KEGG   Plasmodium falciparum 3D7: PF3D7_1013500
Entry
PF3D7_1013500     CDS       T00095                                 

Definition
(RefSeq) phosphoinositide-specific phospholipase C
Organism
pfa  Plasmodium falciparum 3D7
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y Mcp5_PH
Other DBs
NCBI-GeneID: 810290
NCBI-ProteinID: XP_001347417
PlasmoDB: PF10_0132
GeneDB: PF10_0132
UniProt: Q8IJR0 E7EEJ9
Position
10:join(526840..530765,530911..530989,531181..531242,531358..531448)
AA seq 1385 aa
MNLSAKIDSNGYNNNIVEKNDDKRIGRIMSDDENERKDIIYNNEKNKRTSEIKVLKNDMD
NNKNDNSIQSKLSFDIKNVLTHAYLPICLEKMKEGEYVYKWNNNIFQKKTLKFFYLDVNN
YCIRWNSKKKKLSEKKNPSLYICDIIKILDGSESLFFKKKEDDKNLSIEIISTQRNLRLT
FLDIQRWKMWLFGLMYYQYKLVNKGNGKKKMKSFLYESNKLYDNYIISGLKDINALTLSQ
LYIILRSLNIYLNMQILYHYFSIYKNKAVINYIGFTKILEHIFSNTHISIYFNEYKDKKF
NYIDKKKFIEFLIDIQCEGKCEEFIFNNYYQNDTNPNLTREKNTEKLEREKKNDEDDTHY
NLDMMQSSAHNNKIYNVNNQMDDISIKYKNEDDVKPKHIFNNDNKENCNKEENNYSKSEN
NTYFNNDNNNNNKVRNEAIINNYDCNIIKKISNQYINQDDIKYNMDISNTLIFSDNSIIH
DEDYFLILDILKSKYFYHDQNKVGNKKNTHDNNYNNYNNNSANASCHHNLKDEKESKLNS
NNNNNNNNNNNVDTCINVINKNIPNIYPIKVNVIYKLLNIIKKYNIPFVINNDDNQYLTE
IGLVYFLLSKENSIMCPEYAKVYQNMNLPLCNYWINSSHNSYLARKQIFSTSNIEQYIYI
LLDGCRCVEFDCYYFNKNIVVYHGFYGYKLTSSILFCDTLIACKMFGFTTSPYPIILSLE
IHCKNKHKNLIAKILISILGNQLYIPKTTDEINNITPNNCKNKFLVKYKHFENNDSSGFY
YLFEGLQSVMYDELNYMSDILDENDELDYDNEDMDVLQQNCQGELLHNDDVDVENFDADE
DEYEMEKTFGEYIEKSIEKKYNQDSINHKQLYMKNSDSNNNVSIEKENYEEKHNKFVEDT
KKPRNILNIIKKNDNNMDNDSSDNNNNNNVKIPKNSITSCIEKKDKSKDLEEQKKKHILK
KTDNFNLKNNNLLNEYSCLKGYVFRNFYETRNYNEICSISENKFIKLIKKNENEIIKYNQ
KTLTRVYPSGTRLASTNFNPLIFWNAGIQVVALNYQYNGLSMLLNKGRFLENGGKHSGYI
LKPELLRFNEKQDYNTLLLDLQILSLHQINLLFSIKNKYHEKKLKKKLFQMDMIQRIQTH
KKIKKKIKNWKDLQKLEKEKKNILFSDVQSDDNKNKHISYELLLNKINDNDDVNYIHNKC
LNVEKKYEDMLTEYKSFLLCSSSLSHSSSFNSCSSNTTTSNDGNKTHSNKNNSSKYKNKN
FYQTFEELKKANNLFFYLYLTISIHGYNENKYYFKTEIAKVNFYDINYCWSKPSTFQMKI
SYPSLALIVFELKAYDTVKSEIIACACFPVKCLREGLRFVPLCDKYLKDIKGSGILVNLK
INQEN
NT seq 4158 nt   +upstreamnt  +downstreamnt
atgaaccttagtgcgaaaatcgattcaaatggatataataataatatagtagaaaaaaat
gatgataaaagaataggtagaattatgagcgatgatgaaaatgaaagaaaggatataata
tataataatgagaagaataagagaacgtctgaaataaaagttcttaaaaatgatatggat
aataataaaaacgacaacagtattcaatctaagttatcttttgatataaagaatgtatta
acacatgcatatttaccaatatgcttagaaaaaatgaaggagggagaatatgtttataaa
tggaataataatatatttcaaaagaaaaccttaaaatttttttatttagatgttaataat
tattgtataagatggaattcaaaaaagaaaaaattaagtgaaaaaaagaacccatcctta
tatatatgtgatataataaaaatcttagatggttcagaatctttatttttcaaaaagaaa
gaagatgataagaatttatctattgaaattataagtacacaaagaaatttaagattaacc
tttttagatatacaaagatggaaaatgtggttatttggtcttatgtattatcaatataaa
ttagttaataaaggaaatgggaaaaaaaaaatgaaatcctttttatatgaaagtaataaa
ttatatgataattatatcatatcaggattaaaagatattaatgcattaacattatctcaa
ttatacattatattgagaagtcttaatatatatttgaatatgcaaatattatatcattat
ttttctatttataaaaataaagctgttataaattatataggttttacgaaaatattagaa
catattttctcaaatacacatatttcgatatattttaatgaatataaagataaaaaattt
aattatatagataaaaaaaaatttattgaattcttaatcgatatacaatgtgaaggcaag
tgtgaagaatttatatttaataattattatcaaaatgataccaacccaaacttaacgcgt
gagaaaaatacagaaaaattagaaagagaaaagaaaaatgatgaagatgatacacattat
aacttagatatgatgcaatcatctgcacataataataaaatttataatgtaaataatcaa
