KEGG   Plasmodium falciparum 3D7: PF3D7_0617800
Entry
PF3D7_0617800     CDS       T00095                                 

Definition
(RefSeq) histone H2A
  KO
K11251  histone H2A
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pfa03036]
    PF3D7_0617800
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfa04147]
    PF3D7_0617800
Chromosome and associated proteins [BR:pfa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    PF3D7_0617800
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PF3D7_0617800
SSDB
Motif
Pfam: Histone Histone_H2A_C CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 3885797
NCBI-ProteinID: XP_966163
PlasmoDB: PFF0860c
GeneDB: PFF0860c
UniProt: C6KT18
Position
6:complement(748416..748814)
AA seq 132 aa
MSAKGKTGRKKASKGTSNSAKAGLQFPVGRIGRYLKKGKYAKRVGAGAPVYLAAVLEYLC
AEILELAGNAARDNKKSRITPRHIQLAVRNDEELNKFLAGVTFASGGVLPNIHNVLLPKK
SQLKAGTANQDY
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtcagcaaaaggaaaaactggtagaaaaaaagcctcaaagggaacttcaaattctgct
aaagcaggacttcaattcccagtaggaagaattggaagatatcttaaaaaaggaaaatac
gcaaaaagagtaggagcaggagcacctgtatacttagcagcagttttggaatatttatgt
gcagaaattttagaattagcaggaaatgcagcaagagataataaaaaatcaagaattacc
ccaaggcacatacaattagctgttagaaatgacgaagaattaaacaaattcttagcaggt
gtcaccttcgcttcaggaggagtattaccaaatattcacaatgttttattaccaaaaaaa
tcacaacttaaagctggtactgccaatcaagattattaa

DBGET integrated database retrieval system