GenomeNet

Database: Pfam
Entry: Yopt
LinkDB: Yopt
Original site: Yopt 
#=GF ID   Yopt
#=GF AC   PF09467.12
#=GF DE   Hypothetical protein Yopt
#=GF AU   Coggill P;0000-0001-5731-1588
#=GF SE   pdb_2dlb
#=GF GA   25.50 25.50;
#=GF TC   25.50 170.70;
#=GF NC   24.80 25.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF DR   INTERPRO; IPR018572;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This hypothetical protein is expressed in bacteria, particularly
#=GF CC   Bacillus subtilis. It forms homo-dimers, with each monomer
#=GF CC   consisting of one alpha helix and three beta strands.
#=GF SQ   2
#=GS YOPT_BACSU/2-72    AC O34498.1
#=GS YOPT_BACSU/2-72    DR PDB; 2DLB A; 2002-2071;
#=GS YOPT_BACSU/2-72    DR PDB; 2DLB B; 4002-4071;
#=GS O64103_BPSPB/2-72  AC O64103.1
YOPT_BACSU/2-72               AGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDMEYEITNTEELPE
#=GR YOPT_BACSU/2-72    SS    -EEEEEEEEEEEEEEEEE-SSHHHHHHHHHHHHHTTTT-SEEEEE-TTS-EEEEEEEEEEEEEEEEEE--X
O64103_BPSPB/2-72             AGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDMEYEITNTEELPE
#=GC SS_cons                  -EEEEEEEEEEEEEEEEE-SSHHHHHHHHHHHHHTTTT-SEEEEE-TTS-EEEEEEEEEEEEEEEEEE--X
#=GC seq_cons                 AGYLNNIALNLEIVLKNKADSPEVSETLVTRICENLLLSKEVSFLKADGSVENFKLSDMEYEITNTEELPE
//
DBGET integrated database retrieval system