KEGG   Plasmodium falciparum 3D7: PF3D7_0800200
Entry
PF3D7_0800200     CDS       T00095                                 

Definition
(RefSeq) erythrocyte membrane protein 1, PfEMP1
  KO
K13850  erythrocyte membrane protein 1
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa05144  Malaria
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    PF3D7_0800200
SSDB
Motif
Pfam: ATS Duffy_binding PFEMP CIDR1_gamma NTS
Other DBs
NCBI-GeneID: 2655302
NCBI-ProteinID: XP_001349513
PlasmoDB: PF08_0141
GeneDB: PF08_0141
UniProt: Q8IAK2
Structure
PDB: 
2LKL

Position
8:complement(join(29700..30878,31636..39033))
AA seq 2858 aa
MGSQGSKPVDTSDVKNESHNSARNVFENIAEIIYNRVKEDAEKRGKSLKGDYKRAKFHQP
LLEAAKYVWYAPSNPCNFDFRFDTNAPDKGSYDRDPCHLRDTNRFSDKGDAICTNNKINC
NNGGCGACAPYRRIQLCDYNLEYINEYNINSTHDLLGNLLVMAKREGDSIVNSHGHTGKG
IYKSGICTSLARSFADIGDIIRGKDLFLGHNHKKKPLLDNLEKIFNRFQKIYEDINNLPI
DDIREYWWALNRNDVWEALTCSAPYYADYFKKKSGNTYNFTTEGYCGRNEGAPPTNLDYV
PQFLRWFDEWAEEFCRIKNIKIGNIKKSCTGESNNKHCSREGYDCNKTNLRLNEIFMDLE
CPRCADDCKSYETWVENKKKEFNKQKEKYKEEINESKPGVNSEHGKYNKAFYDKLRTIYR
TNDKFFEILNKGQICENVDEKNKIDFNDLVKTFSRSEYCKSCPMLGVTCKGEQCNSLDDI
TCTNDKGGPNKVTDKNNNTFVIDILLNDNKKKVLSNDLNDYKECDLFKRLRRQNWNCKYK
CNLHVCELNNFNNEIDDERVISIKVFIKRWLESFLKDYNKLKENLNPCINNENQLPCIKD
CLENCDCVEKWIKKKGEEWKKIKERYLKDYKIEDNNSSNSLNKFLQQNQFHSDVVKAIKP
FENLRAFEDSSGCTGTVPSGIEECKSNDVIKILLSKLKEKIELCKKNDVKKNKSNNCVTL
LKPLNDEEDDEEQDDEPPAPKPLPTPNPCVNGGDDTSGAQITSVTEIAEGMHMGAQKQML
ERSGDKSGKGTENGESVLKGDIKKAKFKNGASPSSLEDVCGITDQHTKDSRRRRRLRRLR
LLVLRFRRRLRRGHRDYKGPCTGKDGHKKMFQVEKGWENGSKIGTENDVFLPPRREHFCT
SNVEHLYRSASGLQGTTASHSLLGDVLLAANKEAGFIKERYKTQKTSEGFKDEATVCRAI
KYSFADIADIIKGTDLWKANSGKKNTQDKLVKIFQKIKDNLPVNIKGKYNEDEKHLELRK
DWWFANRDKVWEAMKCEQNGITCSGPTPLDDYIPQRLRWMTEWAEWYCKAQKEAYDKLKV
CEKCMDNGKCTQGNGECAKCKTACENYKKFINTWQPQWKQMEQKYESLYKEAQENGNSSH
KSTTEQDKYMVEFLSQLQKANNGDKTGDDKVYSTAAGYVHQEATMNCEKQTQFCKNKNGV
KAANDAEDVNYTFKDTPNGYDVVCKCKDRPEQQIKKKEVEDACKIAQDIFKGKDENTTVG
LCKKKDFGRTPYPDWKCEKNSKLVTGNGECMPPRRQKLCLYFLAHKIETPNLNTQEDLRK
AFIKCAAAETFFSWYYFKKINDKLNKLDEKLKEGEIPPQFLRSMFYTFGDYKDICLDTDI
SLKTENGDITKAKSNIDRIIPKKSAKNPDEERKIWWDGIKEDVWEGMLCGLSHAVSNNDK
ATVQKTLTTKTIYDYDTVTFDGTTKLEDFSKRPQFLRWMTEWGEEFCKKRKEQLENLKDK
CPDYTCSFDTKKQECENHCKVYEEWLKGWKDQYKKQSEKFTTDKEKPEYKDDPDVASSEN
AHKYLSKKLKQIFHNGSTTEKCDYTCMEYASRQPQTSACSQQQQQQNKSSTQNHFPEAFD
YPPKEIGDRCTCPKLPEPKYCVDKTAYDIRKESGKKSDNSLKGNGNTYNNNCNNSMREEY
ANQNGETCKFNETFWSKKKPSIEECDINAKERFQIQKYWDCNGKTPDGKNTFCIPPRRKD
MCLKQLEEINSADVNNSKKLLQKIQDVAKKEGDDIIKKLLPKYPCNEDVICKAMKYSFAD
