KEGG   Plasmodium falciparum 3D7: PF3D7_0512600Help
Entry
PF3D7_0512600     CDS       T00095                                 

Definition
(RefSeq) ras-related protein Rab-1B
  KO
K07874  Ras-related protein Rab-1A
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pfa04131]
    PF3D7_0512600
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfa04147]
    PF3D7_0512600
   04031 GTP-binding proteins [BR:pfa04031]
    PF3D7_0512600
Membrane trafficking [BR:pfa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    PF3D7_0512600
 Autophagy
  Other autophagy associated proteins
    PF3D7_0512600
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PF3D7_0512600
  Exosomal proteins of other body fluids (saliva and urine)
   PF3D7_0512600
  Exosomal proteins of colorectal cancer cells
   PF3D7_0512600
GTP-binding proteins [BR:pfa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab1/35 [OT]
    PF3D7_0512600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA RsgA_GTPase MMR_HSR1 SRPRB GTP_EFTU AAA_22 Sharpin_PH ABC_tran AAA_16 AAA_29 AAA_5 NACHT
Motif
Other DBs
NCBI-GeneID: 812940
NCBI-ProteinID: XP_001351683
PlasmoDB: PFE0625w
GeneDB: PFE0625w
UniProt: Q7K6A8 Q9BHN1
Position
5:join(544540..544553,544791..544863,545126..545221,545312..545375,545507..545582,545714..545993)
Genome map
AA seq 200 aa AA seqDB search
MNDSYDSLFKILLIGDSGVGKSCLLLRFADDTYTDSYISTIGVDFKIKTIEIEDKIIKLQ
IWDTAGQERFRTITSSYYRGAQGIIIVYDVTDRDSFNNVKNWIIEIEKYASEDVQKILIG
NKIDLKNDRNVSYEEGKELADSCNIQFLETSAKIAHNVEQAFKTMAYEIKNKSQHETINK
GKTNINLNARPIKDTKKKCC
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatagctatgatagtttatttaaaatattgttaattggagatagtggtgttgga
aaatcatgtttgctccttcgttttgccgatgatacgtatacagacagttatataagtacc
ataggagtagactttaaaataaaaacaatagaaatagaagataaaataataaaattacaa
atatgggatacggctgggcaagaaaggttccgaacaataacatcctcatattatagagga
gcccaaggtataattattgtatatgacgtaacggatagggacagctttaataacgttaag
aattggattatagaaattgaaaaatatgcttctgaagatgtacagaagatattgatagga
aataagatcgatttaaagaatgataggaatgtaagttatgaggaggggaaagaattagct
gacagttgtaatattcaatttttagaaacatcagcaaaaattgctcacaatgttgaacaa
gcatttaaaacgatggcatatgaaataaaaaataaatcacaacatgaaactattaataaa
ggaaaaacaaatattaatttgaatgcaagaccaattaaggataccaaaaagaaatgttgt
tga

DBGET integrated database retrieval system