KEGG   Plasmodium falciparum 3D7: PF3D7_0923200
Entry
PF3D7_0923200     CDS       T00095                                 

Definition
(RefSeq) nitric oxide synthase, putative
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PF3D7_0923200
Enzymes [BR:pfa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PF3D7_0923200
SSDB
Motif
Pfam: Flavodoxin_1 NAD_binding_1 FAD_binding_1
Other DBs
NCBI-GeneID: 813508
NCBI-ProteinID: XP_002808949
PlasmoDB: PFI1140w
GeneDB: PFI1140w
UniProt: C0H553
Position
9:944126..946468
AA seq 780 aa
MFMRWNKISRYTLLSGMVVSFWLFYRSENFNLLRRLISKLRSLFPLFIKNNFLNNEIKNS
VKIYFGSQSGTAEEFAKELKANLNDLFHIQANIIDLEYFNKEEIKSFGIRIFIVATYGDG
EPTDNAVEFFKWLKSLNNDNDYFRNTKYSIMGLGSKQYKHFNKIAKKLDTFLLNFKAHQI
SETIYGDDDDNIYHDFEVWKNKFFMQLPKLLNMKNIPIYVPKEDIIELTSWRDMAEIKLD
IQYYDHLIEEDNKKEKNVVTENIINESVTNNQQLLNHNQNNLSINNKSNYISTDIIGKFY
FNHLTGKVISNTKLLKNVDLSNNGDKVNHINISIEDNIIYKAADNLSILTKNTKEVITWW
LKRLNIDEKEKTKKFTFVKRNKLIDNSFTMNDPKDDVKNETFNNDVNKGNNKTNIDYNSN
NNGNNNNNNNYNEYDDNHIYVPFPTPCSVEDALSYYCDLTTIPRLNILKKFKCFIKDIEE
LKMFNFILSNNQRNTFFNICKECDMTFIEFVDMFMQSAVFELSPFLQLIPRNTPKSYTIS
SSPKESKDILSLTVKKKQYCIHSLRRALKNLKTNDMFPKLNEQKLRELCSRRWFKGSSSY
YLTEELNVNDIVKFNIKPSKFVLPENIQSSHIIMIATGAGIAPFKAFLSEFIYYDQQIVK
DNFVRKGKRILFYGCRKREVDFLYEMEIMDALDKKHIDETYFAFSRDQESKIYVQDLILQ
KKELVWNLLQKGAYIYVCGNSNMSKDVNKTINSLPLHFKQNDKKFTKKLKKSGRYIYEIW
NT seq 2343 nt   +upstreamnt  +downstreamnt
atgttcatgaggtggaataaaatatcacggtataccctattaagtggtatggtagtttcc
ttttggttattctatagatcagagaatttcaatttattgagaagattaattagcaagcta
agaagtttgttccctctttttataaaaaacaactttttaaataatgaaattaagaatagt
gtaaaaatatattttggtagtcagagtgggacagcagaagaatttgccaaagaattaaaa
gcgaacttgaatgatttatttcatatacaagcaaatattatcgatttagaatattttaat
aaagaagaaataaaatcttttggaatccgtatatttattgttgcaacgtatggagatgga
gaaccaacggataatgcagttgaattttttaaatggttaaaaagtttaaataatgataat
gattattttagaaatactaaatattccattatgggtttaggtagcaaacaatataaacat
tttaataagatagctaaaaaacttgatacatttcttttaaattttaaagctcatcaaatt
agtgaaactatttatggtgatgatgatgataatatatatcatgattttgaagtatggaaa
aataaattttttatgcaacttccaaaattattaaatatgaaaaatatacctatttatgta
cccaaagaagatattattgaattgacatcttggagagacatggcagaaattaagttagat
atacaatattatgatcatttaatagaagaagataataaaaaagaaaaaaatgtagtaaca
gaaaatattataaatgaaagtgttacaaataatcagcaattattgaatcataaccaaaac
aatttaagtattaataacaaatcaaattatataagtacagatataatagggaaattttat
tttaatcatcttacaggaaaagttatttccaatacaaaattattaaaaaatgtggattta
tcgaataacggagataaagttaatcatatcaatattagcattgaggataatattatttat
aaagctgcagataatttatctattttaacaaaaaatacaaaagaggtcattacctggtgg
ttaaaacgattaaacatagatgaaaaagagaaaacaaaaaaattcacctttgtaaaaaga
aataaattaatagataattcatttactatgaatgatccaaaggatgatgtaaaaaatgaa
acatttaacaatgatgttaataaagggaataataaaacaaatattgattataatagtaac
aataatggtaataataataataataataattataatgaatatgatgataatcatatatat
gtaccctttccaacaccatgtagtgttgaagatgcattatcatattattgtgatctaaca
actattccaagattgaatattttaaaaaagtttaaatgttttattaaagatatagaagaa
cttaaaatgtttaactttattttatctaacaatcaaaggaatacattctttaacatatgt
aaagaatgtgatatgacatttatagaatttgttgatatgttcatgcaaagtgctgtattt
gaattatctccatttttacaattaatacctaggaatactcctaaaagttatacaatttct
tcttctccaaaggaatcaaaagatatattatcattaactgttaagaagaaacaatattgt
atacattctcttagaagagcattaaaaaatttaaaaacaaatgatatgtttccaaaatta
aatgaacaaaagctacgagaactttgtagcagaagatggtttaagggatcatcctcatac
tatctaacagaagaattaaatgtaaatgatatagttaaattcaatataaaaccttccaaa
tttgttctcccagaaaatattcaatcatctcatattattatgattgctacaggtgcagga
attgcaccttttaaagctttcctgagcgagtttatatattatgatcaacaaattgtaaaa
gataattttgtaagaaaaggaaaaagaatattgttttatgggtgcagaaaaagagaagta
gacttcctctacgaaatggaaattatggatgctcttgacaagaaacatattgatgaaaca
tactttgcattctcacgagatcaagaaagtaaaatatatgtccaagatttaattcttcag
aaaaaggaacttgtatggaatttattacaaaagggtgcatatatttatgtttgtggaaat
agtaatatgagtaaagatgtaaacaaaaccattaatagtttgcctctccattttaaacaa
aatgataaaaaatttacgaaaaagttgaaaaaatctgggcgttatatctatgagatatgg
taa

DBGET integrated database retrieval system