GenomeNet

Database: Pfam
Entry: YorP
LinkDB: YorP
Original site: YorP 
#=GF ID   YorP
#=GF AC   PF09629.13
#=GF DE   YorP protein
#=GF AU   Coggill P;0000-0001-5731-1588
#=GF SE   pdb_2heq
#=GF GA   25.00 25.00;
#=GF TC   42.60 42.40;
#=GF NC   20.40 19.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF DR   INTERPRO; IPR018591;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   YorP is a 71 residue protein found in bacteria. As it is also
#=GF CC   found in a bacteriophage it might be of viral origin. The
#=GF CC   structure is of an alpha helix between two of five beta strands.
#=GF CC   The function is unknown.
#=GF SQ   8
#=GS A0A7G9USA9_9CAUD/1-71  AC A0A7G9USA9.1
#=GS A0A7G5CIY5_9CAUD/1-71  AC A0A7G5CIY5.1
#=GS O64150_BPSPB/1-71      AC O64150.1
#=GS A0A7H0X9V4_9CAUD/1-71  AC A0A7H0X9V4.1
#=GS A0A7G5CHY1_9CAUD/8-78  AC A0A7G5CHY1.1
#=GS A0A268EBR2_9BACI/1-65  AC A0A268EBR2.1
#=GS YORP_BACSU/1-71        AC O31898.1
#=GS YORP_BACSU/1-71        DR PDB; 2HEQ A; 7-76;
#=GS A0A7G9URS4_9CAUD/1-71  AC A0A7G9URS4.1
A0A7G9USA9_9CAUD/1-71             MPKYWSYPVGLAIEINNNARYGCPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHELTPLKGGLTYV...
A0A7G5CIY5_9CAUD/1-71             MPKYWSYPVGLAIEINNNARYGCPHHVGRKGKIIEHLHSATYDYSVSDETGDITYFKEHELTPLKGGLTYV...
O64150_BPSPB/1-71                 MPKYWSYPVGLAVEINNNARYGCPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHELTPLKGGLAYV...
A0A7H0X9V4_9CAUD/1-71             MPKYWSYPVGLAIEINNNARYGCPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHELTPLKGGLTYV...
A0A7G5CHY1_9CAUD/8-78             LPKYWSYPVGLAVEINNNARYGCPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHELTPLKGGLTYV...
A0A268EBR2_9BACI/1-65             MPKYFTYDLKTRVIVNDHAIKGMPCSTGKEGIVIEHLNSWQYDYLVLHDDGTYGKYAEIELN---------mih
YORP_BACSU/1-71                   MPKYWSYPVGLAVEINNNARYGCPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHELTPLKGGLAYV...
#=GR YORP_BACSU/1-71        SS    X-SS--S-TT-EEEE-TT-TTTSTT--SSEEEEEEE---SS-SEEEEETTS-EEEE-GGGEEE-----SS-...
A0A7G9URS4_9CAUD/1-71             MPKYWSYPVGLAIEINNNARYGCPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHELTPLKGGLTYV...
#=GC SS_cons                      X-SS--S-TT-EEEE-TT-TTTSTT--SSEEEEEEE---SS-SEEEEETTS-EEEE-GGGEEE-----SS-...
#=GC seq_cons                     MPKYWSYPVGLAlEINNNARYGCPHHVGRKGKIIEHLHSATYDYAVSDETGDITYFKEHELTPLKGGLTYV...
//
DBGET integrated database retrieval system