KEGG   Plasmodium falciparum 3D7: PF3D7_0211200
Entry
PF3D7_0211200     CDS       T00095                                 

Definition
(RefSeq) ras-related protein Rab-5A
Organism
pfa  Plasmodium falciparum 3D7
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase Pribosyltran_N
Other DBs
NCBI-GeneID: 812700
NCBI-ProteinID: XP_001349618
PlasmoDB: PFB0500c
GeneDB: PFB0500c
UniProt: O96193
Structure
PDB: 
3CLV

Position
2:complement(455579..456286)
AA seq 235 aa
MEKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGASFCTYVVNLNDINIKNNSN
NEKNNNINSINDDNNVIITNQHNNYNENLCNIKFDIWDTAGQERYASIVPLYYRGATCAI
VVFDISNSNTLDRAKTWVNQLKISSNYIIILVANKIDKNKFQVDILEVQKYAQDNNLLFI
QTSAKTGTNIKNIFYMLAEEIYKNIINNNNTSKNKTVNKNLINLDNQTLSKKGCC
NT seq 708 nt   +upstreamnt  +downstreamnt
atggaaaagaaaagtagttataaaacagttttattaggagaatcatcagtaggaaaatca
agtatagttttacgattaacaaaagatacttttcatgagaatactaacacaacaataggt
gcatctttttgtacatatgtagtaaatttaaatgatataaatataaagaataatagtaat
aatgaaaaaaataataatataaattcaataaatgatgataataatgttattataacaaat
caacataataattataatgaaaacttatgtaatataaaatttgatatatgggatacagct
ggacaagaaagatatgcaagtattgtcccactatattatagaggtgctacttgtgctata
gtagtttttgatattagcaattcaaatactttagatcgagctaagacatgggttaatcaa
ttaaaaattagtagtaactatattattattttagttgctaataaaatagataaaaacaaa
ttccaagttgatatattagaagtacaaaaatatgctcaagacaataatttactttttatt
caaacaagtgccaaaactggaacaaacataaaaaatatattctacatgcttgctgaagaa
atttataaaaatattataaataataataatacctcaaaaaataaaacagttaataaaaac
ttaataaatctagataatcaaacactttcaaaaaaaggatgttgttaa

DBGET integrated database retrieval system