KEGG   Plasmodium falciparum 3D7: PF3D7_0814400
Entry
PF3D7_0814400     CDS       T00095                                 

Definition
(RefSeq) phospholipase DDHD1, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB
Motif
Pfam: DDHD Lipase_3 FSH1
Other DBs
NCBI-GeneID: 2655442
NCBI-ProteinID: XP_001349381
PlasmoDB: MAL8P1.91
GeneDB: MAL8P1.91
UniProt: Q8IAY0
Position
8:complement(join(695215..696717,696797..696956,697146..697522))
AA seq 679 aa
MSNHTVKVEDDDDENNEDTEKKVQSSFFFFKKQEKNVNRKFVKNTKDNDINFYEDKPILD
DKINKVDYIILIIHGIGSNEELIINQCEDLKNSFKIVKKMWFFDYPFNIHFHIFNWKKYI
IDAQIHVFNRININTMAETRKIINLSAGDIICFLHPRYGDYIMLNLYNDINKTLESLKND
SSGRFKYSKVCLLGYSLGSAMAYEILHNVKVRISESNLKYNLKSKIHYLFMLGSPLSALL
SLYKPEYINDGLKLNNGLKFYNIFHGFDPVAFRIEPLIYPGIKNIPEPVLINYWRNNGAR
YWFEWDKNMQNAKLAIVQNLNDFTSAITNGFYKFLGKNENNDEDQSTLNKNICYNKCESK
DINIFLLKVKENQRKIALQKKKIHRYNKKNNITYKENVAEKKNAHYNSIHNINDNNICDN
ICDNICENICDNICDNIRDNIRDNMRDNIRDNICDHHLNDISYNDEDSQDTYFGHEKYKR
KYDHNDEQKKEGTYYSKEENSSYIDSTKSICASQDSNSEYSFFDHELSDNSNNLYEENRR
NYDDHNKKRESICNSNNINDALNIRYDYQLQEFIMEHYIYPLAVAKSHFNYFIIKDISFF
ILKELIHHKNISLSYEEYLTKIEKEYNSKALNEKDNIKKEKYFKVAIKATKTLEEFKKYE
KNIQAMSDPFNMKNFKNLI
NT seq 2040 nt   +upstreamnt  +downstreamnt
atgagtaatcataccgtaaaggtagaagacgatgatgacgaaaacaatgaggacacagaa
aaaaaagtacagagtagtttttttttctttaaaaaacaggaaaagaatgtaaacagaaaa
tttgtaaaaaatacaaaagataatgatataaatttttatgaagacaaaccaattctggat
gataaaattaataaagttgattatattattttgattattcatggtataggatcaaatgaa
gaattaataataaaccaatgtgaagatttgaaaaatagttttaaaattgtaaaaaaaatg
tggttttttgattatccttttaatatacatttccatatatttaactggaaaaagtatatc
atcgatgcacaaatacatgtttttaacaggataaatattaatactatggctgaaactcga
aaaataataaacttgtccgccggagatattatatgttttttacatccaagatatggtgat
tacataatgttaaatttatacaatgatataaataaaacattggaatctttaaagaatgat
tctagcgggagatttaaatattccaaagtatgtttactaggttattcattaggtagtgca
atggcatatgaaatattacataacgtgaaagttcgaataagtgaaagtaatttaaaatat
aatttgaaaagtaagatacattatttatttatgttgggtagtcctttaagtgctttatta
tctttatataaaccagaatatataaatgatggattaaaattaaataatggtttaaagttt
tataatatttttcatggatttgatcctgtggcttttcgaattgaaccattgatttatcca
ggaattaaaaatattcctgaacctgttcttataaattattggagaaataatggagcaagg
tattggtttgagtgggataaaaatatgcagaatgctaaactagccattgttcaaaatttg
aatgattttacatctgcaataactaacggtttttataaatttcttgggaaaaatgagaat
aatgatgaagatcaaagtactctaaataaaaatatttgttacaataaatgtgaaagtaag
gatataaatatattcttattaaaggtgaaagaaaatcaacgaaaaattgctttacaaaaa
aaaaaaattcataggtataataaaaaaaataatattacatataaggagaatgttgcagaa
aaaaaaaatgcacattacaacagtattcataatataaatgataataatatttgtgataat
atttgtgataatatttgtgagaatatttgtgataatatttgtgataatattcgtgataat
attcgtgataatatgcgtgataatattcgtgataatatttgtgatcatcatcttaatgat
atttcttacaatgatgaagatagtcaagatacctattttggtcatgaaaaatacaaaaga
aaatatgatcataatgatgaacaaaaaaaggaaggaacttattattccaaagaagaaaat
tctagctatattgatagtactaaaagtatttgtgcatcacaagattcaaatagtgaatat
tctttttttgatcatgagcttagtgataattcgaataatttatatgaagaaaatagaaga
aattatgatgaccataataagaaaagagaatctatatgtaattctaataatataaacgat
gccttaaatattagatatgattatcaattacaagaattcattatggaacattatatatat
cctttagctgttgctaaatcacattttaattattttataattaaagatatctcctttttt
atattaaaagaattaatacatcataaaaatatatcactaagctatgaagaatatctaaca
aaaattgaaaaagaatataatagcaaagcattaaacgaaaaagataatataaaaaaagaa
aaatattttaaagttgcaataaaggctacaaaaacgttagaagaatttaaaaagtatgaa
aaaaatattcaagctatgtctgacccatttaatatgaaaaattttaaaaatttaatatag

DBGET integrated database retrieval system