KEGG   Plasmodium falciparum 3D7: PF3D7_1005000Help
Entry
PF3D7_1005000     CDS       T00095                                 

Definition
(RefSeq) methionine--tRNA ligase, putative
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa00450  Selenocompound metabolism
pfa00970  Aminoacyl-tRNA biosynthesis
pfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PF3D7_1005000
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PF3D7_1005000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pfa01007]
    PF3D7_1005000
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pfa03016]
    PF3D7_1005000
Enzymes [BR:pfa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PF3D7_1005000
Amino acid related enzymes [BR:pfa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PF3D7_1005000
Transfer RNA biogenesis [BR:pfa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PF3D7_1005000
 Prokaryotic type
   Other AARSs
    PF3D7_1005000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 810211
NCBI-ProteinID: XP_001347338
PlasmoDB: PF10_0053
GeneDB: PF10_0053
UniProt: Q8I716
Position
10:complement(225456..227705)
Genome map
AA seq 749 aa AA seqDB search
MKIYFIFILFLYLNFFILIIEILSKDIIKTRRSFPSYIKDGEKRKSNKIKRKRIKNDAYI
NVYRKNILDSINIKGDQNKIKEKWLQNLKKKKAFDKISVRLSNYNDDKKEIFDITFVNNK
EDRNDDNYDNKSCIKKVCNAEEYLLISTPVYYSNDRPHIGHAYCNILCDVLYKYEKLKGV
EKKKKGIIFFSGMDEHGLKIEKKCNKNKMKIIEYIDDISNYYKDMNKKLSVDVNLFYRTS
YSFHKMFVQNVWKYLVHNNYIYKDTYKGYYNINEERYISEQELREGKYKIDNENIIYVEE
ENSYFFNILKFKDYLIDFYEKNENFIYPPYLRKQVIYTLKNELRNICISRYNTKWAIQIP
NEAEGTIYVWFDALLSYVSSMLYLHKIKKNNNNNNNNNNKNNNNNNNKNNNNKNNKNNNN
VINCTNGTKDVNISSTCDTDSPICSYDDILNIVNLNANNNNTQSNILPHISSNICDEKKN
EKREKNIPFNKVIGKKFWNPFIQVIGKDILNFHAILYICLLKSLNLELPQKILCHGLIKN
ENIKMSKSLNNVVNPFDLLKKYNPDVLRLYFMGCGSIYEDKNYKEQNIESFELFLRNNVG
NLLYRVVSLCIENNYNMVPVIKTNDYDSNIILNEWKDNIKNKLIPYLDNMEYIQFLELIM
TLIKNVNKFFVHNTPWNYKKDTQHFHTTIYVTLECMKYFSILMFPFIPNISLAILRNIGF
DDIDEENISLDMLETRTTKFMLNGLIKIV
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttattttatttttatattatttttgtatctaaatttttttattttaattata
gaaatattaagcaaagatataataaaaactagacgctcttttccttcatatataaaggat
ggagagaaaagaaaaagcaataaaataaaaagaaaacgaataaaaaatgatgcttatata
aatgtttataggaaaaatatattggatagcataaatataaaaggtgatcaaaataaaatt
aaagaaaaatggttgcagaatttaaaaaagaaaaaagcatttgacaaaataagtgtgcgt
ttatcaaattataatgatgataaaaaagagatatttgatataacgtttgtaaataataaa
gaagacaggaatgatgataattatgataataagagttgtattaaaaaagtttgtaatgct
gaagaatatttacttattagtactcctgtatattattcaaatgatagaccacatataggt
catgcatattgtaatatattatgtgacgttctatataaatatgaaaaattaaaaggggta
gagaaaaagaaaaagggtataatttttttttcaggtatggatgagcacggtttaaaaatt
gaaaagaagtgtaataaaaataaaatgaaaataattgaatatattgatgatatatctaat
tattataaagatatgaataagaaattaagtgtggatgtaaatttattttataggacatct
tattcatttcataaaatgtttgttcagaatgtatggaaatatttagtacataataattat
atatataaagatacatataaaggttattataatattaatgaagaaagatatataagtgaa
caagaattaagagaaggtaaatataaaatagataatgaaaatattatatatgttgaagag
gaaaatagttatttttttaatatattaaaatttaaagattatttaattgatttctatgaa
aagaatgaaaattttatatatccaccatatttaagaaaacaggtaatttataccttaaaa
aatgaattaagaaatatatgtataagtaggtataatacaaagtgggcaatacaaatacct
aatgaagcagaaggtactatctacgtgtggtttgatgctttgttatcatatgtaagttct
atgttatatctacataaaataaaaaaaaataataataataataataataataataataaa
aataataataataataataataaaaataataataataaaaataataaaaataataacaat
gttataaattgtacaaatggtacaaaagatgtgaatatatcctctacatgcgatacggat
tctcccatttgctcatatgatgatattttaaatatcgtaaatttgaatgctaataataat
aatacacaaagtaatatacttccacatataagcagcaacatatgtgatgaaaaaaaaaat
gaaaaaagagaaaaaaatattccattcaacaaagtaatcggtaaaaaattctggaatcca
tttatccaagttataggtaaagatattttgaatttccatgccatattgtatatatgtttg
ttgaaaagtttaaatcttgagcttccacaaaaaattctatgtcatggtttaataaaaaat
gaaaatataaaaatgtccaagagcttaaataatgttgtaaatccatttgaccttttaaaa
aaatataatccagatgtattacgtttatattttatgggatgtggtagtatttatgaagat
aaaaattataaagaacaaaatatagagtcattcgaattatttttaagaaataacgtaggc
aatctattatatcgtgtagtatccttatgtatagaaaataattataatatggttcctgtt
ataaaaacaaatgattatgattctaatattattttaaatgagtggaaagataatataaag
aataaactcataccatatcttgataatatggaatatattcaatttttggaacttattatg
acattaataaaaaatgtaaataaattttttgtacataatacaccatggaattataaaaaa
gatacacaacattttcacacaactatttatgttactctggagtgtatgaaatatttttct
atattaatgttcccatttataccaaacatttctttggctattttaagaaatattggtttc
gatgacattgacgaggagaatatatctctcgacatgttggaaacaaggacgacaaaattt
atgcttaatgggttgataaaaatagtgtga

DBGET integrated database retrieval system