRLLLSM..AGA..AL..L..LFGVSLAIICTA-a...........
R6BIA5_9FIRM/1-299                   ...................................................mktl----------------------.----VFDALLLEWKNQKETALQVFLLVIVAALVLNFTDLME.K.NGT.A...LISFFMMYLMLAAVLMKGFTGMSRMTDATLGRVNGFMKALVPSYFAAAVFAG........NSVGGLAFYESAILLIAAVQWVQRY........LLLPGVQLYV...LFLLLDHLS.K..DDRLSHLAELVRTVIEWAMKSMTAAAIGFQVIQGLILPAVDGLKNTAVSRTVSA-IPGIGNLFGSVTDTVLGSAVLLKNAVGVCGMIAVLILCLAPVCRL.AFCTLIYKAMAALVQP..V.G.DKRLN...ECVAAVAEGVGLLLKI..MVS..SS..M..LFFLTIAIVTA--s...........
A0A0N0YG24_THEVU/52-372              ...................................................qgqs-----LFDLLLS-PNKELSLEQ.MLMGFVRFFFHEILYNGKLLGTIVVLTVLSMLLRTLQTAFE.Q.NQV.S...KVAYAIVFMVLIILAANSFHVAVDSAKTAIGRMIDFMLALVPMMLTLLVSMG........NIGSVALFHPLIVFMIHTIGTFIYT........IVFPLLFLSA...ILSIVSCLS.E..KYKVNQLASLLRKISVSVLGGLLAIFLGVISIQGATASIADGVTLRTAKYLTGNFIPVIGRTISEAADTVMGASLLVKNTIGLAGVLILLFICAFPALKI.LSLAFIYNFTAAVMQP..L.G.NSPII...ESLSTIGRTLIYIFAA..LAT..VG..L..MFFLAITIIVASG............
A0A1E7DMT6_9BACI/43-354              .................................................fdlasf-----------------FSLDS.WLSALKSYVFFEITTHAESLAIIFLLSILASVLKTVGQALE.T.QTV.T...KTAEAAVLIPIFILAMNTFRLAVESVSVAVEQMTVFMMAFMPVLIALLTISG........AVASAALFPPLLLFMMNGSGILIDQ........IILPCLIFSV...LFSLISLLS.D..HYNADRIASLLRTVSVSLLSSFMAVFLAILTMRGMTAAAADGLTVKTAKFLSGTFVPVVGRMMADAADTASGAALMIHNTAGAAGIGLLLLTALFPVVKL.MVLVFLYKASAAVLQP..L.G.DSAAA...SLLEVIGKTMSYMLAS..LAL..VS..F..MYFLFMAAVVSAG............
D6DGY9_CLOSC/96-416                  .......................................................FSFEELLLTLLK-GDFAGAFSQ.ALSGLKAALFSELSSGTRLMTQVLLISMAGAVFSCFSDIFS.G.GQI.S...ETAFYVTFLLLFSLLAASFYGSLSIAGEAISTVLGFMKTLAPAYFMAVSFTG........GGLSAAAGCEWMLLSITAVEWLLST........FLLPLTKVYI...LLVLAGHLT.K..EELFSRMTVLIKNIIEWSLKTVTGIVLGFQLLQGMVLPYADAIKNVSIQRLISV-IPGIGQGASAISQMVLGSGILIKNTVGAAAAVVLILLTAVPLLKL.LILMALYHGLAAVTEP..V.C.DKRIA...ACISDMGKAHQILIRL..VLT..SA..F..LFIISIGVICMT-s...........
A0A1H2UAZ3_9BACL/72-391              ......................................................d----DLFDMILAQAKGGWDWGK.FFLTFGKYLFHEVLYNGKLLGTIIVLTVFSMFLSTLQSAFE.R.NQV.S...KIAYAISFLVIIILAIDSFSVAVEAAKGAIGRMIDFMMALVPLVLTLLASMG........NFGSVGMFHPLIVLMVHVIGTVIYS........VVFPLLFFSA...ILSIVSCLS.D..KYKVNQLANLLRTISIGLLGSMLTIFLGIISVQGATAAVTDGVTIRTAKYVTGNFVPVIGRMFSDAADTVVGASLLVKNAVGIAGVVILLFISAFPALKI.LSLAFIYSFSAAVLQP..L.G.NSPII...ECLNIISKTLIYIFAA..LAT..VG..L..MFFLTITIIVAAG............
