KEGG   Plasmodium falciparum 3D7: PF3D7_0903200
Entry
PF3D7_0903200     CDS       T00095                                 

Definition
(RefSeq) ras-related protein RAB7
  KO
K07897  Ras-related protein Rab-7A
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa04144  Endocytosis
pfa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    PF3D7_0903200
   04145 Phagosome
    PF3D7_0903200
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pfa04131]
    PF3D7_0903200
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfa04147]
    PF3D7_0903200
   04031 GTP-binding proteins [BR:pfa04031]
    PF3D7_0903200
Membrane trafficking [BR:pfa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    PF3D7_0903200
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PF3D7_0903200
  Exosomal proteins of other body fluids (saliva and urine)
   PF3D7_0903200
  Exosomal proteins of colorectal cancer cells
   PF3D7_0903200
  Exosomal proteins of bladder cancer cells
   PF3D7_0903200
GTP-binding proteins [BR:pfa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    PF3D7_0903200
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase Septin SRPRB cobW AAA_16 AAA_22 AAA_5 AAA_24 G-alpha AAA_7 ATPase_2 FeoB_N PduV-EutP MCM NB-ARC NTPase_1 NACHT AAA TniB MMR_HSR1_Xtn AAA_14 ABC_tran
Other DBs
NCBI-GeneID: 813311
NCBI-ProteinID: XP_002808912
PlasmoDB: PFI0155c
GeneDB: PFI0155c
UniProt: C0H516 Q9NFG0
Position
9:complement(join(133762..133831,133930..134078,134204..134278,134403..134549,134706..134764,134886..134953,135535..135587))
AA seq 206 aa
MSNKKRTILKVIILGDSGVGKTSLMNQYVNKKFTNQYKATIGADFLTKETIVDNEQITMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDLTNYKTYESLESWKDEFLIQASPKDPENFPF
VIIGNKVDETNKRKVQSLKVLQWCKSNNNIPYFETSAKNAINVDQAFDEIARKAMKQEHQ
EEQIYLPETFALNNQSEQKMYKSRCC
NT seq 621 nt   +upstreamnt  +downstreamnt
atgtcaaataaaaaaagaaccatattaaaagttataattcttggagatagtggtgttggt
aaaacatcattaatgaatcaatatgtgaataaaaaatttacgaatcagtacaaagcaacg
attggtgccgactttttaactaaagaaactatagttgacaatgaacaaataactatgcag
atatgggatactgcaggacaagaacgttttcaaagtttaggagtagctttttatagaggt
gcagattgttgtgttttagtattcgatttgacaaactacaaaacttatgaatctttggaa
tcgtggaaagatgaatttttaattcaagctagtccaaaagatcctgaaaattttcctttt
gttattattggaaataaagttgatgaaacaaataaaagaaaagttcaatcattaaaagtt
ttgcaatggtgtaaatcaaataacaatattccctattttgagacaagtgcaaaaaatgca
attaatgttgatcaagcatttgatgaaatagctagaaaagctatgaagcaagaacaccag
gaagaacaaatatatttacccgaaacttttgctttaaataatcagagcgaacaaaaaatg
tacaaaagtcgttgttgttaa

DBGET integrated database retrieval system