KEGG   Plasmodium falciparum 3D7: PF3D7_0507100
Entry
PF3D7_0507100     CDS       T00095                                 

Definition
(RefSeq) 60S ribosomal protein L4
  KO
K02930  large subunit ribosomal protein L4e
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PF3D7_0507100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pfa03011]
    PF3D7_0507100
Ribosome [BR:pfa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    PF3D7_0507100
  Archaea
    PF3D7_0507100
SSDB
Motif
Pfam: Ribosomal_L4 Ribos_L4_asso_C RB_A
Other DBs
NCBI-GeneID: 812881
NCBI-ProteinID: XP_001351629
PlasmoDB: PFE0350c
GeneDB: PFE0350c
UniProt: Q8I431
Position
5:complement(294668..295903)
AA seq 411 aa
MATIRPVANVYSTNGKNVVGEVEIPVVFQTPIRNDLIQSVYTNMSKNRRHPYAVKLGAGY
ETSAESWGTGRAVARIPRVPGGGTHRAGQGAFGNMCRGGGMFNPTKIWRRWGRKVNLKEK
RYAVCSSIAASGVTSLVLARGHRISHLKEVPLVVSNDIESLSKTKEAVNFLVSLGLKDEV
NRLVKSKKIRAGKGKMRNRKYKIRNGPLIIYENDNGVKKAFRNIPGVDLCKVTKLNLLKL
APGGSIGRLCIWSESAFKKLDVIYGKIHEKKVTKKNYILPKSIVHNPDIYRIIHSDKVQA
SLLAKKKPCKKRLQNKNSLTNFAVRCRLNPAYKLLRSLAVLRMRKSILEKSKNKKEKRVQ
KQIQKKELQKINHDYYKGVAKAVKKKKKREEKKAKSKKTANQAVINVAAEE
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggctaccataagacctgttgcaaatgtttatagtacaaatggaaagaacgtcgttggc
gaagtagaaataccagtcgtttttcaaaccccaattagaaatgacttaatacaaagcgta
tatacaaatatgtcaaaaaataggaggcatccatatgctgttaaattaggtgctggatat
gaaacatcggctgaatcatggggtactggtagagcagtagcaagaattccaagagttcca
ggtggaggtactcatagagctggtcaaggtgcttttggaaatatgtgtagaggtggtggt
atgtttaacccaacaaaaatatggagaagatggggaaggaaagttaatttgaaagaaaag
agatatgccgtatgttcatctattgcagctagtggtgtaacatcattagttttggcaaga
ggtcatcgtatatcccaccttaaggaagttccattagttgttagcaatgatattgaatct
ctttctaaaactaaagaagctgtgaactttttagttagtcttggtttaaaagatgaagtt
aatagattagtaaaatcgaaaaaaattagagcaggaaaaggtaaaatgagaaacagaaaa
tataaaattagaaatggtcctcttattatttatgaaaacgataatggtgtaaagaaagct
tttagaaatattcctggagttgatttatgtaaagttaccaaattaaatttattaaaatta
gctcctggtggatctataggtagattgtgtatatggagtgaaagtgcttttaaaaaatta
gatgttatatatggaaagatacatgagaaaaaagtcactaagaaaaattatattttacca
aaatctattgtgcacaatcctgacatctatagaattatacacagcgacaaagtacaagca
agcttattagccaaaaagaaaccatgcaaaaagagattacaaaacaaaaactcattaacc
aactttgctgtaagatgtagacttaacccagcctacaaattattaagatcattggctgtt
cttaggatgagaaagagtatccttgaaaaatcaaaaaataaaaaggaaaagagagttcag
aaacaaatccaaaagaaagaactccaaaaaattaaccatgactactataagggtgtagct
aaggcagttaagaaaaagaaaaagagagaagagaaaaaggctaaatctaagaaaactgct
aaccaagctgttataaatgttgcagcagaagaataa

DBGET integrated database retrieval system