LADIVRGIDKYKGPNGTNVLEKELKSVFETIYTKWKSENTNNKSKYTDVASFRSAWWDAN
RKDIWNAMTCNAPYDAKIYITKEGGYISPLTFTKNKCGHNDDPPDYDYIPQPFRWLSEWS
ETYCLAQKDLLETMKNCENCMKKNKNADCEQTQYGACRDCKRKCEEYKKFIEIWKKQFET
QNKAYQEIYRNATTTNRDNNNIVDENTKNFVKKLQENCRTDRNESLDTADKYLENASVCR
RFKFGNKDSRHLNYAFHTDPPSYEEHCKCAKDFDPLDECPVDNNECKKYGIGSCPKKNFH
KKLEEWTNYVLNNKSNKNKSAIVPPRRRQLCLQNLTRNLSRLNKEKSFKEGILISAASEA
KMLTEQYRENPAKALQAIKYSFADIGNIIKGDDIIGNVISVQLNKLINGNKKINTSTLWW
EANKEKIWNAMMCYYTGDEKTATSCPSHGNIDKEDQFLLWFQEWGENFCARQKELYEHVQ
AECSHVICVNGTGNIDSKCTEACKNYSNFISETKNVYQSLKKQYNDNHNSIKVGGKEVHH
YMKEKCKDKCECLSEKFNSDNNWEKPYDTFDDTVLKNKCQCKKPDSPILPVEPSVPAETE
KEKKKDSPLKPHTEPKPAPPKKPEVPPPPPVQPPPANQPFNRDILEKTIPFGIALALGSI
AFLFIKKKPKSPVDLIRVLDIHKGDYGMPTLKSKNRYIPYASDTYKGKTYIYMEGDSDSG
HYYEDTTDITSSESEYEEMDINDIYVPDSPKYKTLIEVVLEPSKRDTPSSDAPMNKFTDD
EWNQLKQDFISGILENEQKDLPKNNISGNTPMNTQPNTLYFNKPEEKPFITSIHDRDLYS
GEEINYNINMSTNSMDDTSYVSNNVYSGIDLINDTLSGNQHIDIYDEVLKRKENELFGTN
YKKNTSNNNVAKLTNSDPIMNQLDLLHKWLDRHRDMCEKWKSKEDILHKLNEQWNKDNDG
GNVPIDNRSLNTDVWIEIDMDDPKGKKEFSNMDTILDDIEDDIYYDVNDDENPSVDNIPM
DHNKVDVPKKVHVEMKILNNTSNGSLEPEFPISDVWNI
NT seq 8577 nt   +upstreamnt  +downstreamnt
atgggatctcaaggatctaaacctgtggatacaagcgatgttaaaaatgaaagtcacaac
agtgccagaaatgtttttgaaaatattgcagaaataatatacaaccgagtgaaagaagat
gcagaaaaacgtggtaaatctttgaaaggagattataagagagcaaaatttcatcagccc
ttattagaggcagcgaaatatgtttggtacgctcctagtaatccatgcaattttgatttt
aggtttgatactaatgctccggataaaggttcatatgatagagatccttgtcatttgaga
gatacaaatcgtttttcagacaaaggagatgcaatatgtactaataataaaataaattgt
aataatggtggttgcggagcctgtgctccatatagaagaatacagttatgcgattataat
ttagaatatataaatgaatataatattaatagtacacatgatttattggggaacctatta
gttatggcaaaacgagaaggtgattctattgtgaacagtcatggacatacaggtaaaggt
atttataaatcaggtatatgtacttctcttgctcgaagttttgcagatataggtgatata
atcagaggaaaagatctttttctggggcataatcataaaaaaaaaccattactggataat
ttagaaaagatttttaatagatttcaaaaaatatatgaagacattaataaccttccaatt
gatgatattagagaatattggtgggcacttaatagaaatgatgtatgggaagcattgaca
tgctctgccccatattatgctgattattttaaaaaaaaatcaggtaatacttataacttt
acaactgaaggatattgtggccgtaatgaaggtgctcctcctaccaatttagattacgta
cctcaatttttaagatggtttgatgaatgggcagaagagttttgtcgaataaaaaatata
aaaataggaaatattaagaaatcctgtactggagaaagtaataataaacattgtagtcgt
gagggttacgattgtaataaaacaaatctaagacttaatgaaatttttatggatctagaa
tgtccacgttgtgcagatgattgtaaatcgtatgaaacatgggtagaaaataaaaaaaaa
gaatttaataaacaaaaagaaaaatacaaagaggagatcaatgagagcaaacctggtgtt
aattcagaacatggaaaatataataaagcattttatgataaactaagaacgatatataga
acaaatgacaaattttttgaaatattgaataaaggacaaatatgcgaaaatgttgatgaa
