KEGG   Plasmodium falciparum 3D7: PF3D7_0605800
Entry
PF3D7_0605800     CDS       T00095                                 

Definition
(RefSeq) DNA repair protein RAD50, putative
  KO
K10866  DNA repair protein RAD50 [EC:3.6.-.-]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa03440  Homologous recombination
pfa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    PF3D7_0605800
   03450 Non-homologous end-joining
    PF3D7_0605800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pfa03032]
    PF3D7_0605800
   03400 DNA repair and recombination proteins [BR:pfa03400]
    PF3D7_0605800
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.-  Acting on acid anhydrides
    3.6.-.-  
     PF3D7_0605800
DNA replication proteins [BR:pfa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     PF3D7_0605800
DNA repair and recombination proteins [BR:pfa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     PF3D7_0605800
    BRCA1-C complex
     PF3D7_0605800
   NHEJ (non-homologous end-joining)
    MRX complex
     PF3D7_0605800
SSDB
Motif
Pfam: AAA_23 SMC_N AAA_21 SbcCD_C AAA_29 DUF948 AAA_16
Other DBs
NCBI-GeneID: 3885706
NCBI-ProteinID: XP_966048
PlasmoDB: PFF0285c
GeneDB: PFF0285c
UniProt: C6KSQ6
Position
6:complement(237811..244521)
AA seq 2236 aa
MTTLEKIGIQGIRSYNDEDVEILEFATPITIIYGNNGSGKSTIIECLKVSCTGDFPPNAE
KGKSFLHDPLISNKMNIRGKIDVLLNNYNNKRIGISRSYNLFYSKDKNKKVKHTFRALDN
NIIIKKEKGDDLIITNKCVDINNHIPKLMGVSKALLENVIFCHHDENLWPFSESIKIKKK
FDELFGDDHFSKILEELLKCKKYLNDLLKRKEFDLIHIKENFEKKKNIYIEIEKNEKEIQ
SAQICIQLDVEEIEENTIILNNLIKKKNLLYKLIGNIDSYFLLYTKFKVDAEAYKDLKEV
YEENYTELLYFQEVFNNDINKCEICIQKVKQDIQNLQHEKDTCMFNYNESNKYDDNYELS
KKQLNEYIIKRDDIRNKLKDIFFYNDQIFFSNYKGNSSSDMIKHSSINEGHQKEKLKKKF
KKHDSVYIKDHLLKEYENLLHMYDIHKEDIALYNHDVMLSYKNEEHIPSNARLMEELFLI
CQNKVQYKTSNKSDDNKRNNNNNHFDDDNKRNNNNNHFDDDNKRNNNNNHFDDDNKRNNN
NNHFDDDNKRNNNNNHFDDDNKRNNNNNHFDDDNKNKCDDKKFIEIPNVSNILSNVPYLK
KKHEKKINSIRYILKRHISHIKRNKYKKRNVIYKIKNYKKRLLKIEKNITLLDIYKNKLN
KLKSNEIIYEQNLKKIEKLNQLKCLYDNLTTLDNEMDTYNIQKENNYYEEQIEKNMKQIN
DIQKLKIWIHTFCNIIRNYNIFYEFIQRCKKIHEHCVIFFDILFSLLDVIKTDFYKIVDM
LKERDMDLYYYIERGMQKKINVERNVCVERNVCVERNVCVENNICVEKNICVEKNICGEK
NICGEKKKITKLKSNIEIEESVEKIKDNKINECDVNVDTLNKTNSIHHVNNIKINSKSLV
CMNEHLQRKRENEKLNDYTCKLKKQKTHLDISILKNRKYLDILLNIINIFIDKYENKINN
IKTLIIPLNQKVLEISKKLNNMNNNINEYKNYLSNFIHMLKEKKYKDVKDFVNYVEAIDN
QIKIKKKNLWMLNGKEDLMNEFKNHLKSDEQNNSDNNKKVGVEKKKKKNCLFCKNTISQN
NKDIVQIEMYIEEQKRDMLKKIEESEKDINILKNKKEENIILLNYYYYHIKHIHTYTNDS
NEMIVKLKEELLSAQDSIEKYNIKIKNIHRKFQLVQKFKETCVYLINIQKDILDVEKYIK
DESIKIKGNFQEMKNKIKDNVENNKMSNNTNKCNDTKTCNNTKTCNNTYTCDHLFIEKLY
HMIENLDISIEVKESNLLKNIKEFVKKFAKYNNKDIINIFYNKICTSNVNDSYSYIPYND
