KEGG   Plasmodium falciparum 3D7: PF3D7_0619400
Entry
PF3D7_0619400     CDS       T00095                                 

Definition
(RefSeq) cell division cycle protein 48 homologue, putative
  KO
K13525  transitional endoplasmic reticulum ATPase
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PF3D7_0619400
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pfa03019]
    PF3D7_0619400
   04131 Membrane trafficking [BR:pfa04131]
    PF3D7_0619400
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfa04147]
    PF3D7_0619400
Messenger RNA biogenesis [BR:pfa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     PF3D7_0619400
Membrane trafficking [BR:pfa04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    PF3D7_0619400
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PF3D7_0619400
SSDB
Motif
Pfam: AAA AAA_lid_3 CDC48_N RuvB_N AAA_16 AAA_33 AAA_2 AAA_5 TIP49 CDC48_2 AAA_22 AAA_18 AAA_14 AAA_25 RNA_helicase Mg_chelatase Vps4_C IstB_IS21 AAA_28 NACHT AAA_17 Viral_helicase1 AAA_7 ATPase_2 ABC_tran TsaE NB-ARC Zeta_toxin Parvo_NS1 DUF815 Bac_DnaA Sigma54_activ_2 AAA_24 UFD1 KAP_NTPase
Other DBs
NCBI-GeneID: 3885942
NCBI-ProteinID: XP_966179
PlasmoDB: PFF0940c
GeneDB: PFF0940c
UniProt: C6KT34
Position
6:complement(join(815622..817807,817947..818247))
AA seq 828 aa
MEDNTDKKALVDENNGENKVPKKKNLSRLIVEEATNDDNSVVALNTKRMEELNFFRGDTI
IIKGKKRHSTICIILNDNDLDEGKIRINKVARKNLRVCLGDVVYVKSCPEIPYGKKIQVL
PIDDTIEGLAKDTLFEIFLKPYFNESYRPVKKGDLFLVRGGFMSVEFKVVEVDPDDFCIV
SPDTVIYYEGDPIKRDDEEKLDEIGYDDIGGCKKQLAQIREMIELPLRHPGLFKTLGVKP
PRGVLLYGPPGSGKTCIARAVANETGAFFFLINGPEVMSKMAGEAEANLRRAFEEAEKNS
PAIIFIDEIDSIAPKREKTNGEVERRVVSQLLTLMDGIKSRGQVVVIAATNRQNSIDPAL
RRFGRFDREIDIGVPDDNGRFEILRIHTKNMKLSPDVKLEELASNTHGFVGADLAQLCTE
AALTCIREKMDVIDLEDEIIDKEVLESMCVTQDHFNMALGTCNPSSLRETVVEVPNVKWD
DIGGLDEVKSTLREMILYPIDHPDKFEKFGMSPSRGVLFYGPPGCGKTLLAKAVASECSA
NFVSIKGPELLTMWFGESEANVREVFDKARAAAPCVLFFDELDSIGTQRGSSLGDGSGAG
DRVMNQLLTEIDGVGPKKNLFFIGATNRPELLDEALLRPGRLDQLIYIPLPDLGARISIL
TAILRKCPVAENVPIDFLAQKTAGFSGADLAELCQRAARAAIRDAIDAEEMNKKSKLELS
NKKENEQNETNENDVHNKTEQQANDQQKNDDDNIKYEITRHHFKEGLAGARRSVSQADLI
KYDNFRIKFDPLYKTKTGGTGDDFIIDWPDEDNNDDTPAYVVDEDLYS
NT seq 2487 nt   +upstreamnt  +downstreamnt
atggaagataatacagataaaaaggctttggttgatgaaaataatggcgaaaataaagtt
ccaaagaaaaaaaacttaagcaggcttatagttgaagaagcaacaaatgatgataattct
gttgttgcattaaatacgaaaagaatggaagagttaaatttttttagaggtgacactata
ataattaaaggaaagaaacgacactctaccatttgtattatattgaatgacaatgattta
gatgaaggaaaaataagaataaataaggttgcaagaaaaaacttgagagtttgtttagga
gatgttgtttatgtaaagtcatgcccagaaattccttacggaaaaaaaattcaggtgtta
cccatagatgatactatcgaaggattagcaaaagatactttatttgaaatatttttaaaa
ccatactttaatgaatcttatagaccagttaaaaaaggagatttatttttagtaagaggt
ggtttcatgtccgttgaatttaaagttgttgaagtagaccctgatgatttttgtattgtt
tcacctgatacagttatttattatgaaggtgatccaataaaaagagatgatgaagaaaaa
ttagatgaaattggttatgatgatattggaggctgtaagaaacagctagctcaaataaga
gaaatgattgaattaccattaagacatcctggtttattcaaaacattaggagtgaaacca
ccaagaggtgtattattatatggacctccaggtagtggtaagacgtgtatagctagagct
gttgctaatgaaacaggtgcatttttctttttaataaatggaccagaagttatgagtaaa
atggcaggagaagctgaagcaaatttgagaagagcatttgaagaagcagaaaagaattca
cctgctattatttttattgatgaaattgattctattgctccaaaaagagaaaagactaat
ggagaagtagaaagaagagttgtttcacaattgcttacattaatggatggtataaaaagt
agaggtcaagttgttgttattgcagcaactaatagacaaaattcaattgatccagctttg
agaagatttggaagatttgatagagaaattgatattggtgtacctgatgataatggtaga
tttgaaattcttagaattcatacaaaaaatatgaaattatcacctgatgtgaaattagaa
gaattagctagtaacacacatggttttgttggtgctgatttagctcaattatgtacagaa
gctgccttgacttgtattagagaaaaaatggatgtgattgatttagaagatgaaattata
gacaaagaagttttagaaagtatgtgtgtaacacaggatcattttaatatggcattaggt
acatgtaatccatcttcattaagagaaactgttgtagaagttccaaatgtgaaatgggat
gatattggtggtttagatgaagttaaaagtacattaagagaaatgatattatatcctatt
gatcatccagataaatttgaaaagtttggaatgtctccatcaagaggagtattattttat
ggacctccaggttgtggtaaaactttactagccaaagctgtggcatcagaatgttcagct
aattttgtatctattaaaggtccagaattattaacaatgtggtttggtgaatctgaagca
aatgttagagaagtttttgataaagcaagagcagctgctccatgtgttttattttttgat
gaattagattctattggaacacaaagaggatccagtttaggtgatggaagtggtgcagga
gatcgtgttatgaatcaattattaacagaaattgatggtgtgggccctaaaaagaattta
ttctttatcggtgcaactaatagacctgaattattggatgaagctttattaagacctgga
agattagatcaattgatatatatcccattaccagatttaggtgcaagaatttctatttta
acagctattctaagaaaatgtccagttgctgaaaatgtaccaattgacttcttggctcaa
aaaacagctggttttagtggtgctgatttagcagaattatgtcagagagcagcacgagca
gctataagagatgccatagatgcagaagaaatgaataagaaatctaaattagaattaagt
aacaaaaaagaaaatgaacaaaatgaaacaaatgaaaatgatgtacataataaaacagaa
caacaagccaatgaccaacaaaagaatgatgatgataatataaaatatgaaattacaaga
catcattttaaggaaggattggctggagcaagaagaagtgtttcccaggctgatttaatt
aaatatgataactttagaataaaatttgatcctttatataaaaccaaaacaggtggaaca
ggtgatgattttattattgattggcctgatgaggacaataatgacgatacacctgcatat
gttgtagatgaagatttgtattcataa

DBGET integrated database retrieval system