KEGG   Plasmodium falciparum 3D7: PF3D7_0602500
Entry
PF3D7_0602500     CDS       T00095                                 

Definition
(RefSeq) geranylgeranyl transferase type-2 subunit beta, putative
  KO
K05956  geranylgeranyl transferase type-2 subunit beta [EC:2.5.1.60]
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:pfa01006]
    PF3D7_0602500
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pfa04131]
    PF3D7_0602500
Enzymes [BR:pfa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.60  protein geranylgeranyltransferase type II
     PF3D7_0602500
Prenyltransferases [BR:pfa01006]
 Protein prenylation
  Rab geranylgeranyltransferase
   PF3D7_0602500
Membrane trafficking [BR:pfa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    PF3D7_0602500
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
    PF3D7_0602500
SSDB
Motif
Pfam: Prenyltrans SQHop_cyclase_N
Other DBs
NCBI-GeneID: 3885742
NCBI-ProteinID: XP_966015
PlasmoDB: PFF0120w
GeneDB: PFF0120w
UniProt: C6KSM5
Position
6:105503..106642
AA seq 379 aa
MSEDIEFVQEKHIQYLESYTTIKNAEELIFNETLKMCGVFYFLCSCKILSHTIEKKEEFI
NFILKCQNVDGGFGNNINYDSHIVSTHHAILSLLLLNYSFDKINEYMDKANNHHDINNTN
DNNKVDLNNTNNNNKLDFNNTNDNNYNVYSKSIRENTCKYILTLFNEDGSFKGDMWGEVD
TRFVYSAVSCLTILNKINLVCVDKISSYLLTNYAICENGFSWVSGNEPHAASVFCCIATL
FLIQKLYLINENKLAHWLSLRQTTNGGFNGRAEKLTDTCYSWWIFSTLIVLKKYNWINKN
ALKNYILLCQDIEKGGISDNPDCLPDICHTFFGLAALSLIDNLNESEKKYTLQQMHPVYA
IPVHTVKMRNLPYHDIDII
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgagtgaggatatcgaatttgtgcaagagaaacatatccaatatttggaatcttataca
acaataaaaaatgcagaagaactaatatttaatgaaactctaaaaatgtgtggagttttt
tatttcctttgttcatgtaaaattttatcacatacaatagagaaaaaagaagagttcata
aattttattttaaaatgtcaaaatgttgatggtggttttggaaataatataaattatgat
tcgcatattgtttctacacaccatgctatattatcattacttttattgaattattctttt
gacaagattaatgaatatatggataaagcaaataatcaccatgacataaataatacaaat
gataataataaagttgatttaaataatacaaataataataataaacttgattttaataat
acaaatgataataattataatgtatattctaaaagtatacgagaaaatacatgcaagtat
atactaaccttgtttaatgaagatggttcctttaaaggagatatgtggggagaagttgat
acaagatttgtttatagtgcagttagttgtctaaccatattaaacaaaattaatttagtt
tgtgtagataaaatctcatcatatttattaacgaattatgctatatgtgaaaatggcttt
tcatgggtaagtggaaatgagccacatgcagctagtgttttttgttgtattgcgacatta
tttttaatacaaaaattatatttaattaatgaaaataaattagctcattggttaagtctt
agacaaactactaatggaggttttaatggaagagctgaaaaattaacagacacttgctac
tcttggtggattttctctacacttattgttttaaaaaaatataattggattaataaaaat
gctttaaaaaattatattcttctttgtcaagatattgaaaaaggtggtataagtgataac
cctgattgccttccagacatttgccataccttttttggattagccgctttaagtttgata
gataatctcaacgagtccgaaaaaaaatataccctgcaacaaatgcacccggtatatgca
attcctgttcatacggttaagatgaggaatttgccttatcacgacatagacataatttaa

DBGET integrated database retrieval system