IINVDLYQQYNYQNNYKNRFKYNLYKINNANYICKLLSPHQKVSLKDCYSSDQTPQKIYV
DEEKEKEKEKKKKKKKKTDNDGYYDEIFHCDNMEYDEQFYEDDDHHSYNKSKSLIENYIT
PCKNKEESVKEPNMCSIKHIYDNGSSNDDILNNDKTVLLNKINSSYLSFVLNIGTSYYSN
EEIKENNKNDTNKMCDDTNKMCDDTNKMYDDTNKMYDDTNKMYDDTNKMYDDTNKMCDDT
NKRYDDTNKMCHDTNKMCDDTNQMYDDTNKRYDDTNKRYDDTNKMCDDTNQMYDDTNKRY
DNINQNTYGTFLKCSDFLHNLPSIILNNKHFEKMYRNFLSYLNVEEYTRKEQNKMIEKMK
VVIKDRRAYVIKKSKVLEKTINIDKRIRDLIKKMDIYILYYKEKKKKIIDEKINVKNLLI
EQRDTQLKYIKRCIRNNKKSIFLEKRNYYLKMNMIYILIKKLKHTEEEIVNKEKYLKDVK
EKLNNNEIIKNQVICIDKKINEKKEHILCLEKEKINIEKMLHNIIMNTNMKKMYEQFLEH
HQTFILSLNQLKASFFLYERKNIKNSNMCKLEYKDEINGDKKKENDNTVSSNNDSIINND
NRNKKNRYNDEENGINYINDIVKKLEENYNNNTNIYNFINKTFDITDCLKNRLKDIIKIE
EDDLNEQIEKYTKSITALKIKEAEMNGKICLRKEYLEKLKEDIKSETLINIDKEYKKKII
EIFVYKNLIKDLQNFHFSFDQAIIKFHSLKMQEINLSIKNLWRRVYNSADIDYIYIKSDI
QTEPTDKSSQRRSYNYRVVMVKDNCELDMKGRCSSGQKVLSSIIIRLALAESFSIKCGIL
ALDEPTTNLDKANSRNLASLLANIVELRKSSSSFQLILITHDNYFVDILSQYGLTNCFYK
IKKNNLGYSKIERVNT
NT seq 6711 nt   +upstreamnt  +downstreamnt
atgactacgcttgaaaagattggaatccaaggtattcgaagttataatgatgaagatgtg
gagattctcgagtttgcaactcccattacgataatatatggaaataatggtagtggtaaa
tccacaataattgaatgtcttaaggtgagttgtacaggtgactttcccccgaacgccgag
aaagggaaatcttttttacatgaccctttaatatctaataagatgaatataagagggaag
atcgatgtacttttaaataattataataataagcgtattggtatatctcgttcatataat
ttattttattcaaaagataaaaataagaaagtgaaacatacgtttagagctttagataat
aatataattattaaaaaagagaaaggtgatgatttaattattacaaataaatgtgttgat
attaataatcatattcctaaattaatgggagtatctaaagctttattagaaaatgtaatt
ttttgtcatcatgatgagaatctgtggccttttagtgaatccataaaaataaaaaagaaa
ttcgatgaattatttggagatgatcatttttccaaaatattagaagaattattaaaatgt
aagaaatatttgaatgatttattaaaaagaaaggaatttgatttaatacatataaaagaa
aactttgagaaaaaaaaaaatatatatatcgaaatagaaaaaaatgaaaaggaaatacaa
agtgctcaaatatgtatacaattagatgtggaagagatagaagaaaatacaattatttta
aataatttaataaaaaaaaaaaatcttttatataaattaataggaaatatagattcttat
tttttattatataccaaatttaaagtagatgcagaagcatataaagacctgaaagaagta
tatgaagaaaactatacagaattattatatttccaagaggtttttaataatgatattaat
aaatgtgaaatatgtatacagaaggtaaaacaagatatacagaatttacagcatgaaaaa
gatacatgtatgtttaattataatgaatccaacaaatatgatgataattatgagctttcc
aaaaaacagctcaatgaatatataatcaaaagagatgatataagaaataagttaaaggat
atttttttttataatgatcaaatttttttttctaattataagggtaactcatcatccgat
atgataaaacatagttcgataaatgaaggacaccaaaaggaaaagttaaaaaagaaattt
aaaaaacatgacagcgtatatattaaagaccatttattaaaagaatatgagaacttatta
catatgtatgatatacataaggaagacatagcattgtataatcatgatgttatgttatct
tataagaatgaggagcacattccttcaaatgcaaggttaatggaagaattatttttaata
tgccaaaataaggttcaatataaaacctctaataaaagtgatgataataaaaggaataac
aacaacaaccattttgatgacgataataaaaggaataacaacaacaaccattttgatgat
gataataaaaggaataacaacaacaaccattttgatgacgataataaaaggaataacaac