A0A226YU93_9BACI/68-388              ................................................sktptfv--------ELLT-GTKEFDMSA.IFSGILRYFFHELLYNGKLLASIVILTMFSMVLETLQSSFE.K.NTV.S...KVAYAIAFMVLMIMAINSFSVAIGYANSAISDMIHFMLAVIPLLLTLLASMG........NVVSVSVLHPLIVFMIHAVGTAIYL........VVFPLLFFSA...VLHIVSSLS.D..KYKVSQLANLLRTVSIGCLGVFVTVFLAVISIRGAGSAVVDGVTIRTAKYLAGNFVPVVGRMFSEASETVIGASLLVKNAVGLAGVVIIIVLCAFPALKI.MALALIYNLSAAVMQP..L.G.NNPII...TCLETIGKSLIYVFAA..LAA..VG..L..MFFLALTILITAG............
A0A231QZD8_9BACL/83-402              .............................................lpelrqlmfp-------------QGESWNIGQ.VLSGLAKFFLHEVLYSGKLLVTIVLLTVFTMLLETMQNAFE.R.NAV.S...KVAYGIAYLVVIILAVNSFRTATAYAAEAIGNMVQFMLAMVPLLLTLLAGTG........GVTSVAVLHPLIVFMIHTIGTLVHL........VVFPLLFFSA...VLHLVSAIT.E..RYKATQLANLLRNVGVGLLGILLTVFLGVLSVQGATGAVADGVALRTAKFVTGNFVPVVGKMFSDATDTVMSASLLVKNAVGLAGVIVLIFLCAFPALKI.LTLALIYNLAGAVMQP..L.G.DTPIV...HCLQTIGKTLIYVFAA..LAS..VG..L..MFFLAVTIILTAG............
A0A1M5CYQ8_9BACI/69-389              ..................................................lerts-----IVEF-VK-NQDSFSIKN.TLLGAVKFLFHEIIMNGKLLGLLLLLTLLSVFLQTMQSAFE.N.STV.S...KIAYFVVYIVLIFIALNSFYLAVSYTTEAINMMSSFMIALIPLVLGIMATFG........NIITVSFFSPFVIFLINLSGVLVSK........FILPLLFLSA...LLLIVSSLS.E..NYKATQLADLFRSVGMGALGIFLTIFLGVMSVQGAASAVQDGVAMKTTKFITGNFIPVVGRTITDATDTVLSASLLLKNAVGIVGVAIVLFIALFPALKI.FAIALIYKLAAAILQP..I.G.DGPII...TSLNTISKYIAYMLAC..LLA..VS..F..MFFLAIVIIVTA-s...........
A0A1I6Q974_9BACI/62-382              ..................................................sqkgn-----FMEF-VK-GEKEFSIKE.WVIGLLKYLFHELVANGKLLGTLIMLTIFSALLQSLQSAFA.K.SSV.G...KIADAVVYMVLIVFALNSFYVVMTYTKDTIQTMIDFILALLPILLALIATGG........GVVSVSFFHPIIVFLMNTSGMLMNY........IVLPLLLLAT...ILSIVSTMS.D..QYKVTKLSKLLQNVSVSIIGIFLTIFLGVLSVQGTATAVADGIAVKTAKFVTGNFIPVVGRMFTEAADTVLSASALLKNTVGIVGVVILLLIVAFPAIQI.FCIAFIYKFAAAVLQP..V.G.GGTII...QCLDIIGRSIIYVFAC..LAI..VS..F..MFFLSITIVIAAG............
