KEGG   Plasmodium falciparum 3D7: PF3D7_1012500
Entry
PF3D7_1012500     CDS       T00095                                 

Definition
(RefSeq) phosphoglucomutase, putative
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa00010  Glycolysis / Gluconeogenesis
pfa00030  Pentose phosphate pathway
pfa00052  Galactose metabolism
pfa00230  Purine metabolism
pfa00500  Starch and sucrose metabolism
pfa00520  Amino sugar and nucleotide sugar metabolism
pfa01100  Metabolic pathways
pfa01110  Biosynthesis of secondary metabolites
Module
pfa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF3D7_1012500
   00030 Pentose phosphate pathway
    PF3D7_1012500
   00052 Galactose metabolism
    PF3D7_1012500
   00500 Starch and sucrose metabolism
    PF3D7_1012500
   00520 Amino sugar and nucleotide sugar metabolism
    PF3D7_1012500
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PF3D7_1012500
Enzymes [BR:pfa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PF3D7_1012500
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Other DBs
NCBI-GeneID: 810280
NCBI-ProteinID: XP_001347407
PlasmoDB: PF10_0122
GeneDB: PF10_0122
UniProt: Q8IJS0
Position
10:complement(478758..480539)
AA seq 593 aa
MENIKNEQVMKFLELWNIFKKPQYLIDETIEILKKNDEEELKCLFLKRLNFGTAGLRGKM
CVGFNAMNVVTIMQTTQGLCSYLINTYGLNLCKNRGIIFGFDGRYHSESFAHVAASVCLS
KGFRVYLFAQTVATPILCYSNLKKNCLCGVMVTASHNPKLDNGYKVYASNGAQIIPPVDK
NISNCILNNLEPWKDAYEYLNENFYLKDTSLVEDIYFEMYDSFMDDLKHEFNFNCYRNSR
TKLAIVYSPMHGIGRKFVQGIMHVVGFNNLLTVPQQALPDSDFSTVSFPNPEEKGALDMS
MELADKVCSPIVVANDPDADRFACAEKFNNKWKVFSGDELGIIFAYHLMKQYEKKNIDKS
KHVFLCTVVCSRMLKKLCEKYGYKYDETLTGFKWIINKAIEYNEQNYTILYCYEEALGHA
LTRHVKDKCGISALGYWIEIAVYLYENNLTFHQYLETIREEIGYFVNNNGYYIVLDSNDI
VSIFNEFRSNGLYKTNLGSYKIIHIRDLTTGYDSTTADKKSLIAPTPDSQNITIHFENTA
ILTIRASGTEPKVKWYAEISRDTYEQAKKEIDQLIDEVMPMFMQPNKYNVKKS
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggaaaatataaaaaatgaacaggttatgaaattcctagaactgtggaatatatttaag
aaaccccagtatttaattgatgagacaatagaaatattaaaaaaaaacgatgaagaagaa
ttaaaatgtttgtttttaaaaagattaaattttggtacagctggattaagaggtaaaatg
tgtgtaggttttaatgccatgaatgtagttactataatgcaaacaacacaaggattatgt
tcatatttaataaatacatatggtttaaatttatgtaaaaatagaggtataatttttgga
ttcgatggtagatatcattctgaatcttttgctcatgtagctgcttctgtttgtttatct
aaaggatttagagtgtacttatttgcacaaacagttgctacacctatattatgttattca
aatttaaaaaagaattgtttatgtggtgttatggtcactgcttctcacaaccctaaatta
gataatggttataaagtgtatgcatctaatggagctcagataatcccaccagttgataaa
aatatttcgaattgtatattaaataatttagaaccttggaaagatgcatatgaatattta
aatgagaatttctatttaaaagatacatcattagttgaagatatatattttgaaatgtat
gattcttttatggatgatttaaaacatgaatttaattttaattgttatagaaattcacgt
acaaaactagctattgtatattcacctatgcatggtattggtagaaaatttgtacaaggt
attatgcatgtagtaggttttaataatttacttaccgttccacaacaagcattacctgat
tcagatttttcaacagtatcatttcctaatccagaagaaaaaggagcattagatatgtca
atggaactagctgataaggtatgtagtcctatagtagtagctaatgatcctgatgcagat
agatttgcttgtgcagagaaatttaataataaatggaaagttttttctggtgatgaatta
ggaataatttttgcttatcatttaatgaaacaatatgaaaaaaaaaacattgataaatcg
aaacatgtttttctatgtacagttgtgtgttcaaggatgctaaaaaaattatgtgaaaaa
tatggttataaatatgatgaaacactcacaggatttaaatggataataaataaagctata
gaatacaatgaacaaaattataccattttatattgttatgaagaagctttaggacatgct
ctaacacgacatgttaaagataaatgtggtatatctgcattaggttattggatagaaatt
gcagtatacttatatgaaaataatttaacatttcatcaatatttagaaactattagagaa
gaaataggctattttgtaaataataatggttattatattgtacttgattctaacgatatt
gtaagtatattcaatgaatttagatctaacggtttatataaaacgaatttaggttcatac
aaaattatacatattagagatttaacaacaggatatgattctactactgcagataaaaaa
tcattaatcgcacctacaccagattctcaaaatattaccatacattttgaaaatacagcc
attctaactattagggcaagtggtacagaaccaaaagtaaaatggtatgcagaaatctct
agagatacatatgaacaagccaaaaaagagatagatcaactaatagatgaagttatgcct
atgtttatgcaaccaaataaatataacgtaaagaaatcataa

DBGET integrated database retrieval system