KEGG   Plasmodium falciparum 3D7: PF3D7_0608700Help
Entry
PF3D7_0608700     CDS       T00095                                 

Definition
(RefSeq) T-complex protein 1 subunit zeta
  KO
K09498  T-complex protein 1 subunit zeta
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pfa03110]
    PF3D7_0608700
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfa04147]
    PF3D7_0608700
Chaperones and folding catalysts [BR:pfa03110]
 Heat shock proteins
  HSP60 / Chaperonin
   PF3D7_0608700
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PF3D7_0608700
  Exosomal proteins of colorectal cancer cells
   PF3D7_0608700
  Exosomal proteins of bladder cancer cells
   PF3D7_0608700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1 SO_alpha_A3
Motif
Other DBs
NCBI-GeneID: 3885910
NCBI-ProteinID: XP_966077
PlasmoDB: PFF0430w
GeneDB: PFF0430w
UniProt: C6KST5
Position
6:join(358391..359900,360082..360203)
Genome map
AA seq 543 aa AA seqDB search
MSIHLLNKKADSLRSTNVLMTNMNASKGMYEIIKSNLGPKGSYKMLVSSSGAIKITKDGN
VLLNEMMIQHPTASMLSRICSSIDETLGDGSSSNLIVATSLIYLSEKYILYENIHPRIIT
QGFDIAKGILLEFLDSMKIPVNIEENFDKELLYNVCKTCIRTKLPICLADKLADDLVESI
KIIYKPTKQIDLHMIEIMDIKRNMSINTKLVRGMVLDHGCRHPNMPNKLTKCFILVLNVS
LEYEKSEVFSSFVYSNAEDRDKLVESERKFTDDKVKKIIELKKILVEKKFKETNEIYNFA
VFNQKGIDPISLDLLAKENIMALRRIKRRNLERIVLCCGGNPCNNVYDLTEEDVGYAGLV
YEISINDEKYTFIEEVQNPKSCTIFIQAPNDYTIKQIKDAIRDGLRSIKNVIDDKCVLSG
AGSFEIMAYCKLKDEEKKIKGKQKFALDIYANSLLNIPKVLLENSGLDIHQTLFNVIDKY
NEDRSEPLGLDLDTGEPIIAHLKGIYDNYCVKKEILSIATAISQQILLVDEIIRAGKSMG
EEK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtccatacacctgttgaacaagaaggcggatagcttgcgttccacaaatgtgctcatg
acgaatatgaacgcaagcaaagggatgtatgaaataataaaaagtaatttaggacctaaa
ggaagttataaaatgttagttagtagttcaggtgctataaagataacaaaagatggtaat
gttttattaaatgaaatgatgattcaacatcctacagcaagtatgttaagtagaatttgc
tcaagcattgatgaaactttaggagacggttctagtagtaacttaatagttgcaacttct
ttaatatatttatcggagaaatatattttgtatgaaaatattcatccacgtattataaca
caaggatttgatatcgctaaaggtatattattagaattcttagatagtatgaaaatacct
gtaaatattgaagaaaattttgataaagaacttttatataatgtatgcaaaacatgtatt
cgaaccaaattacccatatgtttggctgataaattagctgatgaccttgtagaaagtata
aaaattatttataaacctacgaaacaaattgatttacatatgattgaaattatggatatc
aaaagaaatatgagtattaatacgaaacttgttagaggtatggtcttagatcatggatgt
cgtcatcctaatatgcctaataaattaacaaaatgttttattttagttttaaatgttagt
ttagaatatgaaaaaagtgaagtcttctcatcttttgtatattctaatgcagaagataga
gataaacttgtggaatcggaaagaaaatttacagatgataaagtaaaaaaaattattgaa
ttaaaaaaaatacttgttgaaaaaaaattcaaagaaacaaatgaaatatataattttgct
gtatttaatcaaaaaggtatagatcccataagtttagatttacttgctaaagaaaatatt
atggcattaagacgtattaaaagaagaaatctagaaagaattgttttatgttgtggaggt
aacccatgtaacaatgtatatgatttaacagaagaagatgttggatatgctggattagta
tatgaaatttccataaatgatgaaaagtatacatttattgaagaagtacaaaaccctaaa
agctgtactatctttatacaagcacctaatgattataccattaaacaaattaaagatgcc
ataagagatggtctcagaagtattaaaaatgttatcgacgataaatgtgttttatcagga
gcaggatcttttgaaattatggcatattgtaaattaaaagatgaagaaaaaaaaattaaa
ggaaaacaaaaatttgcactagatatttatgcaaatagcttgctgaatattccaaaggtc
ttgttagaaaatagtggactggatattcaccaaacattatttaatgttattgataagtat
aatgaggatcgttccgaacctttgggtttggacttggacacaggagagcccataatagct
cacttgaaaggaatttatgacaattattgtgtgaaaaaagaaatcctctccattgctaca
gccatatctcaacaaattcttttggttgatgaaattataagagcagggaaatcaatggga
gaggagaaatga

DBGET integrated database retrieval system