KEGG   Plasmodium falciparum 3D7: PF3D7_0523100Help
Entry
PF3D7_0523100     CDS       T00095                                 

Definition
(RefSeq) mitochondrial processing peptidase alpha subunit, putative
  KO
K01412  mitochondrial-processing peptidase subunit alpha [EC:3.4.24.64]
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pfa01002]
    PF3D7_0523100
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pfa03029]
    PF3D7_0523100
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.64  mitochondrial processing peptidase
     PF3D7_0523100
Peptidases and inhibitors [BR:pfa01002]
 Metallo peptidases
  Family M16: pitrilysin family
   PF3D7_0523100
Mitochondrial biogenesis [BR:pfa03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    PF3D7_0523100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M16_C Peptidase_M16
Motif
Other DBs
NCBI-GeneID: 813046
NCBI-ProteinID: XP_001351788
PlasmoDB: PFE1155c
GeneDB: PFE1155c
UniProt: Q8I3N3
Position
5:complement(join(963227..964458,964672..965044))
Genome map
AA seq 534 aa AA seqDB search
MKKNIQCLNIFYKTKWRNIHNSSIVRSKENLNLQKIYTGEKQNFNKVSFKKEKIEDVIKE
VKFDYYYFNEGKKNKYKDIPLNISIINESDFPPFKAVDEKLHFSVLENDLKIISTNRNNS
VCSIGLYVKCGSRYEEINDKVNEQGMSVMLENMAFHSTAHLSHLRTIKSLEKIGATVSCN
AFREHMVYSCECLKEYLPIVTNLIIGNVLFPRFLSWEMKNNVNRLNLMREKLFENNELYI
TELLHNTAWYNNTLGNKLYVYESSIENYTSENLRNFMLKHFSPKNMTLIGVNVEHDELTK
WTSRAFQDYVPIPYTNQKEVTPKYTGGFISVEDKNVKKTNIAIAYETQGGWKSSDMITLT
VLQTLMGGGGSFSTGGPGKGMYSRLFLNVLNSYNFIESCMAFSTQHSDTGLFGLYFTGEP
SNTSDIIKAMALEFQKMNRVTDEELNRAKKSLKSFMWMSLEYKSILMEDLARQMMILNRI
LTGKQLSDAIDSITKEDIQRVVHNFLKTKPTVVVYGNINYSPHYDEICNILGHK
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaatatacaatgcttgaatattttttataaaaccaaatggagaaatatacac
aacagtagtattgtgaggtcaaaagaaaatttgaaccttcaaaaaatatatacaggagaa
aaacaaaattttaacaaagtatcctttaaaaaagagaaaatagaagatgtcattaaagaa
gtgaagtttgattactattattttaatgaaggaaaaaaaaataaatacaaagatatccca
ttaaatatatccataattaatgaatcggactttccgccatttaaggcagttgatgaaaaa
ctgcatttctcagtattagaaaatgatttgaaaattatatcaaccaatagaaacaatagt
gtgtgttcgataggtttatatgtaaagtgcggatccagatacgaagaaataaacgacaaa
gtaaatgaacaaggtatgagcgtaatgcttgaaaatatggcttttcatagtacggcacat
ttatctcatttaagaaccataaaatcactcgaaaaaataggagctactgttagttgtaat
gcatttcgtgaacatatggtttatagttgtgaatgcttaaaagaatatttacctattgtt
actaatttaataataggtaatgttttatttccaagatttttatcatgggaaatgaaaaat
aatgtaaaccgtttaaatttaatgcgtgagaaattatttgaaaataatgaattatatata
accgaattattacataatactgcatggtataataataccttaggtaataaattatatgta
tatgaatccagtattgaaaattatacatcagaaaatttaaggaattttatgttgaaacat
ttctcaccaaaaaatatgacattgataggtgtcaatgtagaacatgatgaactaaccaaa
tggacttctagagcttttcaagattatgttcctataccttatactaatcaaaaagaagta
actccaaaatatacaggtggatttattagtgtagaagataaaaatgtgaagaaaactaat
attgccatcgcttatgaaacacaagggggttggaaaagttctgatatgatcaccttaaca
gtattacaaacattaatgggtggtggtggctccttttccactggtggacctggaaagggt
atgtattcaagattattcttaaatgttttaaatagctataattttattgaatcatgtatg
gcctttagtactcagcattcagatactggtctttttggattatactttacgggagaacca
tcgaatacctctgatataataaaagctatggcattagaatttcaaaaaatgaatagagtt
actgatgaagaacttaatagagcaaagaaaagcttaaaaagctttatgtggatgagttta
gaatataaatcaatattaatggaagatttagctagacaaatgatgattttaaatagaata
ttaacaggaaaacaattatcagacgctatcgattctataacaaaggaagatattcaaagg
gttgttcataatttcttgaaaacaaaaccaactgttgttgtttatggaaatataaattat
tcacctcattatgatgaaatatgtaacatattaggacacaaataa

DBGET integrated database retrieval system