aagaataaaatagactttaatgaccttgtgaaaacattttcgcgttcagaatattgtaaa
tcatgtcctatgttaggtgttacctgtaagggtgaacaatgcaattcacttgatgacatc
acttgtacaaatgataaagggggtcctaataaagtaacggacaaaaataacaatacattt
gttattgatatcctgttgaatgataataaaaaaaaagtactttctaatgatttaaatgat
tataaagaatgtgatctttttaaaagactaagaaggcaaaattggaattgtaaatataaa
tgtaacttacatgtatgtgaactgaataatttcaataatgaaatagatgatgaaagagtt
atttcaatcaaagtatttattaaacgttggttagagtcttttttaaaagattataataaa
ttaaaagaaaatttaaatccatgtataaataatgaaaaccagttgccttgcataaaagat
tgtctggaaaattgtgattgcgtagaaaaatggataaaaaaaaaaggggaagaatggaaa
aaaataaaagaacgttacctaaaagattataaaattgaagataacaatagttctaatagt
ttaaataaatttttgcaacaaaatcaatttcatagtgatgttgtaaaagctataaaacct
tttgaaaatttacgcgcttttgaggactcaagtggatgtactggaactgtaccctcagga
atcgaagagtgtaaaagtaatgatgtaatcaaaattctactctctaaacttaaagaaaaa
atagaattatgtaaaaagaatgatgtcaaaaaaaataaaagtaataattgcgttacgtta
cttaaacctctaaatgacgaagaagacgatgaagaacaagacgacgaaccacctgcacca
aaacctcttcccacccctaatccgtgtgtcaatggtggagacgacacaagtggtgctcaa
atcacgagcgtgacagaaattgcagaagggatgcatatgggggcgcaaaaacaaatgtta
gagcgtagtggtgataaaagtggtaagggtactgaaaatggtgagagtgtgttgaaaggt
gatataaagaaagcgaaatttaaaaatggagctagtccgagttcattggaagacgtatgt
ggtataacggaccaacataccaaggatagtcgtcgtcgtcgtcgtcttcgtcgtcttcga
cttcttgttcttcgttttcgtcgtcgtcttcgtcgtggtcatcgagattataaaggacca
tgtacaggtaaagatggacacaaaaagatgtttcaggtagaaaaaggatgggaaaatggg
agcaaaataggtacagaaaatgacgttttcttgccaccaagacgtgaacatttttgtact
tccaatgtggaacatttgtacagaagtgccagcggacttcaaggaactactgccagccac
tctctattgggggatgtgttacttgctgcgaataaagaagcaggattcataaaagaaaga
tataagacgcaaaaaacttcagaaggttttaaggacgaggcaactgtgtgtagagcaata
aaatatagttttgctgatattgcagatataattaaaggaacagacttatggaaagcaaat
tccggaaaaaaaaatacacaagataaattggtaaaaatatttcaaaagattaaagacaat
cttcctgttaacatcaaaggaaaatataacgaagatgaaaaacatttagaattacgtaag
gattggtggtttgctaaccgtgacaaagtctgggaagcaatgaaatgcgaacaaaacggt
atcacttgtagtggtcctaccccattggatgattacatccctcaaagattacgttggatg
accgaatgggcagaatggtattgtaaagcacagaaagaggcgtatgacaagttgaaggtg
tgtgagaaatgtatggataatggaaaatgtacgcaaggtaatggcgagtgtgcaaagtgc
aagacagcatgtgaaaattataaaaaatttattaatacatggcaacctcaatggaaacaa
atggaacaaaaatacgaaagtttatacaaagaagcacaagaaaatggtaatagtagtcat
aaaagtactacagaacaagacaaatatatggtagaattcctgtcacaattacaaaaagca
aataatggcgacaaaactggtgacgataaagtgtattctactgctgcaggatatgtacac
caagaagctacaatgaattgtgagaaacaaactcagttttgtaaaaacaaaaatggtgtc
aaggcagctaatgatgcagaagacgtcaattatacctttaaggatacgcctaatgggtat
gatgtggtatgtaaatgtaaagataggccggagcaacagataaaaaaaaaggaagtagaa
gatgcgtgcaaaatagcgcaggacatatttaagggtaaggatgaaaacactacagtaggg
