KEGG   Plasmodium falciparum 3D7: PF3D7_0818900Help
Entry
PF3D7_0818900     CDS       T00095                                 

Definition
(RefSeq) heat shock protein 70
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa03040  Spliceosome
pfa04141  Protein processing in endoplasmic reticulum
pfa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    PF3D7_0818900
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PF3D7_0818900
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    PF3D7_0818900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pfa01009]
    PF3D7_0818900
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pfa03041]
    PF3D7_0818900
   03009 Ribosome biogenesis [BR:pfa03009]
    PF3D7_0818900
   03110 Chaperones and folding catalysts [BR:pfa03110]
    PF3D7_0818900
   04131 Membrane trafficking [BR:pfa04131]
    PF3D7_0818900
   03051 Proteasome [BR:pfa03051]
    PF3D7_0818900
   03029 Mitochondrial biogenesis [BR:pfa03029]
    PF3D7_0818900
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfa04147]
    PF3D7_0818900
Protein phosphatases and associated proteins [BR:pfa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PF3D7_0818900
Spliceosome [BR:pfa03041]
 Complex B
  Other components
   Prp19 complex
    PF3D7_0818900
 Complex C
   Prp19-CDC5 complex
    PF3D7_0818900
Ribosome biogenesis [BR:pfa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    PF3D7_0818900
Chaperones and folding catalysts [BR:pfa03110]
 Heat shock proteins
  HSP70 / DNAK
   PF3D7_0818900
Membrane trafficking [BR:pfa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    PF3D7_0818900
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    PF3D7_0818900
Proteasome [BR:pfa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    PF3D7_0818900
Mitochondrial biogenesis [BR:pfa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    PF3D7_0818900
Exosome [BR:pfa04147]
 Exosomal proteins
  Proteins found in most exosomes
   PF3D7_0818900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A DDR DUF5581
Motif
Other DBs
NCBI-GeneID: 2655254
NCBI-ProteinID: XP_001349336
PlasmoDB: PF08_0054
GeneDB: PF08_0054
UniProt: Q8IB24
Position
8:860384..862417
Genome map
AA seq 677 aa AA seqDB search
MASAKGSKPNLPESNIAIGIDLGTTYSCVGVWRNENVDIIANDQGNRTTPSYVAFTDTER
LIGDAAKNQVARNPENTVFDAKRLIGRKFTESSVQSDMKHWPFTVKSGVDEKPMIEVTYQ
GEKKLFHPEEISSMVLQKMKENAEAFLGKSIKNAVITVPAYFNDSQRQATKDAGTIAGLN
VMRIINEPTAAAIAYGLHKKGKGEKNILIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHL
GGEDFDNRLVNFCVEDFKRKNRGKDLSKNSRALRRLRTQCERAKRTLSSSTQATIEIDSL
FEGIDYSVTVSRARFEELCIDYFRDTLIPVEKVLKDAMMDKKSVHEVVLVGGSTRIPKIQ
TLIKEFFNGKEACRSINPDEAVAYGAAVQAAILSGDQSNAVQDLLLLDVCSLSLGLETAG
GVMTKLIERNTTIPAKKSQIFTTYADNQPGVLIQVYEGERALTKDNNLLGKFHLDGIPPA
PRKVPQIEVTFDIDANGILNVTAVEKSTGKQNHITITNDKGRLSQDEIDRMVNDAEKYKA
EDEENRKRIEARNSLENYCYGVKSSLEDQKIKEKLQPAEIETCMKTITTILEWLEKNQLA
GKDEYEAKQKEAESVCAPIMSKIYQDAAGAAGGMPGGMPGGMPGGMPGGMNFPGGMPGAG
MPGNAPAGSGPTVEEVD
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggctagtgcaaaaggttcaaaaccaaatttaccagaatccaatatcgctattggaatt
gatttaggtactacttattcttgtgttggtgtatggagaaatgaaaatgtagatattatt
gctaatgaccaaggtaatagaacaaccccatcttatgttgctttcaccgataccgaaaga
ttaattggagatgctgctaaaaaccaagtagctaggaatccagaaaatacagtatttgat
gctaagagattaattggtagaaaatttacagaatcatcagtacaaagtgatatgaaacat
tggccattcactgttaaatcaggtgttgatgagaaaccaatgattgaagttacctatcaa
ggagaaaagaaattattccatccagaagaaatttcttctatggtattacaaaaaatgaaa
gaaaatgctgaagcatttttaggaaaatctataaagaatgctgtcattaccgttccagct
tattttaacgattcacaaagacaagctactaaagatgctggtacaattgcaggattaaat
gttatgagaattattaatgaacctactgcagctgctattgcatatggtttacacaaaaaa
ggaaaaggtgaaaagaacattttaattttcgacttaggaggaggtacatttgatgtatca
ttattaactattgaagatggtatttttgaagtaaaagctactgctggtgatactcattta
ggtggtgaagatttcgataacagattagtaaatttctgtgttgaagatttcaaaagaaaa
aacagaggtaaagatttatcaaaaaatagtagagccttaagaagattaagaacacaatgt
gaaagagcaaaacgtactttatcatcatctacacaagctacaattgaaatagattcctta
tttgaaggtattgattacagtgttactgtaagtagagcaagatttgaagaattatgtatc
gactatttccgtgatactttaattccagtagaaaaagttttaaaagatgctatgatggat
aaaaaaagtgtacatgaagttgttttagttggtggttctacaagaattccaaaaatccaa
actttaataaaagaattctttaatggtaaagaagcatgcagatcaattaacccagatgaa
gctgttgcatatggtgcagctgtacaagcagccattttatctggtgaccaatcaaatgct
gtccaagatttattattattagatgtttgctccttatcattaggtttagaaactgctggt
ggtgttatgaccaaattaattgaaagaaacacaaccatacctgctaaaaagagtcaaatc
tttactacttatgctgataaccaaccaggtgtcttaattcaagtatatgaaggtgaaaga
gccttaaccaaagataacaatttattaggaaaatttcacttagatggtattccacctgca
ccaagaaaggtaccacaaatcgaagttacattcgatatcgatgctaacggtatcttaaac
gttacggctgtagaaaaatccactggtaaacaaaaccatattacaattaccaacgacaaa
ggaagattatctcaagatgaaattgatcgtatggttaatgatgctgaaaaatacaaagca
gaagatgaagaaaacagaaaaagaatcgaagcaagaaacagccttgaaaattactgctat
ggagttaaaagctcattagaagaccaaaaaattaaagaaaaattacaaccagctgaaatt
gaaacatgtatgaaaactattacaaccatacttgaatggttagaaaaaaaccaacttgct
ggaaaagatgaatatgaagccaaacaaaaagaagcagaatcggtttgtgctccaattatg
tctaaaatctatcaagatgctgctggtgcagccggtggtatgccaggaggtatgcccggt
ggaatgcccggtggaatgccaggtggtatgaatttcccaggaggtatgcccggagcagga
atgccaggaaatgccccagctggaagtggaccaacagttgaagaagttgattaa

DBGET integrated database retrieval system