KEGG   Plasmodium falciparum 3D7: PF3D7_1026800
Entry
PF3D7_1026800     CDS       T00095                                 

Definition
(RefSeq) 40S ribosomal protein S2
  KO
K02998  small subunit ribosomal protein SAe
Organism
pfa  Plasmodium falciparum 3D7
Pathway
pfa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PF3D7_1026800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pfa03011]
    PF3D7_1026800
Ribosome [BR:pfa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    PF3D7_1026800
SSDB
Motif
Pfam: Ribosomal_S2
Other DBs
NCBI-GeneID: 810421
NCBI-ProteinID: XP_001347548
PlasmoDB: PF10_0264
GeneDB: PF10_0264
UniProt: Q8IJD4 A0A143ZZG2
Structure
PDB: 
3J7A 6OKK

Position
10:join(1122962..1123024,1123309..1124037)
AA seq 263 aa
MSNKKGQSPKEESIAKMLICKVHIGTKNLENKMKRYVYTRAKDGVHIINLAKTYEKLQLA
ARIIVAISNPADVVVVSARPFGSRAVLKFAQYTGAQAIAGRWTPGMLTNQIIQKFTEPRL
LIVTDPRTDAQSVKESAYANIPVIALCDSDSPLEHVDIAIPCNNKGKESIALMYWLLAQE
VLYLKGVIPRSEPWNVMVDMFLWRDPEQFELKNLANEENTPTAPHLIENQYAAEAPYDEW
TKKEEWNDNTNEDWKNPIAAEEW
NT seq 792 nt   +upstreamnt  +downstreamnt
atgagtaacaaaaaaggtcaatcccccaaagaagagagcattgctaagatgcttatatgt
aaagtgcatataggtacaaaaaatttagagaacaagatgaaaagatacgtttatacgaga
gcaaaggatggtgtacatattataaacttagcgaagacatatgagaaattacagcttgct
gcacgaattatcgtagctataagcaacccagcagatgtagtagttgtatcagcaagacct
tttggaagtagagctgtgttaaaatttgctcagtatacaggagcacaagccatagccggt
agatggactcctggtatgttaacaaatcaaattatccaaaaatttacagaaccaagatta
ttaattgtaacggatccaagaacagatgcacaatcggttaaagaatctgcatatgcaaat
atccctgtaatagcattatgtgattcagattctcctttagaacacgtagatattgcaata
ccatgtaataataaaggaaaagaatccattgcacttatgtattggttattagctcaagaa
gtattatatttaaagggtgttattccaagatcagaaccctggaatgtaatggttgacatg
tttttatggagagacccagaacaatttgaattaaaaaatctagctaatgaagaaaataca
ccaaccgctccacatttaattgaaaatcaatatgccgctgaagctccttatgatgaatgg
accaagaaagaagaatggaatgataatacaaatgaggattggaaaaatccaatagccgct
gaagagtggtaa

DBGET integrated database retrieval system