aacaaccattttgatgatgataataaaaggaataacaacaacaaccattttgatgacgat
aataaaaggaataacaacaacaaccattttgatgacgataataaaaacaaatgtgatgat
aaaaaatttattgaaattcctaatgtatcaaatatattatcgaatgttccatatttaaaa
aagaaacatgagaaaaaaataaattccataagatatattttaaaaagacatatatcacac
ataaaaagaaataaatataaaaaaagaaatgtaatatataaaataaaaaattataaaaaa
agattgttgaagatagaaaagaatataacattattagatatatataaaaataaattaaat
aaattaaagtctaatgaaattatatatgaacaaaatttaaaaaagatagaaaaattaaac
caactaaaatgtttatatgataatctaaccactcttgataatgaaatggatacatataat
attcaaaaagaaaataattattatgaagaacaaatagaaaaaaatatgaaacaaattaat
gatatacagaaattaaaaatatggatacataccttttgtaatatcataaggaattataat
attttctatgaatttatacagaggtgtaaaaaaatacacgaacattgtgtaatctttttt
gatatcctcttttctttgttggacgttataaaaacagatttttacaaaattgtagatatg
ttgaaggaaagggatatggatttgtattattacattgagaggggcatgcaaaaaaaaata
aatgtagaaagaaatgtatgtgtagaaagaaatgtatgtgtagaaagaaatgtatgtgtg
gaaaataatatatgtgttgaaaaaaatatatgtgttgaaaaaaatatatgtggtgaaaaa
aatatatgtggtgaaaaaaaaaaaataaccaaattgaagagtaacatagaaatagaagaa
agtgtagagaagataaaggataataaaattaacgaatgtgacgtaaatgtagatacatta
aacaaaacaaatagtatccatcatgtgaataatataaaaattaatagtaaatctttagtt
tgtatgaatgaacatttgcaaaggaaaagagaaaatgaaaaactaaatgattatacatgt
aaattgaaaaaacaaaaaacacatttagatatatccattttaaaaaatagaaagtactta
gatatattgctaaatattataaatatatttatagataaatatgaaaataagataaataat
ataaaaactcttattattccattaaatcaaaaggttttagaaatatctaaaaaattaaat
aatatgaataataatataaatgaatataaaaattacttatcaaattttatacatatgctt
aaggaaaaaaaatataaagatgttaaagattttgttaattatgtagaagctattgataat
caaataaaaataaaaaaaaaaaatttatggatgttaaatggtaaagaagatctcatgaat
gaatttaagaaccatctaaaatcagatgaacaaaataatagtgataataataaaaaagtg
ggtgtagagaaaaaaaaaaaaaaaaattgtttattttgtaaaaataccatatctcaaaat
aataaagatatagtacaaatcgaaatgtatatagaagaacaaaaaagagacatgttaaaa
aaaattgaagaatctgaaaaagatattaatatattaaaaaataaaaaagaagagaatatt
attttattaaattattattattatcatataaaacatatacatacatatacgaatgattca
aatgaaatgatagtaaaattaaaagaagaactcttatctgctcaagacagtattgaaaaa
tataatataaaaataaaaaatattcatagaaaatttcaactggtacagaaatttaaagaa
acgtgtgtgtatctaattaatattcaaaaggatatattagatgtggaaaaatatataaaa
gatgaatcgataaaaataaaaggaaattttcaagaaatgaaaaataaaataaaggataac
gtggagaataataaaatgagcaataatacgaacaaatgtaatgatactaaaacgtgtaat
aacactaaaacgtgtaataatacctacacctgtgatcatttatttatagaaaagttatat
cacatgatagaaaatttagatatttccatagaagtaaaggaatctaatttattaaaaaat
attaaagaatttgttaaaaaatttgcaaaatataataacaaagatatcataaatattttt
tataataaaatttgtacatcaaatgtaaatgattcttattcatatattccttataatgat
ataattaatgtagatttatatcaacaatataattaccaaaataattataaaaatcgtttt
aaatataatttatataaaattaataatgctaattatatctgtaaattgctttcaccacat
caaaaggttagcctaaaagattgttattcaagcgatcaaacaccacaaaaaatatatgta
gatgaagaaaaagaaaaagaaaaagaaaaaaaaaaaaaaaaaaaaaaaaaaacagataat
