KEGG   Plasmodium falciparum 3D7: PF3D7_0914200
Entry
PF3D7_0914200     CDS       T00095                                 

Definition
(RefSeq) phospholipid or glycerol acyltransferase, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 813419
NCBI-ProteinID: XP_001352014
PlasmoDB: PFI0695c
GeneDB: PFI0695c
UniProt: Q8I310
Position
9:complement(join(608361..608648,608878..609452,609568..609625,609740..610075))
AA seq 418 aa
MIRKLEYHIISYIIFALHVKLFMHTVFYAEWVWDLFHIYFCTIIVYVNILLIYGIRIYFG
LKKLDLKYFPLEKIASCTNYKNKKNIHPYAAFERLDLINMKFMNLFYGIIFVATWKIAFI
FFLSLMNLMVSLLIYPFLKGKSDNLESSILFLYLKFLKLVCRLAIWVFGVNKIENNYLCD
NEWPKNIVSNHISAVDPLFFISEHACSFVAKKSLSKDRMVGPSVLALKCVLVYREKSEDR
KIALESIKERQLLINAKQNNYPSFVIFSEGTTSNGLQIIEQKKGAFNSLLPITPVLLIYD
YDFYNPSYDIIPFTWWIFLSSSNYQGSTLRTYWLPKVYPPDKAQYPDLTDEERINIFHDE
VSKIMFNHMKKYNPRAPKDVDDYNDWPGSLRFKLEYFQNALGNVATKHLNKEKNLSEK
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgatcaggaagctggagtatcatattatttcctatataatatttgctcttcatgtgaag
ttatttatgcatactgtattttatgcagaatgggtttgggatctttttcatatatatttt
tgtacaattattgtatatgttaatatacttcttatatatggaatacgtatatatttcggc
ttaaaaaaattagatttaaaatatttccccctagaaaaaatagcatcttgtacaaattat
aagaataaaaaaaatatccatccttatgcagccttcgaacgtttagatttgataaacatg
aaatttatgaacttgttttatggaataatctttgtggcaacgtggaaaatagctttcatt
tttttcttatcattgatgaatctaatggtttctctgctgatatacccctttttgaagggc
aaatcggataatttggagagctcgattttatttttatatcttaaatttttaaaacttgtg
tgcagattagctatatgggtctttggtgtgaataaaatcgaaaacaactatctttgtgat
aatgaatggcccaagaacattgtatcgaatcatatatctgccgtagatcctctttttttt
ataagtgaacatgcatgtagttttgtggcaaaaaaatcgttaagtaaagaccgtatggtt
ggtccgagtgttttagctttaaaatgtgtacttgtatatagagaaaaatcagaagataga
aaaattgcattagaaagtataaaagaaaggcaattattaattaatgctaaacaaaacaat
tatccatcatttgtaatattttcagaaggtacaacatctaacggtttacaaattattgaa
caaaaaaaaggagcattcaattctttattacctataacacctgtcttgttaatatatgat
tatgatttttacaatccatcgtatgatataatacctttcacatggtggatttttctttca
tcatcaaattatcaaggaagtacattacgcacatactggttgccaaaagtataccccccc
gataaagctcaatatccagacttaacagatgaggagagaataaatatttttcatgatgaa
gtatcaaaaatcatgttcaatcatatgaaaaaatataatcctagagctccaaaagatgtg
gatgattataatgactggcctgggtccctaagatttaaattggagtattttcaaaatgcc
ttaggtaatgtggcaaccaaacatttaaataaagaaaaaaacttaagtgaaaaataa

DBGET integrated database retrieval system