KEGG   Plasmodium falciparum 3D7: PF3D7_0810400
Entry
PF3D7_0810400     CDS       T00095                                 

Definition
(RefSeq) aquaporin, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 2655296
NCBI-ProteinID: XP_002808836
PlasmoDB: PF08_0097
GeneDB: PF08_0097
UniProt: C0H4T7
Position
8:532220..534031
AA seq 603 aa
MKIQKGLFFLQRSIKNVLRKIIKFIKGYVKDIIKEINVKSLKKYKYNLFFEFIGSFLFVF
FISIYMLNSNSNEEYIIKHTKQINPYKTNDILIPGHNNFEAEINNIKYMNNLNQERKNVV
ASILLEKYDNEYKGNNKSKREVERDDDKISNNLQNEFEKDNEKKKNYDNINEKEISTTSD
GKIKDMEDPKNISNKNENYDNTNMELKNEKINNKVNDEKNIKNEDDINNKENMLKSVDKI
IFKEPVNEYSKIKIEDINNINLKDIDQYEVLKNSENKKSSNHAIYSFVGCFIYVIFILLG
AHINPAYTYALWLTEPKKYGFALSTLYITFQYFGGIVASIICAHLYGSIFIYTLLPKKEI
IKTFLCEFISTFLITLLLLSLYNYKKKFMEENKNDESLTFNINKLRNMSSLYNFNTYEDF
YSYDMFSTNQNRKYNSFLYIDNKYIKYIMNHIFYLLFIFFSLLFFVFVTNTTLNPMFSTS
TLYTYLYYKIFKASNSFKIYSIFISFLSITKIFQLLIFYIQSLPLWIGPYFGSAFAATFL
SLFKENEEEIINIIDTNVYSSYNKKKEQIPLIDKNSAKQNAYLIEYNDNIHNNSYNYLLP
SVF
NT seq 1812 nt   +upstreamnt  +downstreamnt
atgaaaatacaaaaagggttattttttctccaaagatctattaaaaatgtgttgagaaaa
attataaagtttatcaaaggttatgtaaaagatataataaaagagataaatgtaaaatca
ttgaaaaaatataaatataatttattttttgaatttattggttcattcctttttgttttt
tttatatccatatatatgttaaattcaaattcaaatgaagaatatataattaaacacacc
aaacaaattaacccatataaaactaatgatattttaatacctggtcataataatttcgaa
gcagaaattaataatattaaatatatgaataacttaaatcaagaaagaaaaaatgtcgta
gcaagcatattattagaaaaatatgataacgaatataaaggtaacaataaaagtaaaagg
gaagtggaaagggacgatgataaaataagcaataatttacaaaatgaatttgaaaaagat
aatgaaaaaaaaaaaaattatgataatataaatgaaaaagaaataagcactacatctgat
gggaaaataaaagatatggaggatcctaaaaatatatctaataaaaatgaaaattatgat
aatacaaatatggaattaaaaaatgagaaaataaataataaagtaaatgatgaaaaaaat
attaagaatgaagatgatataaataataaagagaatatgcttaaaagtgtagataaaatt
atttttaaagaacctgtaaatgaatatagtaaaataaaaatagaagatataaataatatc
aatttaaaagatattgatcaatatgaagtattaaaaaattcagaaaataaaaaaagtagt
aatcatgcaatatattcctttgtaggttgttttatatatgtaatatttattttgttaggt
gctcatataaatccagcttatacatatgctttatggttaacagaaccaaaaaaatatgga
tttgctctttcaacactttatattacttttcaatattttggtggtatcgttgccagtatt
atatgtgctcatttatatggtagtatatttatttatactttattaccaaaaaaagaaatt
atcaaaacctttctttgtgaatttatatcaacctttttaataactttgttattattaagt
ttatataattataaaaagaaatttatggaagaaaataaaaatgatgaatcattaacattt
aatataaacaaattaagaaatatgagttctttatataattttaatacatatgaagatttc
tattcatatgacatgttcagtacaaatcagaatagaaaatataattcttttctatatatt
gataataaatatattaaatatataatgaaccatatattttacttattatttatattcttt
tctttattattttttgtttttgtaacaaatacaacattgaatccaatgttttcaacatct
acattatatacatatttatattataaaattttcaaagcatctaattcgtttaaaatttat
tccatatttatatcatttttaagtattacaaaaatatttcaactactaatcttttatatt
cagtcgttaccattatggatagggccttattttggatcagcatttgccgcaactttcctt
tcgctttttaaagaaaacgaagaagaaattatcaacatcattgatacaaatgtatattca
tcgtataataaaaagaaagaacaaataccgttaatagataaaaacagcgcaaagcaaaat
gcttatctgattgaatacaatgataatatacataataattcatataattatttactaccc
agcgttttttaa

DBGET integrated database retrieval system