KEGG   Plasmodium falciparum 3D7: PF3D7_0418700
Entry
PF3D7_0418700     CDS       T00095                                 

Definition
(RefSeq) RNA-binding protein NOB1, putative
  KO
K11883  RNA-binding protein NOB1
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    PF3D7_0418700
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pfa03009]
    PF3D7_0418700
   03051 Proteasome [BR:pfa03051]
    PF3D7_0418700
Ribosome biogenesis [BR:pfa03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    PF3D7_0418700
Proteasome [BR:pfa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    PF3D7_0418700
SSDB
Motif
Pfam: PIN_6 NOB1_Zn_bind
Other DBs
NCBI-GeneID: 812504
NCBI-ProteinID: XP_001351495
PlasmoDB: PFD0905w
GeneDB: PFD0905w
UniProt: Q8I1Q0
Position
4:841196..842905
AA seq 569 aa
MEEKKKYVLDSNSLIKFKDFLFYKYECYITEGVIKEIKDENSKKKLMNILPLLKIEKPEE
IDINFIRYFSKLTGDLNSLSSVDIEVIALTYMLHRKYGDVTKLRATPLETIYKYDDVKYE
YMNVNKNDKKEKKKKKKKQKKINEIHFNDHHKEKETDDEKGTHEENEKENIKREDDHNTI
QIGEGELLKQEKLQVSNDDNMDDDNNHYDKKEIIYLEHDKHSQGDDNSLGKNYKLSHIDD
DISDKSNSLSYNNTDLSDDNISDFLASDDEYEELKKGKNKFIGCQTIKEEVVKVLSNGDN
NEDNDEDNDVDNDEDNDVDINDDNSDDNNDNNSDDNSDDNSDDNSDDNSDDNNDEGGDWI
NLNNFDKINLNINKDETFKETVACITTDYAMQNVLYQIGLNVITIDGYKINSIKLWGYFC
TSCYFFMRTNNLLFCSKCGNNNLRKVNVHVDNDSKKLIVKIPHIRVNIKNTIFSIPKKKY
HNNNKNKFEDKLQIFREDELLIGGRKQFISHQKKLYESQKNINDPFNDDNFYDTSNCFIR
TKLKSGKVAVLKNPKILVGGKKNVHRRKK
NT seq 1710 nt   +upstreamnt  +downstreamnt
atggaagagaaaaagaaatatgtattagattcgaacagcttaattaaatttaaagatttt
ttattttacaaatatgagtgttatataactgaaggggtaataaaagaaataaaagatgag
aattccaaaaagaaattaatgaatattcttcctcttttaaaaatcgaaaaacctgaagaa
atagatataaattttataagatatttttcaaagttaacaggggatttgaattcattaagt
tctgtagatatagaagttatagcattaacatatatgcttcataggaaatatggagatgtc
acaaaattaagagcaacacctttagaaacgatttataaatatgatgacgttaaatatgaa
tatatgaatgttaataaaaatgataagaaagaaaaaaagaagaaaaagaagaaacagaag
aaaataaatgaaatccattttaatgaccatcataaagaaaaagaaacagatgatgaaaaa
ggaacacatgaagaaaatgagaaggaaaatattaaaagagaagatgatcataatacaata
caaattggggaaggtgaattattaaaacaagaaaaattacaagtaagtaatgatgacaac
atggatgatgataataatcattatgataaaaaggaaattatttacttagaacatgataaa
cattcacaaggagatgataactccttaggtaaaaattataagctttcccatatagatgat
gacatatcggataaaagcaatagtctttcttataataatacggacctatcggatgataac
attagcgattttttagcaagtgacgacgaatatgaagaattgaagaaaggaaagaataaa
tttattggttgccaaacgataaaagaagaagtggtaaaggtattgtcgaatggtgataat
aatgaagataatgatgaagataatgatgtagataatgatgaagataatgatgtagatatt
aatgatgataatagtgatgataataatgataataatagtgatgataatagtgatgataat
agtgatgataatagtgatgataatagtgatgataataatgatgagggtggtgattggata
aaccttaacaactttgataaaataaatttaaatattaataaagatgaaacttttaaagag
acagttgcttgtataactacagattatgctatgcaaaatgtgttgtatcaaatcggatta
aatgtaataactatagatggttataaaataaattcaataaaattatggggttatttttgc
acgtcttgttatttttttatgagaacaaataatttattattttgttcgaaatgtggaaat
aataatctaagaaaggttaatgttcatgttgataatgattcaaaaaagttaattgttaaa
atcccacatataagagttaatataaaaaatacaatttttagtatacccaaaaaaaaatat
cataacaataataaaaataaatttgaagataaattacaaatttttagagaagatgaattg
ttaataggaggaaggaaacaatttatatctcatcaaaaaaaattatatgaatcacaaaaa
aatattaacgatccttttaatgatgataatttttatgatacatccaattgttttattaga
accaaattgaaaagtggaaaagtcgctgtcttgaaaaatccaaaaattcttgttggggga
aaaaaaaatgtccacagaaggaagaaatga

DBGET integrated database retrieval system