ctatgcaaaaaaaaagattttggaagaactccttatcccgattggaaatgtgaaaaaaat
tcaaaattggtgacaggaaatggtgaatgtatgcctccaagaagacaaaagttatgttta
tactttttggcacataaaattgaaacaccaaatttaaatacacaagaagatttgagaaag
gcttttattaaatgcgctgctgcagaaacattcttctcatggtactactttaagaaaata
aatgataaattaaataaactcgatgaaaaattaaaagaaggagaaatccctcctcaattt
ttaagatccatgttctacacatttggagattataaagatatatgtttggatactgacata
tctttaaaaactgaaaatggtgatataactaaggcaaaaagcaatatagacagaattatc
ccaaaaaaaagtgccaaaaatcctgatgaagaacgtaaaatttggtgggatggaattaaa
gaagatgtatgggaagggatgttatgtggattatcacatgctgtcagtaataatgacaaa
gcgacagtacaaaaaacacttactaccaagaccatctacgactatgacactgtgacattt
gatggtaccaccaaattggaggatttctccaagcgaccccaatttttgagatggatgacg
gaatggggggaagagttttgtaaaaaacggaaggaacaattagaaaatttaaaagacaaa
tgtccagattatacgtgtagcttcgatactaaaaaacaagaatgtgaaaatcactgtaaa
gtatatgaagaatggctaaaaggttggaaagaccaatataaaaaacaaagcgaaaaattt
acaacagataaagaaaaacctgaatataaagatgatcccgacgttgccagctccgaaaat
gctcacaaatatttgagcaaaaaattaaaacaaatttttcacaatggaagtactactgag
aaatgtgattatacgtgtatggaatatgcgtcaagacaaccacaaacatctgcttgcagt
caacaacaacaacaacaaaacaaatcatctacacaaaaccatttccctgaagcgttcgat
tatcctcctaaagaaattggtgataggtgcacttgtcctaaacttccggaacctaaatat
tgtgtagacaaaaccgcatatgatataagaaaagagagtgggaaaaagtcggataatagt
ttgaaaggaaatggtaatacatacaataataattgtaataattccatgagggaagagtat
gccaatcaaaatggagaaacatgtaaatttaacgaaacattttggtccaaaaaaaaacct
tctattgaagaatgtgatatcaatgcaaaagagcgttttcaaatacagaaatattgggat
tgtaatgggaaaacacctgatggaaaaaacacattttgtatccctccaagaagaaaagat
atgtgcttgaaacaattggaagaaataaattctgcagatgttaataatagcaaaaaatta
cttcaaaaaatccaagatgtagcaaaaaaggaaggagatgatataataaagaaactatta
ccaaaatatccttgtaatgaagatgtaatttgtaaagctatgaagtatagttttgccgat
ttagcagatattgttagaggtatagataaatataaaggtccaaatggtaccaatgtactt
gaaaaagaattaaaaagtgtttttgagacaatatatacaaaatggaaatccgaaaacaca
aataataaaagtaaatacaccgatgtagcctcttttcgttccgcctggtgggatgctaat
agaaaagatatttggaatgctatgacgtgtaatgctccttatgatgcaaaaatttatatt
accaaagaaggaggatatatatctcctttaacgttcacaaaaaacaaatgtgggcataat
gatgatccacctgattatgattatatccctcaaccttttcgatggctaagtgagtggagc
gaaacctactgtcttgctcaaaaagatttattggaaacgatgaaaaattgtgagaattgc
atgaaaaaaaacaaaaatgcagattgtgaacagacacaatatggagcttgtagggactgt
aaaagaaaatgtgaagaatacaagaaatttatagaaatttggaaaaaacagtttgaaaca
caaaacaaagcatatcaagaaatatatagaaatgctacaacaactaacagagataataat
aatattgttgatgaaaatacaaaaaattttgtaaaaaaactacaggaaaattgcagaacc
gaccgaaacgaatctcttgatactgccgataaatatcttgaaaatgcaagtgtttgtcga
agatttaaatttgggaataaggactcacgtcatctaaattatgctttccatacagatcca
