KEGG   Plasmodium falciparum 3D7: PF3D7_0531000
Entry
PF3D7_0531000     CDS       T00095                                 

Definition
(RefSeq) SURF1 domain-containing protein, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB
Motif
Pfam: SURF1
Other DBs
NCBI-GeneID: 813122
NCBI-ProteinID: XP_001351864
PlasmoDB: PFE1550w
GeneDB: PFE1550w
UniProt: Q8I3F8
Position
5:1267410..1269539
AA seq 709 aa
MPLFKYDLKAKEIIFMLNKINFFSTVHFCKIDVKCIPSSFTNNYNINKSTYMNRKFIVGD
KNVGRINSNMRLRKLKDKNMVIFWKKENGNNIKKKKKKSGKKLFASGFKKSVILNKFHID
LLNEELKNVENEINNKYLTSNEEKEIILRKSKYASQKFYKANEEEIKIIRKSEGQYYLPI
ECENSTIIRIVNINDKVTSPIFRCVRNSKFGLRKKERTFFFYYSTFICSFFFTMGIWQYK
KMKKKKFLINYISNNLNDEIINLNGTNFPWVNDYKTLKDEYTQLSRNLLKYENKLVSGYN
ILRNIYVNVLSNYENWIPYFNLIGMYKNYIETSDSVSRMNFKGMENICVDTDDYLSKNRN
NLYDNIKRKEKEEYKNSIEYVTVDLNNIDNIYEWLLKIRNENIVMKLYRKFFKRNEIITN
DELKKLVIEKYKYRKVEITGVLDTTNEVYVGPKIYEKDSKQKYFYVICPLFLKNGNCILV
NRGLVSNDILEEKINEIPKIVTIRAVLDPGELYECSFKKIKNFSNKSSKKESYFYYYNIE
EICNHTNISKFEGTSYFIANVYDIIFHEDYLSDIQKYNNNNNVGEESNSPDKTNYIDLDN
VNINNIDINQVDRETQERIKRLTKAKSNVIQKDKNYVNNLDDVYLSDIPYKSRPFRYDEH
FIHKKKKDYVKFYADESTHFNYACQWFLFSFIFSTISIFKFVQFKRWVF
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgcccttatttaagtatgatcttaaggcaaaggaaataatttttatgttgaataaaatt
aattttttttcaaccgtccatttttgtaaaattgatgtaaaatgtatcccctcatctttc
acaaataattataacataaataaaagcacatatatgaatagaaaatttatagtcggtgat
aaaaatgtaggacgtataaatagtaatatgagattgagaaaattaaaagataagaacatg
gtaatcttttggaagaaagaaaacggtaacaatataaaaaaaaaaaaaaaaaaaagtgga
aaaaagttatttgcaagtggttttaagaaaagtgttattttaaataaatttcatatcgat
ttattaaatgaagaattaaaaaatgtagagaatgaaataaataataagtatttaacttct
aatgaggaaaaagaaattattttaagaaaatctaaatatgcaagtcagaaattttataaa
gctaatgaagaagaaataaaaataattagaaaaagtgaaggacaatattatttacccatt
gaatgtgaaaatagtaccataattcgtattgttaatataaatgataaagtaacatcacct
atttttagatgtgtgcgtaatagtaaatttggtttaagaaaaaaggaaagaacttttttt
ttttattattctacatttatttgttcttttttttttactatgggtatatggcaatataag
aagatgaaaaaaaaaaaatttctaattaattacatttcaaataatttaaatgatgaaata
ataaatttaaatggtacaaattttccatgggtgaatgattataaaacattgaaagatgag
tatacacaattaagtagaaatttgttaaaatatgaaaacaaattagtaagtgggtataat
atattaagaaatatatatgttaatgtattatcgaattatgaaaattggataccttatttt
aaccttataggtatgtataaaaattatattgaaacgagtgattcagtaagtcgaatgaat
tttaagggaatggaaaatatatgtgttgatacagatgattatttgagtaaaaatagaaat
aatttatatgacaatataaaaagaaaggagaaagaagaatataaaaatagtattgaatat
gttacggtagatttgaataatattgataatatatatgaatggttacttaaaataagaaat
gaaaatattgtaatgaaattatatagaaaattttttaaaagaaatgagattataacaaat
gatgaattaaaaaaacttgttattgagaaatacaaatatcgtaaggtcgaaataacaggt
gtattggatacaacaaatgaagtgtatgtaggtccaaaaatatatgaaaaggatagtaag
caaaaatatttttatgttatatgtccattatttttaaaaaacggtaattgtatattagtt
aatagaggattagtatcaaatgatatattagaagagaaaattaatgaaattcctaaaatt
gtgacaataagagcagtattagatccaggagaattatatgaatgttcttttaaaaaaata
aaaaatttctctaataaaagtagcaaaaaggagtcctatttttattattataatattgaa
gaaatttgtaatcatactaatatatcaaaatttgagggaacaagctattttattgcgaat
gtgtatgacattatatttcatgaagattatcttagtgatatacaaaagtacaataataat
aataatgtgggtgaagaaagtaatagcccagacaaaactaattatattgatttagataat
gttaatataaataacattgatataaaccaagttgatagagaaacacaagaaaggataaaa
cgcttaacaaaagcgaaaagtaatgtaatacaaaaagataagaattatgttaataactta
gatgatgtatatttatcagatattccatataaaagcagaccttttagatatgatgaacat
ttcatacataaaaagaaaaaggattatgttaaattttatgcggacgaatctacgcatttt
aattatgcatgtcagtggtttcttttttcattcattttttcaaccatatctatatttaaa
tttgtacaattcaaaaggtgggttttttaa

DBGET integrated database retrieval system