gatggatattatgatgaaatatttcattgtgataatatggaatatgacgaacaattttat
gaagatgatgatcatcattcttataataaaagtaaaagtttaattgaaaattatataact
ccttgtaaaaataaagaagaaagtgtaaaagaacctaatatgtgtagtataaaacatata
tatgataatggatccagcaatgatgatatattaaataacgacaaaacggttcttcttaat
aaaattaatagttcttatctttcattcgtattaaatattggaacgtcctattatagcaat
gaagaaataaaagaaaataataaaaatgatacaaacaagatgtgtgatgatacaaacaag
atgtgtgatgatacaaacaaaatgtatgatgatacaaacaaaatgtatgatgatacaaac
aaaatgtatgatgatacaaacaaaatgtatgatgatacaaacaagatgtgtgatgataca
aacaaaaggtatgatgatacaaacaaaatgtgccatgatacaaacaaaatgtgtgatgat
acaaaccaaatgtatgatgatacaaacaaaaggtatgatgatacaaacaaaaggtatgat
gatacaaacaaaatgtgtgatgatacaaaccaaatgtatgatgatacaaacaaaaggtac
gataatataaatcaaaatacttatggaacatttttaaagtgttctgactttttacataat
ttaccttcaatcatactaaataataaacactttgaaaaaatgtatagaaactttttatca
tatctaaatgtagaggaatatacaagaaaagaacagaacaaaatgattgaaaaaatgaaa
gttgtcataaaggataggagagcttatgtaataaaaaaaagcaaagtattagaaaagact
ataaacatagataaaagaattagagacctaataaaaaaaatggatatttacattttatat
tataaagaaaaaaaaaagaaaattatagacgagaaaataaatgtaaaaaatttattaatt
gaacaacgggatactcaattaaaatatataaaaagatgtattagaaataataaaaaaagt
atatttttagaaaagagaaattattatttaaaaatgaatatgatatatattttgataaaa
aaattaaaacatacagaagaagaaatagtcaacaaagaaaaatatttaaaagatgtaaaa
gagaaattaaataataatgaaataattaaaaatcaagtaatttgtattgataaaaaaatt
aatgaaaaaaaagaacatattttatgtttagaaaaagaaaaaatcaatatagaaaaaatg
ttacataatattattatgaatacaaatatgaagaaaatgtatgaacaattcttggaacat
catcagacgtttatattatctttgaatcaattgaaggcatctttttttttatacgaaagg
aaaaatataaaaaatagtaatatgtgtaaattggaatataaggatgaaataaatggagat
aaaaaaaaagaaaatgataatactgtatcttcaaataatgactctataataaataatgat
aataggaataagaagaataggtacaatgatgaagagaatggaataaattatattaatgat
attgtaaaaaagcttgaagagaattataacaataatactaacatatataattttattaat
aaaacatttgatataacagattgtctaaaaaatagattaaaggatattataaaaatagaa
gaagatgatttaaatgaacaaatcgaaaagtatactaaatcaataacagccttaaaaatt
aaagaagctgaaatgaatggaaaaatatgtttaagaaaagaatatttagaaaaattaaaa
gaagatataaaatctgaaacattaattaatatagataaagaatataagaaaaaaatcatt
gaaatttttgtatacaaaaatttaatcaaagatttacaaaattttcatttctcatttgat
caagctattattaaattccattcattaaaaatgcaagaaattaatttatctattaaaaat
ctatggagaagagtatataatagtgcggatatagattatatatatattaaatcggatata
caaactgaaccaacagataaatctagtcaaagaagatcttataattatcgagttgttatg
gttaaagataattgtgaacttgatatgaaaggtagatgttcatctggtcaaaaagttcta
tcatctattattataagattagctctagctgaatcattttctattaaatgtggtatctta
gcattagatgaacctactacaaatctagataaagctaattcaagaaatttagctagccta
cttgcaaatattgtagaactaagaaaaagcagctcatcatttcaacttatacttataaca
catgataattattttgttgacatcctatcacaatatgggctaaccaactgtttctataaa
attaaaaagaacaacctagggtactcaaaaattgaaagagttaatacttga

DBGET integrated database retrieval system