KEGG   Plasmodium falciparum 3D7: PF3D7_0714000
Entry
PF3D7_0714000     CDS       T00095                                 

Definition
(RefSeq) histone H2B variant
  KO
K11252  histone H2B
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    PF3D7_0714000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pfa03036]
    PF3D7_0714000
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfa04147]
    PF3D7_0714000
Chromosome and associated proteins [BR:pfa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    PF3D7_0714000
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PF3D7_0714000
SSDB
Motif
Pfam: Histone TFIID_20kDa CBFD_NFYB_HMF YscO-like
Other DBs
NCBI-GeneID: 2655098
NCBI-ProteinID: XP_001349046
PlasmoDB: PF07_0054
GeneDB: PF07_0054
UniProt: Q8IBV7
Position
7:complement(643101..643472)
AA seq 123 aa
MSGKGPAQKSQAAKKTAGKTLGPRHKRKRRTESFSLYIFKVLKQVHPETGVTKKSMNIMN
SFINDIFDRLVTEATRLIRYNKKRTLSSREIQTAVRLLLPGELSKHAVSEGTKAVTKYTT
SAA
NT seq 372 nt   +upstreamnt  +downstreamnt
atgtcaggaaaaggaccagctcaaaaatcccaagcagccaaaaaaactgctggaaaaacc
ttaggaccaagacataaaagaaaaagaagaactgaatctttttcactttacattttcaaa
gtcttaaaacaagtacatccagaaacaggagtaaccaaaaaaagtatgaatattatgaac
tcctttattaatgatatatttgacagattagttactgaagccacaagacttattcgttat
aataaaaaaagaactttatcatcacgtgaaattcaaacagctgtaagattattattacca
ggagaattatcaaaacacgccgtttcagaaggaacaaaagctgtaaccaaatatacaaca
agtgctgcttaa

DBGET integrated database retrieval system