R9KZ39_9FIRM/31-351                  ....................................................vss---MDFMEDVLK-GNWVLEPDL.FWQYLKEAVLGVMADWKSLFVSVLVLFIAAAVVNGFMQAFK.N.DGA.A...HAARTFFILCELIVLVNAFRDVLAIVSEAMERMLEFLKIMLPAYMICIAAAG........SGLTALIFYKLLLGFLCLIEGIIAA........SLVPIVEGYV...MLGVVESIW.G..EGRFQAIMDIMKKVVQWVMKGMIVLLSGSSILQIIITPVMDKANAAVIQKTAGA-IPGIGDLVESVSSVTLASAIAVKNSLGVLILVVLILLIAAPVIQA.FMIIAVIKVSGALGSI..C.G.EKQMV...KCVSYISEAGMLLLRL..LIT..VA..T..LFFVTIAAVTNAT............
A0A1D8GPQ2_9CLOT/51-372              .......................................................IDLKEGVRGLIR-GESNLTLRD.TMNGLFRYLFKEIVANSMLLIRLIVLAIICAFLNNLSDAFE.S.NAV.G...KLAYIVCYLVIIAIAIQSFSIATAVGIAVINDMVMFMQALLPLLLTLLMAMG........GITSSAMFQPIIIAAVGTISTLMKD........IIMPIIFFSA...ILSIVNNLS.S..KIHVSKLASLLKQACVVLLGFTLTVFIGIITIQGVAASTTDGVTIRTAKFAVDRFIPVVGGFISEAVDAIIGCSLLLKNAIGALGLFSLAFIVIMPLLKI.FSLIVIYKIAAAIIEP..I.T.DSQLV...SCLNDMSSSLVLIFAT..VLS..VA..V..MFFMAVTVIVGAG............
A0A0V8JF52_9BACI/74-394              .................................................tqkgtl-------LEFVK-GEKEFSIKA.WAIGILKYLFYEILVQGKLLGTLILLTVFSMLLQTIQNAFE.H.HSV.S...KVAYAIIYMVLIILALNSFHVAMQYSKEAIETMMNFMMALVPLLLALMATVG........SITSVAFFHPIIVFLVNSSSILINS........FILPLLFLSA...LLSIVSTLS.E..HHKVTQLAKLLRSLGMGALAVFFTVFLSVISVQGATTAVADGITVKTAKFITGNFIPVVGRMFTDATDTVMSASVLLKNTVGIAGVAILFLLAVFPAIKV.LAIGLIYSFAAAVLQP..L.G.GGPII...ECLGIIGKSVFYIFAA..LAT..VS..I..MFFIAVTVIVAAG............
A0A0U3W4B5_9BACI/69-388              .................................................ektsiy--------EFVK-DNGSFSIKN.TLLGIAEFLLHELILNGKLLGTLLMLTLFSSILQTMHTAFE.K.STV.S...KIAYYVVYIVLIYLVLNSFYLAVSYANDAIDTMSSFMIALLPLVLGIMATLG........NVITVAFFHPIIIFLINVSGVLVSK........FILPLLFLSA...LLLIVSSLN.E..NYKVTNLANLFKQIGMGALGVFLTVFLGVMSVQGASSAVQDGVAMKTTKFITGNFIPVVGRTFTDATDTILSASLLLKNAVGIVGVVIILLAAIFPALKI.FAIALIYKLAAAVLQP..I.G.DGPVI...TTLDTISKYIVLILAC..LLA..VT..L..MFFLSIVILVAA-s...........
#=GC seq_cons                        .............................................................h..hlp.Gp.phshpp.hhpslhphhhpElhhstcLlspllllslhsslLpslpsuFp.p.psl.o...cluahlsahlllhlslsSFthulshuppslsshssFMhAllPllhslluusG........uhsouuhhpPlllhhlphsuhllpp........lllPLlhhus...lLpllsslo.c..chplopLupLl+phshhhLGhhlTlFlGllolQGhsuussDulsh+oAKassusFlPVVGphhoDAs-oVluuolLlKNulGlsGlllllhlshhPhlKl.lslshlY+luAAllpP..l.u.cstls...ssLssluculhhlhus..lhs..Vu..l..MFFlslslllss.............
//
DBGET integrated database retrieval system