cctagttatgaagagcattgcaaatgtgcgaaagattttgatccattggatgaatgtcct
gttgataataacgaatgtaagaagtatggtataggtagttgtccaaaaaaaaatttccat
aaaaaattggaagaatggacaaattacgttttaaacaacaaatcaaataaaaataaatcc
gcaatagtacctcccagaaggagacaattatgtctacaaaatcttacgagaaatttgagt
cgtctaaataaagaaaaatcatttaaagaaggaattcttatttcagctgcttcggaagct
aaaatgttaactgaacaatatcgtgagaatcctgcaaaggcacttcaagcaataaaatac
agttttgctgatattggaaatattataaagggagatgatattatagggaatgttatatct
gtccaactaaataagttaattaacggaaataaaaaaataaatacatctaccttatggtgg
gaagcaaataaagaaaaaatttggaatgccatgatgtgttattacactggagacgaaaaa
acagctactagttgtccatcacatggaaatattgataaagaagatcaatttttactatgg
tttcaggaatggggagaaaatttctgtgctagacaaaaagaattatatgaacacgtacaa
gcggaatgtagtcatgttatatgtgtcaatggtactggaaatattgacagtaaatgcact
gaagcatgtaaaaattatagtaattttatttcagaaacaaaaaacgtatatcagtcatta
aagaagcaatataatgataatcataactctatcaaagtaggtggtaaagaagttcatcat
tatatgaaagaaaaatgtaaagataaatgtgaatgtttgtctgaaaaatttaacagtgac
aacaattgggaaaaaccgtatgacacatttgacgataccgtactcaaaaacaaatgtcag
tgtaaaaaacctgattccccaattcttccagtagaaccttcagtgccagctgaaacggaa
aaagaaaaaaaaaaagattcacctcttaaaccccatactgaaccaaaacctgcacccccc
aaaaaacctgaggtacccccgcctccacccgtacaacccccccctgcgaaccaacccttc
aatcgtgacattctggaaaagaccattccttttggtattgcgttggcgttaggttcgata
gcgttccttttcataaagaaaaaaccgaaatcacctgttgacctcatacgtgtacttgac
atccacaaaggagattatggaatgcctacactgaaatcaaaaaatcgatatataccctat
gctagtgatacatataaaggcaaaacatacatttatatggaaggagatagtgatagtgga
cactactacgaagatacaactgatattacttcatccgaaagtgaatatgaagaaatggat
attaatgatatatatgtacctgatagtcctaaatataaaacattgatcgaagtagtattg
gaaccatcaaaaagagatacacctagtagtgatgcacctatgaataaatttactgatgac
gaatggaatcaactgaaacaggattttatttccggaattttagaaaatgaacaaaaggat
ttacctaaaaataatataagtgggaatactccaatgaatacacaacccaatactttatat
tttaataaacctgaagaaaaaccttttattacttctattcatgatagggatttatatagt
ggagaagaaattaattataatataaatatgagtactaatagtatggatgatacatcatat
gtatcaaataatgtatattctggtatcgatttaattaatgacacattaagtggtaaccaa
catattgatatatatgatgaagtgctaaaaagaaaagaaaatgaattatttggaacaaat
tataagaaaaatacatcaaacaataatgtagctaaattaacaaatagtgatccaattatg
aaccaattagatttgttacataaatggttagatagacatagagatatgtgtgaaaaatgg
aaaagcaaggaggatatattacataaattaaatgaacaatggaataaagataatgatgga
ggtaatgtaccaatagataacagatcgttgaatacggatgtttggattgaaatagatatg
gatgatcctaaaggaaagaaagaatttagtaatatggatactatcttggatgatatagaa
gatgatatatattatgatgtaaatgatgatgaaaacccatctgtggataatatacctatg
gatcataataaagtagatgtacctaagaaagtacatgttgaaatgaaaatccttaataat
acatccaatggatccttggaaccagaatttcctatatcggatgtatggaatatataa

DBGET integrated database retrieval system