KEGG   Plasmodium falciparum 3D7: PF3D7_0218400Help
Entry
PF3D7_0218400     CDS       T00095                                 

Definition
(RefSeq) ATP-dependent RNA helicase DDX47, putative
  KO
K14777  ATP-dependent RNA helicase DDX47/RRP3 [EC:3.6.4.13]
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pfa03009]
    PF3D7_0218400
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     PF3D7_0218400
Ribosome biogenesis [BR:pfa03009]
 Eukaryotic Type
  90S particles
   Helicases
    PF3D7_0218400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C PIEZO
Motif
Other DBs
NCBI-GeneID: 812770
NCBI-ProteinID: XP_001349688
PlasmoDB: PFB0860c
GeneDB: PFB0860c
UniProt: O96264
Position
2:complement(750049..751737)
Genome map
AA seq 562 aa AA seqDB search
MKYKNYNTATILENFDKKLNKNYKVFNNEEIKKMDEEYEHKIKKKEQLKLQKKQIKKQEH
KNEKKKKNKNLNKKHNQNNTNNSDNSFHNSDNNINQNGNYTNNSDYNIINNNHDNINFIH
GNKNKNHDNSFHNNDDVKNGEVKNLVTNEEREKQNVTFEDLNICEEILESIKELGWKKPT
EIQREILPHAFLKKDIIGLSETGSGKTACFIIPILQDLKVNKQSFYALVISPTRELCIQI
SQNFQALGMNLLINICTIYGGVDIVTQSLNLAKKPNVIVSTPGRILDHLNNTKGFNLKNL
KYLVFDEADKLLSQDFESSINKLLLILPPNRITFLFSATMTKNVAKLKKACLKNPVKVEV
SNKYSTVSTLIETYIFLPLKYKYTYLSSLCFHYQTRNIIIFTNTCATAQKLNFFCRNLGL
KSICLHGKLTQNQRLSSLNSFKVNKYNILISTQVGARGLDLQDIKIVINFDICSCKEYIH
RVGRTARAGRSGKSITFVTQYDVENFLAIEKQLNKKIDKFTDLDENDVLLYHEQTIEALR
LSEIEMKENQELYKKNKFKKKK
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaaaattataacacggccacaatactagaaaactttgataagaaattaaat
aagaattataaagtttttaataatgaggaaattaaaaaaatggatgaggagtatgagcat
aagattaagaagaaggagcaattaaaattacaaaagaaacaaataaaaaaacaggaacat
aaaaatgaaaagaaaaaaaaaaataaaaatctaaataaaaaacacaatcaaaataatact
aataatagtgataatagtttccataatagtgataacaatattaatcaaaatggtaattat
acaaataatagtgattataatatcattaataataatcatgataatattaattttattcat
ggtaataaaaataaaaaccatgataatagttttcacaataatgatgacgtaaaaaatggt
gaagttaagaatcttgttactaatgaggaaagggaaaaacaaaatgttacttttgaagac
ctaaatatatgtgaagaaatattagaaagtataaaagaattaggatggaaaaaaccaaca
gaaatacaaagagaaatattacctcatgcatttctaaaaaaagatattataggattaagt
gaaacgggaagtgggaaaactgcttgttttattatacccatattacaagatttaaaagtg
aataaacaaagtttctatgctttagttatatcaccgacaagagaattatgtatacagatt
tcacaaaactttcaagcattaggtatgaatttattaataaatatttgtacaatatatggt
ggtgtagatattgtaacacaatccttaaatctagccaaaaaaccgaatgtaattgtgagc
acacctggtagaatactagatcatttaaataatacaaaaggattcaacctaaaaaattta
aaatatttagtttttgatgaagctgataaattattatctcaagattttgaatcatccata
aataaattattattaatattaccaccgaatcgtattacatttttattttcagcaaccatg
acaaaaaatgttgccaaattaaaaaaagcttgtcttaaaaatccggttaaagtagaggtc
tcaaataaatatagtactgtctccacattaatagaaacatatatttttcttcctcttaaa
tataaatatacttatctttctagtttatgttttcattaccaaacaagaaatattattata
tttacaaatacttgtgcaaccgctcaaaaattaaactttttttgtagaaatctaggacta
aaatccatatgcctacatggtaaattaacacaaaatcaaagattaagtagccttaattcc
ttcaaagttaataaatataatatattaatctcaacacaagtgggagccagaggactggat
ctacaagatattaaaattgttataaattttgatatttgctcatgtaaagaatatatacat
agagtcggaagaacagcaagggcagggagatctgggaaatccataacctttgttacacaa
tatgatgtggaaaatttcttagcaatagaaaaacagttgaataaaaaaattgataaattt
acagaccttgatgaaaacgatgttcttttataccatgagcaaactattgaggcactcagg
ttatcagaaatagagatgaaggaaaaccaggaattatacaaaaaaaataaatttaaaaaa
aaaaaatga

DBGET integrated database retrieval system