KEGG   Plasmodium falciparum 3D7: PF3D7_1008700
Entry
PF3D7_1008700     CDS       T00095                                 

Name
(RefSeq) tubulin beta chain
  KO
K07375  tubulin beta
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    PF3D7_1008700
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pfa03036]
    PF3D7_1008700
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pfa04812]
    PF3D7_1008700
   04147 Exosome [BR:pfa04147]
    PF3D7_1008700
Chromosome and associated proteins [BR:pfa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     PF3D7_1008700
Cytoskeleton proteins [BR:pfa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    PF3D7_1008700
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PF3D7_1008700
  Exosomal proteins of colorectal cancer cells
   PF3D7_1008700
  Exosomal proteins of bladder cancer cells
   PF3D7_1008700
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 810242
NCBI-ProteinID: XP_001347369
PlasmoDB: PF10_0084
GeneDB: PF10_0084
UniProt: Q7KQL5 A0A143ZWL7
Position
10:complement(join(360625..360913,361082..362034,362385..362480))
AA seq 445 aa
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGTYCGDSDLQLERVDVFYNEATGGRYV
PRAILMDLEPGTMDSVRAGPFGQLFRPDNFVFGQTGAGNNWAKGHYTEGAELIDAVLDVV
RKEAEGCDCLQGFQITHSLGGGTGSGMGTLLISKIREEYPDRIMETFSVFPSPKVSDTVV
EPYNATLSVHQLVENADEVQVIDNEALYDICFRTLKLTTPTYGDLNHLVSAAMSGVTCSL
RFPGQLNSDLRKLAVNLIPFPRLHFFMIGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
CASDPRHGRYLTACAMFRGRMSTKEVDEQMLNVQNKNSSYFVEWIPHNTKSSVCDIPPKG
LKMAVTFVGNSTAIQEMFKRVSDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEFEEEEGDVEA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgagagaaattgttcatattcaagctggccaatgtggaaatcaaataggtgcaaagttt
tgggaagtcatttctgatgagcatggaatagatccaagtggtacctattgtggggacagt
gacttacagttagaaagagttgacgttttttacaacgaagcaacaggaggtagatatgtt
ccaagagctatattgatggacttggaacctggtactatggatagtgttcgtgctggcccc
tttggtcaattatttcgtccagataattttgtgtttggtcaaacaggtgcaggaaataat
tgggctaaaggacattatactgaaggtgctgaattgatagatgcagttttagatgtcgtt
agaaaagaagcagaaggttgtgattgtttacaaggatttcagattactcattcattaggt
ggtggtacaggtagtggtatgggtactttgttgattagtaaaataagagaggagtatcct
gatcgtattatggaaacattttctgtatttccatcaccaaaagtttctgatactgttgtt
gaaccatataatgctacattatcagttcatcagttggttgaaaatgctgatgaagttcaa
gttatcgataatgaagctttatatgacatatgttttaggactcttaaattaacaacacca
acatatggagatttaaatcaccttgtatcagctgcaatgtcaggtgtaacctgttcgtta
agatttcctggtcaacttaacagtgacttaagaaaattagctgttaatttgatcccattc
ccacgtttacatttctttatgatcgggtttgctcctttaactagtagaggcagtcaacaa
tacagagccttaactgtgccggagttaacacaacaaatgttcgacgcaaaaaatatgatg
tgcgcaagtgatccaagacatggaagatatttaacggcatgtgctatgtttagaggaaga
atgtccacaaaggaagttgacgaacaaatgttaaacgttcaaaataaaaactcatcttat
tttgtcgaatggattcctcacaacacaaaatcaagtgtttgtgatattccacctaaggga
ttaaaaatggctgttacttttgtaggaaactcaaccgccattcaagaaatgtttaaaaga
gtttctgatcaatttactgctatgtttagaagaaaagcctttttgcactggtacaccgga
gaaggtatggacgagatggaatttacagaagctgaatcaaatatgaatgatttagtttca
gaatatcaacaatatcaagatgctacagcagaagaggaaggagaatttgaagaagaagaa
ggagacgtagaagcctaa

DBGET integrated database retrieval system