KEGG   Plasmodium falciparum 3D7: PF3D7_0624700
Entry
PF3D7_0624700     CDS       T00095                                 

Definition
(RefSeq) N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, putative
  KO
K03434  N-acetylglucosaminylphosphatidylinositol deacetylase [EC:3.5.1.89]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
pfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    PF3D7_0624700
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.89  N-acetylglucosaminylphosphatidylinositol deacetylase
     PF3D7_0624700
SSDB
Motif
Pfam: PIG-L CrgA
Other DBs
NCBI-GeneID: 3885976
NCBI-ProteinID: XP_966229
UniProt: C6KT83
Position
6:complement(join(1009457..1009502,1009663..1009725,1009814..1009852,1009926..1010030,1010112..1010179,1010296..1010718))
AA seq 247 aa
MSYYIPLAIIFTIFSLILYITINYLNKKKYNFSNLLGNKNISIIVAHPDDELMFFFPTIK
FLFDKKKKKNIFLLCLSNGNYYGYGNIREQELYKVWSYIGGEKNNCHIWNDNKIQDGWLY
WDEKYIFKLIKDYCIQYDIKTIFTFDNYGVSGHPNHISAYKSIRMLSHMKDIDIYTLKST
NIIYKYMSFFSYPFITNKRYVIWSFNPLLLLRLMFFYKSQLVYYRILFCIFSQYVYFNTF
DLLKTYK
NT seq 744 nt   +upstreamnt  +downstreamnt
atgtcttactatatcccccttgcaataatcttcacaattttctcattaatattatatatc
acaattaattatttaaataagaaaaaatataacttctctaatttgttgggaaataaaaac
atcagtattatcgtagcacatccagacgatgagcttatgtttttttttccaactataaaa
tttttgtttgataaaaaaaaaaaaaaaaatatatttctcttatgtctatctaacggtaat
tattatggctatgggaatattagggaacaagaattatacaaagtgtggtcatatatagga
ggagaaaaaaataattgtcatatatggaatgataataaaatacaggatggatggctttat
tgggatgaaaaatatatattcaaattaataaaagattattgcattcaatatgatataaag
acgatatttacttttgataattacggagtatctggacaccctaatcatataagtgcttat
aagagtattaggatgttatcacatatgaaagacatagatatttacactttaaaatccaca
aacatcatatataaatacatgagcttcttttcttatccttttatcaccaacaaaaggtat
gtcatttggtcatttaatcctctcttattattaagactaatgtttttttataaatcacag
cttgtctattataggattttattctgtatattttctcaatatgtatattttaacactttt
gatttattaaagacatacaaatag

DBGET integrated database retrieval system