atggacgacatttccataaaatacaaaaatgaagatgatgtaaaacctaaacatatattt
aataatgacaataaagaaaattgtaataaggaagaaaataattatagtaaaagtgaaaat
aatacatatttcaataatgataataataataataataaagtaagaaatgaagccattatt
aataattatgattgtaatattattaaaaaaataagtaaccaatatataaatcaggatgat
ataaaatataatatggatatatccaatacattaatattctctgataattctataatacat
gatgaagattattttttaatattggatatattaaaaagtaagtacttctatcatgatcaa
aataaagtaggtaataaaaaaaacacacatgataataattataataattataataataat
agtgctaatgcatcatgtcaccataatttaaaagatgaaaaagaatctaaattaaacagt
aataataataataacaataataataataataatgtagatacttgtatcaatgttattaat
aaaaatataccaaatatatatcccataaaagttaatgttatatataaattattaaatatt
attaaaaaatataatatcccatttgttataaataatgatgataatcaatatttaactgaa
attggtttagtttatttcttattatcaaaagaaaatagtattatgtgcccagagtatgca
aaggtatatcaaaatatgaatttacccttatgtaattactggattaatagtagtcataat
agttatttagctagaaaacaaatatttagtacaagtaatatagaacaatatatatatata
ttattagatggttgtaggtgtgtagaatttgattgttattattttaataaaaatatagta
gtgtatcatggattttatggatataaattaacttcttctatattattttgtgatacttta
atagcatgtaaaatgtttggttttaccacatctccatatccaataatattatcattagaa
attcattgtaaaaataaacataaaaatctaattgctaaaatattaatatccatattgggt
aaccaattatatatacctaaaacaacagacgaaattaataatataactccaaataattgt
aaaaataaatttttagttaaatataaacattttgagaataatgatagttcaggattttat
tatctttttgaaggactacaaagtgttatgtatgatgaactaaattatatgtctgatatt
cttgatgaaaatgatgaattggattatgataatgaggatatggatgttttgcaacaaaat
tgtcaaggcgagttattacataatgatgatgtcgatgttgaaaattttgatgcagatgag
gatgaatatgaaatggagaaaacttttggagagtacatagaaaaaagtatagaaaaaaaa
tataaccaagatagtattaatcataaacaattatacatgaaaaatagcgacagtaataat
aatgtatctatagaaaaagaaaactatgaagaaaaacacaataaatttgtggaagatacg
aaaaaacctagaaatattttaaatataataaaaaaaaatgataataatatggataatgat
tcatctgataataataataataataatgtgaagatacctaaaaattctattacatcatgt
attgagaaaaaagataaaagtaaagatttagaggaacagaaaaaaaaacatattttgaaa
aaaacagataattttaatttaaaaaataacaatctgctaaatgaatattcctgcttaaaa
ggatatgtatttcgaaatttttatgaaaccagaaattataatgaaatatgttccattagt
gaaaataaatttattaaattaattaaaaaaaacgaaaacgaaattattaaatataatcaa
aaaaccctaacaagggtttatccatcaggaacacgactagcatctaccaatttcaatcct
ttaatattttggaatgcaggtatacaagttgtagcattaaattatcaatataatggatta
agtatgttgttaaataaaggaaggtttttagaaaatggtggaaaacactcaggctatatt
ttaaaacctgaattattaagatttaatgaaaaacaagattataataccttattattagat
ttacaaatattgtcattacatcaaataaatttactattttcaataaaaaataaatatcat
gaaaaaaaactaaaaaagaaattatttcaaatggatatgattcaaagaattcaaacacat
aaaaaaataaaaaagaaaatcaaaaactggaaagatctacaaaaattagaaaaagagaag
aaaaatatacttttttcagatgttcagtcagatgataataaaaataaacatattagttat
gaattacttcttaacaaaattaatgataatgatgatgttaattatatacataataaatgt
ttaaatgtagaaaagaaatatgaagacatgttaacagaatataaatcgttcttattatgt
tcttcatccttatcacatagtagtagcttcaatagttgtagtagtaacacaactacatca
aatgatggaaataaaacacattccaataaaaataattcatccaaatataaaaacaaaaat
ttttatcaaacatttgaagaattaaaaaaagcaaataatttatttttttatctctatctt
actatatccattcatggatataatgagaacaaatattactttaaaactgaaattgcaaaa
gttaatttttatgacattaattattgttggtcaaaaccatccactttccaaatgaaaata
tcttatccttccttggctcttatagtatttgaattaaaggcatatgatactgtaaaaagt
gaaataatagcttgcgcctgctttccagttaaatgcttaagagaaggattacgatttgta
ccattgtgcgataaatatttaaaagacataaaaggatcaggaattttagttaatctaaaa
attaatcaagaaaattga

DBGET integrated database retrieval system